In this paper, an original approach allowing the determination of the iron losses in the electromagnetic devices is presented. This new approach exploits the Loss Surface (LS) hysteresis model and the magnetic flux density waveforms resulting from a generalized nonlinear adaptive magnetic equivalent circuit (MEC) using a mesh-based formulation in two-dimensional (2-D) or quasi three-dimensional (3-D). The model coupling has been applied to a 18-slots/16-poles radial-flux interior permanent-magnet (PM) synchronous machine (PMSM) dedicated to automotive applications, mainly for electric/hybrid/fuel cell vehicles (EVs/HEVs/FCVs). The obtained results have been compared with those made retrospectively in the 2-D transient finite-element (FE) Flux. The influence of the MEC discretization on the iron loss calculation and the electromagnetic performances has been analyzed. The computation time is divided by 3/2 with an error less than 7 %.

One of the important features of polymethine (cyanine) dyes is isomerization around one of C–C bonds of the polymethine chain. In this review, spectral properties of the isomers, photoisomerization and thermal back isomerization of carbocyanine dyes, mostly meso-substituted carbocyanine dyes, are considered. meso-Alkyl-substituted thiacarbocyanine dyes are present in polar solvents mainly as cis isomers and, hence, exhibit no photoisomerization, whereas in nonpolar solvents, in which the dyes are in the trans form, photoisomerization takes place. In contrast, the meso-substituted dyes 3,3′-dimethyl-9-phenylthiacarbocyanine and 3,3′-diethyl-9-(2-hydroxy-4-methoxyphenyl)thiacarbocyanine occur as trans isomers and exhibit photoisomerization in both polar and nonpolar solvents. The behavior of these dyes may be explained by the fact that the phenyl ring of the substituent in their molecules can be twisted at some angle, removing the substituent from the plane of the molecule and reducing its steric effect on the conformation of the trans isomer. In some cases, photoisomerization of cis isomers of meso-substituted carbocyanine dyes is also observed (for some meso-alkyl-substituted dyes complexed with DNA and chondroitin-4-sulfate; for 3,3′-diethyl-9-methoxythiacarbocyanine in moderate polarity solvents). The cycle photoisomerization–thermal back isomerization of cyanine dyes can be used in various systems of information storage and deserves further investigation using modern research methods.

In August 4 2011, United Nations Environmental Program (UNEP) submitted an unprecedented, scientific, groundbreaking Environmental Assessment Report (EAR) of Ogoniland, to the Nigerian government. This was the outcome of a 14–month intensive evaluation of the extent of pollution. It was intended that UNEP’s recommendations would be implemented to restore the devastated environment, on the one hand, and on the other, counteract the numerous environmental health issues that have for decades, plagued Ogoniland. However, five years post EAR, and, despite the seriousness of the situation, no significant resolution has occurred, both on the part of the government, and on the part of Shell Petroleum Development Company (SPDC) or Shell. To date, millions of Niger Delta residents, particularly those living in the oil-bearing communities, continue to suffer severe consequences. Although, the assessment was conducted in Ogoniland, other communities in the Niger Delta are also affected. This article explores prevailing issues, using Ogoniland (a microcosm of the Niger Delta) as an example. A multidisciplinary approach for sustainable mitigation of environmental health risks in the Niger Delta is paramount, and Environmental Management tools offer valuable strategies. Adopting UNEP’s recommendations for addressing environmental health problems requires implementing the Environmental Management/Environmental Management System (EM/EMS) model.

By using 0.35-um CMOS process, this work achieves a design of analogous band-gap reference voltage circuit with low temperature coefficient. The proposed circuit operates at 3V and generates a reference current of 44 uA. The HSPICE simulation results show the temperature coefficient of this circuit is 23 ppm/℃ at range of -10 ℃ to 100 ℃, and the line regulation (the ratio of output current variation to supply voltage variation) is estimated as 1.95 uA/V from supply voltage variation of 3 V to 5 V. The experimental chip is fabricated and measured. The circuit provides adjustable capability for output voltage among temperature variation of -10 - 100 ℃. The chip area is 534 × 695 um^2. In this new design, the operational amplifier is not necessary. The chip design effort can be great reduced.

The abundant mechanical vibration energy in bridge road environment can be converted into electric energy by using the piezoelectric energy harvest technology, which could be an efficient way to provide energy required by the wireless sensor network in the bridge condition monitoring system. An autonomous energy harvesting system has been designed based on cantilever beams for sensing and acquiring the bridge vibration energy. After the analysis of the dynamic properties of the piezoelectric cantilever beam in the energy conversion, three kinds of interface circuits were compared through simulation and experimental results. It was shown that the VD interface circuit has less power loss. Furthermore, the proposed closed loop control method based on the VD circuit was simple, adaptive, and self-powered, which is suitable for the road energy harvesting application. Finally, the energy harvesting system based on VD circuit was realized with harvested power of around 0.8mW.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Since the requirements in terms of power of the electronic applications range wide, the developed Energy Harvesting (EH) systems limit their availability to the less power demanding applications. However, this paper focuses on increasing the energy levels collected in the EH system so that it can be included in more demanding applications in terms of power. Therefore, an electronic system capable of grouping many single harvesting channels into one single system is analyzed in this paper. This multi-harvester electronic system is able to manage efficiently the energy collected by multiple vibratory transducers. The paper includes a comparison of its performance against some of the State-of-the-Art EH energy management circuits that interface the transducers. The method employed to demonstrate the intrinsic efficiency of each of the electronic circuits tested was based on experimental tests, where the average power transferred from several identical and simultaneous electric sources to a single storage element was measured. It was found out that only one energy management circuit was able to increase the transferred energy in a linear way while new input electric sources were added.

In general, a superconductor has zero resistance, although it requires significant refrigeration or high pressures with high manufacturing costs, which prevents it into practical applications. In other words, solving these issues implies main superconducting researches. To solve these problems, this paper describes a new type of superconductivity, which is independent for temperatures and which operates without pressures. The principles of the presented system are as follows:First a voltage source, a current source and a load are connected in series. Then, the voltage of the voltage source is adjusted to balance the voltage of the load. Under this condition, the balance of the two voltages provides a zero voltage between the taps of the current source and the generated current from the voltage source becomes zero because of the internal infinite resistance of the current source. As a result, the electric powers generated by the two sources are zero, and therefore, the load cannot generate Joule heating because of energy conservation. However, the current from the current source (not the voltage source) is not zero; therefore, we can predict that the resistance of the load must be zero. As a theory, we derived a new electric field and transient attractive force, which result in a very short coherence of an electron pair because there is not the Coulomb repulsive force due to the existence of the above transient attractive force. Note that both the forces are derived by the Poisson equation, which implies that they cannot be compatible. Therefore, the pair combination energy from spins becomes extremely strong, which is not destroyed by the normal heat energy. Moreover, every center-of-mass motion of electron pair results in the Bose-Einstein condensation and the macroscopic wave function, which produces the London equation (i.e., the Meissner effect). Moreover, by introducing the equivalent circuit, this paper conducted numerical calculations. As a result, we could derive numerically zero resistance and responses for additional static magnetic fields as a discharged current, which implies the Meissner effect. Note that this paper has prepared Appendix section, which provides a guide to reproduce actual experiments and preliminary experimental results. These results in the Appendix indicate the zero resistances and Meissner effects.

As a new kind of highly compact and efficient micro-channel heat exchanger, printed circuit heat exchanger (PCHE) is a promising candidate satisfying the heat exchange requirements of liquefied natural gas (LNG) vaporization at low and high pressure. The effects of airfoil fin arrangement on heat transfer an flow resistance were numerically investigated using supercritical liquefied natural gas (LNG) as a working fluid. The thermal properties of supercritical LNG were tested by utilizing a REFPROF software database. Numerical simulation was performed using FLUENT. The inlet temperature of supercritical LNG was 121 K,and its pressure was 10.5MPa. The reference mass flow rate of LNG was set 1.22 g/s for the vertical pitch L_v = 1.67 mm and the staggered pitch L_s = 0 mm, with the Reynolds number of about 3750. The SST k-ω model with enhanced wall treatment was selected by comparing with the experimental data. The airfoil fin PCHE had better thermal-hydraulic performance than that of the straight channel PCHE. Moreover, the airfoil fins with staggered arrangement displayed better thermal performance than that of the fins with parallel arrangement. The thermal-hydraulic performance of airfoil fin PCHE was improved with increasing L_s and L_v. Moreover, L_v affected on the Nusselt number and pressure drop of airfoil fin PCHE more obviously. In conclusion, a sparser staggered arrangement of fins showed a better thermal-hydraulic performance in airfoil fin PCHE.

This paper proposes a method of extracting energy from zero-point energy and evaluates the amount of energy gained. In addition, this electric circuit-based approach exhibits the Meissner effect, suggesting a new type of superconductivity that does not require refrigeration. The proposed method can provide extremely large amounts of energy, which is more than a conventional power station, without consuming fossil fuels or emitting radiation. Thus, it has the potential to solve the global energy problem. It involves preparing two electric loops containing diodes and connecting the loops together with current sources. The diodes are oriented in the same direction within each loop but in opposite directions in different loops. With this setup, the currents from the current sources build iteratively within the loops, resulting in large output currents. Our numerical analysis indicates that extremely large electric potentials are produced, which in turn yield large output currents. In addition, we confirm numerically that the voltage is zero around a loop and show analytically that the Meissner effect is present, proving the existence of a new type of superconductivity. Furthermore, when we introduce induction coils to not break the loop’s symmetry, they store extremely large amounts of energy and we can thus obtain energy from them via discharge currents.

We develop a technique for realizing lithium niobate on insulator (LNOI) waveguides of a multi-centimeter-length with a propagation loss as low as 0.027 dB/cm. Our technique relies on patterning a chromium (Cr) thin film coated on the top surface of LNOI into a hard mask with a femtosecond laser followed by the chemo-mechanical polishing for structuring the LNOI into the waveguides. The surface roughness on the waveguides is determined to be 0.452 nm with an atomic force microscope (AFM). The approach is compatible with other surface patterning technologies such as optical and electron beam lithographies or laser direct writing, enabling high-throughput manufacturing of large-scale LNOI-based photonic integrated circuits.

This article is some review of results that were obtained at 2007-2021 years development of “The Information as Absolute” concept and the informational physical model, which is based on the concept; including a number of fundamental physical problems are briefly considered in framework of the conception and the model. Recently in physics there are several publications, that present lists of the problems. However, those lists are essentially incomplete, for at least two reasons. Firsts of all, a number of phenomena are studied traditionally by philosophy, and so corresponding problems are usually considered to be “metaphysical”. However, they relate also to some concrete physical phenomena. For example, physics evidently studies Matter, and so the metaphysical problems “what is ontology of Matter”, “what is “Space”, “Time” and a few other physical phenomena and notions as well, are really a Meta-physical problems “what does physics study?” There are other fundamental physical problems, which are not considered as such in physics, and are absent in the “fundamental problems lists”. Those include the problems, which really exist, yet are incorporated into standard physical theories, and so are fundamental “implicitly”, which in physics are “solved by default” ‒ and mostly erroneously. Note, though, that a number of “Meta-physical”, and concrete fundamental, problems more in detail are considered in the paper “The Informational Conception and Basic Physics”, https://arxiv.org/abs/0707.4657, v5 (2021), so this paper is, in certain sense, an expanded conclusion of this paper, which includes, correspondingly, more in detail consideration of some more general physical problems; and, besides, in this article, the problem “what are Gravity and Electric Forces” is essentially clarified comparing with the arXiv 2021 paper version above. Besides, the concrete problem “What is Life”, and the rational cosmological model, where a few vague points in standard cosmology rather probably are rationally clarified, while the fundamental problem “matter – antimatter asymmetry” in Matter is solved practically for sure, are considered, and one of recently published rather complete “lists of fundamental problems” is commented in Appendix.

This article evaluates the macroeconomic implications of commercial bank seigniorage, which emerges from the commercial banks’ power to create money in a fractional reserves regime. After evaluating the impact on aggregate output of commercial bank money relative to alternative exchange arrangements, the article identifies the determinants of commercial bank seigniorage and analyzes how equilibrium prices are determined in an economy where commercial banks extract seigniorage. The article also identifies the conditions under which commercial banks extract seigniorage, clarifies the relationship between seigniorage from commercial bank money creation and profits from pure financial intermediation, and shows how commercial bank seigniorage changes with different types of interbank payments settlement.

This paper consists of the design and implementation of a simple conditioning circuit to optimize the electronic nose performance, where a temperature modulation method was applied to the heating resistor to study the sensor’s response and confirm whether they are able to make the discrimination when exposed to different volatile organic compounds (VOC’s). This study was based on determining the efficiency of the gas sensors with the aim to perform an electronic nose, improving the sensitivity, selectivity and repeatability of the measuring system, selecting the type of modulation (e.g., pulse width modulation) for the analytes detection (i.e., Moscatel wine samples (2% of alcohol) and ethyl alcohol (70%)). The results demonstrated that by using temperature modulation technique to the heating resistors, it is possible to realize the discrimination of VOC’s in fast and easy way through a chemical sensors array. Therefore, a discrimination model based on principal component analysis (PCA) was implemented to each sensor, with data responses obtaining a variance of 94.5% and accuracy of 100%.

During flux weakening operation time (FWOT), the total iron loss rises and affects the accuracy of loss prediction and efficiency especially if a large range of FWOT exists. Iron loss prediction is widely employed in investigations for a fast electrical machine analysis using 2-D FEA. This paper studies harmonic loss analytically by a steady-state equivalent circuit. Consideration of skin effects and iron saturation are utilized in order to examine the accuracy through the relative error distribution in the frequency domain of each model from 50 to 700 Hz. Additionally, this comparative study presents a torque-frequency-flux density calculation over each single term of the modified IEM-formula. The analytical calculation is performed using 2-D FEA for a classic and modified IEM-formula along with experimental verifications on a surface-mounted PMSG for a wind generation application.

Recent biotechnological innovations make feasible the new paradigm of creating biological neural circuits de novo. With advances in protein, cell and tissue engineering techniques, as well as cellular reprogramming methods, we are entering an era where the construction of neural circuits can open completely new ways for studying nervous systems and for treating nervous system disorders. I explore here three technologies, namely cellular engraftment, neuronal reprogramming and transsynaptic molecule engineering, and delineate how they are being used in a variety of basic research and translational medicine contexts. In basic neuroscience, neural circuit construction methods are enabling ways to study causality in neural development (e.g. neural precursor differentiation and migration) and circuit function (e.g. excitation/inhibition balance, neural population dynamics). In translational neuroscience, they are providing opportunities for the targeted correction of circuit malfunction in brain disorders, both psychiatric (e.g. schizophrenia) and neurological (e.g. Parkinson’s, Huntington’s and Alzheimer’s disease, as well as epilepsy). I discuss the challenges that these methods currently face, such as targeting specificity and cell survival, and outline future paths and opportunities to realize the full potential of technologies for creating new biological neural circuits.

Drosophila circadian circuit is one of the best described neural circuits but is complex enough to obscure our understanding of how it actually works. Animals’ rhythmic behavior, the seemingly simple outcome of their internal clocks, relies on the interaction of heterogeneous clock neurons that are spread across the brain. Direct observations of their coordinated network interactions can bring us forward in understanding the circuit. The current challenge is to observe activity of each of these neurons over a long span of time –hours to days– in live animals. Here we review the progress in circadian circuit interrogation powered by in vivo calcium imaging.

The catalytic parameters describing enzyme catalysis are discussed in the context of the design of de novo enzymes. It is shown that high values of the catalytic efficiency may in some cases reflect tight substrate binding and lead to an immediate levelling-off of rates to reach a low plateau, an undesirable scenario for many industrial applications. It is argued that increasing the catalytic rate constant should be a main target in de novo enzyme engineering.

The aim of this study was to investigate the role of DNA methylation in the regulation of in vitro and in vivo cartilage formation. Based on the data of an RNA chip-assay performed on chondrifying BMP2-overexpressing C3H10T1/2 cells, the relative expression of Tet1 (tet methylcytosine dioxygenase 1), Dnmt3a (DNA methyltransferase 3) and Ogt (O-linked N-acetylglucosamine transferase) genes was examined with RT-qPCR in mouse cell-line based and primary micromass cultures. RNA probes for in situ hybridization were used on frozen sections of 15-day-old mouse embryos. DNA methylation was inhibited with 5-azacytidine during culturing. We found very strong but gradually decreasing expression of Tet1 throughout the entire course of in vitro cartilage differentiation along with strong signals in the cartilaginous embryonic skeleton. Dnmt3a and Ogt expressions did not show significant changes with RT-qPCR and gave weak in situ hybridization signals. Inhibition of DNA methylation applied during early stages of differentiation reduced cartilage-specific gene expression and cartilage formation. In contrast, it had stimulatory effect when added to differentiated chondrocytes. Our results indicate that the DNA demethylation-inducing Tet1 is a significant epigenetic factor of chondrogenesis, and inhibition of DNA methylation exerts distinct effects in different phases of in vitro cartilage formation.

Earthquakes are one of the most catastrophic natural phenomena. After an earthquake, earthquake reconnaissance enables effective recovery by collecting building damage data and other impacts. This paper aims to identify state-of-the-art data sources for building damage assessment and provide guidance for more efficient data collection. We have reviewed 38 articles that indicate the sources used by different authors to collect data related to damage and post-disaster recovery progress after earthquakes between 2014 and 2021. The current data collection methods have been grouped into seven categories: fieldwork or ground surveys, omnidirectional imagery (OD), terrestrial laser scanning (TLS), remote sensing (RS), crowdsourcing platforms, social media (SM) and closed-circuit television videos (CCTV). The selection of a particular data source or collection technique for earthquake reconnaissance includes different criteria depending on what questions are to be answered by this data. We conclude that modern reconnaissance missions can not rely on a single data source and that different data sources should complement each other, validate collected data, or systematically quantify the damage. The recent increase in the number of crowdsourcing and SM platforms used to source earthquake reconnaissance data demonstrates that this is likely to become an increasingly important source of data.

Giant plasmonic surface enhancement has been observed in gold coated micron sized inverse pyramids entrapping a gold nanoparticle. The amplification of both surface enhanced Raman and photoluminescence signals was found to be dependent on the diameter of trapped gold nanoparticle and around 50-fold enhancement was detected for 250nm diameter sample relatively to the 50nm one. Finite differential time domain simulations, performed to determine the near-field distribution in the structure, showed that when the nanoparticle protrudes into the hotspot zone of the void, coupling of electromagnetic field occurs and the plasmon-related near-field enhancement is concentrated into the close vicinity of the nanoparticle, mainly into the close gaps around the tangential points of the curved sphere and the flat pyramid surface. This results in a more than 15 times increase of the near-field intensity, compared to the empty void.

As the rapid development of communication industry, especially the 5G communication and IOT, there will be plenty of electromagnetic (EM) waves in the free space, which carry lots of energies. However, some of these energies are wasted in free space. To reuse these wasted energies, significantly growing interests are towards to the energy harvesting antennas. This paper is aimed to investigate a wearable antenna which can transfer RF energy from ambient sources to direct current by a soft and portable textile antenna. Among the numerous signals in mobile network, the GSM 1800, 3G, WiFi and 4G/5G will be chosen due to the city signal intensity distribution. Hence, a corresponding triple bands antenna has been designed to cover those frequency bands. The CST STUDIO SUITE is used in whole process of antenna design and simulation. The proposed antenna is a hooked dipole antenna with tuning bar (HATB) whose ends have small folded part in each side for better bandwidth performance. The presented antenna provides a wide operating band from 1.8 GHz to 2.5 GHz below -10 dB in return loss. And methods to overcome interference between antennas is found. Furthermore, using the corresponding rectifier to achieve the RF/DC conversion. The overall efficiency of whole rectifier is about 56.8 %, and output power level of the antenna system is 45.92nW. The experimental results could indicate that my textile hooked antenna harvester is a good choice for the charging system of personal wearable attachment, which could achieve low power absorbing for long distance anytime and anywhere.

Expectation maximization (EM) algorithm is a powerful mathematical tool for estimating statistical parameter when data sample contains hidden part and observed part. EM is applied to learn finite mixture model in which the whole distribution of observed variable is average sum of partial distributions. Coverage ratio of every partial distribution is specified by the probability of hidden variable. An application of mixture model is soft clustering in which cluster is modeled by hidden variable whereas each data point can be assigned to more than one cluster and degree of such assignment is represented by the probability of hidden variable. However, such probability in traditional mixture model is simplified as a parameter, which can cause loss of valuable information. Therefore, in this research I propose a so-called conditional mixture model (CMM) in which the probability of hidden variable is modeled as a full probabilistic density function (PDF) that owns individual parameter. CMM aims to extend mixture model. I also propose an application of CMM which is called adaptive regressive model (ARM). Traditional regression model is effective when data sample is scattered equally. If data points are grouped into clusters, regression model tries to learn a unified regression function which goes through all data points. Obviously, such unified function is not effective to evaluate response variable based on grouped data points. The concept “adaptive” of ARM means that ARM solves the ineffectiveness problem by selecting the best cluster of data points firstly and then evaluating response variable within such best cluster. In order words, ARM reduces estimation space of regression model so as to gain high accuracy in calculation.

Barriers to inventing electronic devices involve challenges of iterating electronic designs due to long lead times for professional circuit board milling or high-costs of commercial milling machines. To overcome these barriers this study provides open source (OS) designs for a low-cost circuit milling machine. First, design modifications for mechanical and electrical sub-systems of the OS D3D Robotics prototyping system are provided. Next, Copper Carve, an OS custom graphical user interface, is developed to enable circuit board milling by implementing backlash and substrate distortion compensation. The performance of the OS D3D circuit mill is then quantified and validated for: positional accuracy, cut quality, feature accuracy and distortion compensation. Finally, the return on investment is calculated for inventors using it. The results show by properly compensating for motion inaccuracies with Copper Carve, the machine achieves a motion resolution of 10 microns, which is more than adequate for most circuit designs. The mill is at least five times less expensive than all commercial alternatives and the material costs of the D3D mill are repaid from fabricating 20-43 boards. The results show that the OS circuit mill is of high-enough quality to enable rapid invention and distributed manufacturing of complex products containing custom electronics.

This work aims to develop an integrated fault location and restoration approach for microgrids (MGs). This work contains two parts. Part I presents the fault location algorithm, and Part II shows the restoration algorithm. The proposed algorithms are implemented by particle swarm optimization (PSO). The fault location algorithm is based on network connection matrices, which are the modifications of bus-injection to branch-current and branch-current to bus-voltage (BCBV) matrices, to form the new system topology. The backward/forward sweep approach is used for the prefault power flow analysis. After the occurrence of fault, the voltage variation at each bus is calculated by using the Zbus modification algorithm to modify Zbus. Subsequently, the voltage error matrix is computed to search for the fault section by using PSO. After the allocation of the fault section, the multi-objective function is implemented by PSO for optimal restoration with its constraints. Finally, the IEEE 37-bus test system connected to distributed generations is utilized as the sample system for a series simulation and analysis. The outcomes demonstrated that the proposed optimal algorithm can effectively solve the fault location and restoration problem in MGs.

Power quality is a major concern in electrical power systems. The power quality disturbances such as sags, swells, harmonic distortion and other interruptions have impact on the electrical devices and machines and in severe cases can cause serious damages. Therefore it is required to recognize and compensate all types of disturbances at an earliest to ensure normal and efficient operation of the power system. To solve these problems, many types of power devices are used. At the present time, one of those devices, Dynamic Voltage Restorer (DVR) is the most efficient and effective device used in power distribution system. In this paper, design and modeling of a new structure of multifunctional DVR for voltage correction is presented. The performance of the device under different conditions such as voltage swell, voltage sag due to symmetrical and unsymmetrical short circuit, starting of motors, and voltage distortion are described. Simulation result shows the superior capability of proposed DVR to improve power quality under different operating conditions. The proposed new DVR controller is able to detect the voltage disturbances and control the converter to inject appropriate voltages independently for each phase and compensate to load voltage through three single- phase transformers.

In this study we used a non-autonomous Chua’s Circuit, and the fractional Lorenz chaos system together with a detection method from Extension theory to analyze the voltage signals. The measured bearing signals by acceleration sensor were introduced into the master and slave systems through a Chua’s Circuit. In a chaotic system minor differences can cause significant changes that generate dynamic errors, and extension matter-element models can be used to judge the bearing conditions. Extension theory can be used to establish classical and sectional domains using the dynamic errors of the fault conditions. The results obtained were compared with those from Discrete Fourier Transform analysis, Wavelet analysis and an integer order chaos system. The diagnostic ratio showed the fractional order master and slave chaos system calculations. The results show that the method presented in this paper is very suitable for monitoring the operational state of ball bearing system to be superior to the other methods. The diagnosis ratio was better and there were other significant advantages such as low cost and few.

Maximum likelihood estimation (MLE) is a popular method for parameter estimation in both applied probability and statistics but MLE cannot solve the problem of incomplete data or hidden data because it is impossible to maximize likelihood function from hidden data. Expectation maximum (EM) algorithm is a powerful mathematical tool for solving this problem if there is a relationship between hidden data and observed data. Such hinting relationship is specified by a mapping from hidden data to observed data or by a joint probability between hidden data and observed data. In other words, the relationship helps us know hidden data by surveying observed data. The essential ideology of EM is to maximize the expectation of likelihood function over observed data based on the hinting relationship instead of maximizing directly the likelihood function of hidden data. Pioneers in EM algorithm proved its convergence. As a result, EM algorithm produces parameter estimators as well as MLE does. This tutorial aims to provide explanations of EM algorithm in order to help researchers comprehend it. Moreover some improvements of EM algorithm are also proposed in the tutorial such as combination of EM and third-order convergence Newton-Raphson process, combination of EM and gradient descent method, and combination of EM and particle swarm optimization (PSO) algorithm.

Recently, the demand for electric vehicle is increasing worldwide due to eco-friendly policies and stricter emission regulations. As a traction motor for electric vehicle, interior permanent magnet synchronous motors are mainly used. For the design of the interior permanent magnet synchronous motor, the magnetic equivalent circuit method, which is a method of lumped constant circuit, and the finite element method, which is a method of distributed constant circuit, mainly are used. Magnetic equivalent circuit method is useful for simple design through fast and intuitive parameters, but it cannot derive the distribution of magnetic field. The finite element method can derive an accurate magnetic field distribution, but it takes a long time to analyze and it is difficult to analyze intuitive design parameters. In this paper, magnetic equivalent circuit method and Carter coefficient are mixed for rotor structure design. This design method will be called the hybrid magnetic equivalent circuit method. Intuitive design parameters are derived through this hybrid magnetic equivalent circuit method. We will derive the Air gap flux density distribution according to rotor shape, no-load induced voltage, and cogging torque, and compare and verify it with the finite element method.

Silicon-based photonic integrated circuit (PIC) is a research focus in producing high-density photonics. One of the potential applications of silicon PIC is the sensing and measurement system. In this work, we use the one-dimensional photonic crystal (1D-PhC) cavity design which and utilize it at the PIC level design. The 1D PhC design used as the compact model has the same characteristics as experimentally demonstrated in previous works. The compact model is made from the S-parameter extraction of the 1D-PhC device which is done by using Lumerical FDTD software. The PIC design integrates the 1D-PhC device as a sensing component with a PN-phase shifter (PN-PS) to function as a refractive index (RI) sensor calibration or tuning circuit. A custom design of PN-PS device is used by simulating and extracting the bias voltage-effective index (bias-Neff) data by using Lumerical DEVICE and MODE into the circuit simulator. The circuit-level simulation is done by using Lumerical Interconnect software. Finally, we show the GDSII layout design of the 1D-PhC based photonic sensor calibration circuit with an analysis of generic silicon PIC design rules. The designed PIC is applicable for the bio-sensing applications and photonic SOC component. This work also shows the promise of PIC design approach for further PIC development.

Inferring algorithmic structure in data is essential for discovering causal generative models. In this research, we present a quantum computing framework using the circuit model, for estimating algorithmic information metrics. The canonical computation model of the Turing machine is restricted in time and space resources, to make the target metrics computable under realistic assumptions. The universal prior distribution for the automata is obtained as a quantum superposition, which is further conditioned to estimate the metrics. Specific cases are explored where the quantum implementation offers polynomial advantage, in contrast to an indispensable exhaustive enumeration in the corresponding classical case. The unstructured output data and the computational irreducibility of Turing machines make this algorithm impossible to approximate using heuristics. Thus, exploring the space of program-output relations is one of the most promising problems for demonstrating quantum supremacy using Grover search that cannot be dequantized. Experimental use cases for quantum acceleration are developed for self-replicating programs and algorithmic complexity of short strings. With quantum computing hardware rapidly attaining technological maturity, we discuss how this framework will have significant advantage for various genomics applications in meta-biology, phylogenetic tree analysis, protein-protein interaction mapping and synthetic biology. This is the first time experimental algorithmic information theory is implemented using quantum computation. Our implementation on the Qiskit quantum programming platform is copy-left and can be found on https://github.com/Advanced-Research-Centre/QPULBA

Negative feedback to the back gate of MOS devices available in FD-SOI technologies can be used to improve linearity of operational amplifiers. Two operational amplifiers designed and fabricated in a 22nm FD-SOI technology illustrate this technique, its advantages and limitations.

Three-phase AC electric arc furnace (EAF) is a typical non-linear load, causing many power quality problems. Most of the researches on the voltage problems of EAF mainly focus on the voltage fluctuation, and less on the transient voltage problems caused by EAF short circuit and open circuit. In this paper, the relationship between voltage and current of EAF is obtained by combining hyperbolic function and exponential function, then the white noise and chaotic circuit are added to establish the EAF model which is suitable for the study of voltage fluctuation and transient voltage. This paper analyzes the causes of the transient voltage problem of the EAF, calculates the short-circuit current, reactive impact and the influence on voltage at the point of common coupling (PCC) in the three-phase short-circuit of the EAF, and compares the calculation results with the simulation results to prove the accuracy of this model. The results show that the reactive impact of three-phase short circuit is about twice as much as that of normal operation of EAF, resulting in about 30% voltage sag at the PCC, which is very unfavorable to the power grid. This paper provides reference for transient power quality evaluation and dynamic reactive power compensation of EAF.

In this paper, we have shown the electronic circuit equivalence of a mechanical system consists of two oscillators coupled with each other. The mechanical design has the effects of the magnetic, resistance forces and the spring constant of the system is periodically varying. We have shown that the system’s state variables, such as the displacements and the velocities, under the effects of different forces, lead to some nonlinear behaviors, like a transition from the fixed point attractor to the chaotic attractor through the periodic and quasi-periodic attractors. We have constructed the equivalent electronic circuit of this mechanical system and have verified the numerically obtained behaviors using the electronic circuit.

A new circuit model of the self-powered device for heart rate measurement is presented in this paper. This device consists of piezoelectric energy harvester (PEH), power management circuit (PMC) with energy storage, microcontroller, Photoplethysmography (PPG) sensor, and Wi-Fi module. The PEH is placed under the insole to harvest the pressure energy from human foot-step to generate ac power. In our model, a PEH is represented by sine voltage source, where its parameters were taken from experiments with 20 volunteers. The PMC is simplified by a switch with gain δ placed in series with the main circuit. The model of the main circuit is RC elements in parallel, where C is the capacitance of the storage device, and R is the equivalent parallel resistance of the microcontroller, PPG sensor, and Wi-Fi modules, respectively. The value of R depends on the power and current absorbed by those modules during sleep, deep sleep, sense, and transmit modes which collected from the datasheet. Finally, the proposed circuit model of the self-powered device was built and simulated in SPICE. The simulation results were compared with the laboratory experiment using commercial devices. Based on the results, the proposed model had small gaps compared to the real self-powered devices in terms of average current, voltage, power and efficiency.

Recently in various theoretical works, path-breaking progress has been made in recovering the well-known Page Curve of an evaporating black hole with Quantum Extremal Islands, proposed to solve the long-standing black hole information loss problem related to the unitarity issue. Motivated by this concept, in this paper, we study cosmological circuit complexity in the presence (or absence) of Quantum Extremal Islands in negative (or positive) Cosmological Constant with radiation in the background of Friedmann-Lemaî tre-Robertson-Walker (FLRW) space-time. Without using any explicit details of any gravity model, we study the behaviour of the circuit complexity function with respect to the dynamical cosmological solution for the scale factors for the above mentioned two situations in FLRW space-time using squeezed state formalism. By studying the cosmological circuit complexity, Out-of-Time Ordered Correlators, and entanglement entropy of the modes of the squeezed state, in different parameter space, we conclude the non-universality of these measures. Their remarkably different features in the different parameter space suggests their dependence on the parameters of the model under consideration.

This article will continue ansatz gage matrix of Iyer Markoulakis Helmholtz Hamiltonian mechanics points’ fields gage to Pauli Dirac monopole particle fields ansatz gage general formalism at Planck level, by constructing a Pauli Dirac Planck circuit matrix field gradient of particle monopole flow loop. This circuit assembly gage (PDPcag) that maybe operating at the quantum level, demonstrates the power of point fields matrix theoretical quantum general formalism of Iyer Markoulakis Helmholtz Hamiltonian mechanics transformed to Coulomb gage metrics, to form eigenvector fields of magnetic monopoles as well as electron positron particle gage metrics fields. Eigenvector calculations performed based on Iyer Markoulakis quantum general formalism are substituted for gage values of typical eigenvectors of dipolar magnetically biased monopoles with their conjugate eigenvectors, as well as eigenvector fields that are of the electron and positron particles. Then they are compiled to form combinatorial eigenvector matrix bundle of the monopole particle circuit field constructs assembly. Evaluation of this monopole particle fields matrix provided eigenvector fields results like SUSY, having Hermitian quantum matrix with electron-positron annihilation alongside north and south monopoles collapsing to dipolar “stable” magnetism, representing electromagnetic gaging typical metrics fields. Applying experimental observations on magnetic poles with measuring magnetic forces John Hodge’s results were showing asymmetrical pole forces; author has mathematically constructed asymmetric\strings\gage\metrics to characterize electromagnetic gravity, putting together while integrating with stringmetrics gravity that author has been reporting in earlier published articles. Physical Analysis with generalization of mass-charge and charge-fields gage metrics to quantum relativity gage metrics fields are proposed based on author’s proof formalism paper providing derivational algorithmic steps, to determine gage parametric values within the equation of Coulomb gage. Vortex fields’ wavefunctions and the scalar potential characterized by a function and a coupling constant having quantum density matrix together define the gage metrics quantifiable observable measurement physics of electron-positron cross-diagonal fields; contrastingly, diagonal terms of PDPcag matrix characterizes electron-positron particle eigenvector fields, while Hilbert Higgs mass metrics characterizes eigen-matter. Author is already working with Christopher O’Neill about magic square symmetry configurations to quantitatively understand symmetry, structure, and the real space geometry that are expected to form out of vacuum quanta point fields’ quantitative quantum general formalism theory of Iyer Markoulakis. In addition, author is currently collaborating with Manuel Malaver’s astrophysical Einstein Minkowski modified space time metrics evaluations of the sense-time-space relativistic general metrics to have means to account for curving or shaping of spacetime topology of a five-dimensional sense-time-space. Manuel Malaver’s specialization with modified Einstein Maxwell equations for modeling galaxies and stars cosmological physics, utilizing Einstein-Maxwell-Tolman- Schwarzschild and Reissner-Nordström spacetime and black holes theoretical formalisms have author of this paper collaboratively model quantum astrophysics of dark energy Star’s theory with Einstein-Gauss-Bonnet gravity equations.

We demonstrate fabrication of single-mode optical waveguides on lithium niobate on insulator (LNOI) by optical patterning combined with chemo-mechanical polishing. The fabricated LNOI waveguides have a nearly symmetric mode profile of a mode field size of ~2.5 µm (full-width at half maximum). We develop a high-precision measurement approach by which the single mode waveguides are characterized to have a propagation loss of ~0.042 dB/cm.

We report fabrication of a multifunctional photonic integrated chip on lithium niobate on insulate (LNOI), which is achieved by femtosecond laser assisted chemo-mechanical polish. We demonstrate a high extinction ratio beam splitter, a 1 × 6 optical switch, and a balanced 3 × 3 interferometer on the fabricated chip by reconfiguring the microelectrode array integrated with the multifunctional photonic circuit.

We propose a deep learning algorithm that directly compensates for luminance degradation owing to the deterioration of organic light emitting diode (OLED) devices to address the burn-in phenomenon of OLED displays. Conventional compensation circuits are encumbered by a high cost of development and manufacturing processes owing to their complexity. However, given that deep learning algorithms are typically mounted on a system on chip (SoC), the complexity of the circuit design is reduced, and the circuit can be reused by re-learning only the changed characteristics of the new pixel device. The proposed approach comprises deep feature generation and multi-stream self-attention, which decipher the importance of the variables, and the correlation between burn-in-related variables. It also utilizes a deep neural network that identifies the nonlinear relationship between the extracted features and luminance degradation. Thereafter, the luminance degradation is estimated from the burn-in-related variables, and the burn-in phenomenon can be addressed by compensating for the luminance degradation. The experimental results revealed that compensation was successfully achieved within an error range of 4.56%, and demonstrate the potential of a new approach that can mitigate the burn-in phenomenon by directly compensating for pixel-level luminance deviation.

With the development of designing and manufacturing level for micro-electromechanical system (MEMS) gyroscopes, the control circuit system becomes a key point to determine their internal performances. Nevertheless, phase delay of electron components may result in some serious hazards. This paper describes a real-time circuit phase delay correction system for MEMS vibratory gyroscopes. A detailed theoretical analysis is provided to clarify the influences of circuit phase delay on the in-phase and quadrature (IQ) coupling characteristics and zero rate output (ZRO) utilizing force-to-rebalance (FTR) closed-loop detection and quadrature correction system. By deducing the relationship between amplitude-frequency, phase-frequency of MEMS gyroscope and the phase relationship of the whole control loop, a real-time correction system is proposed to automatically adjust the phase reference value of phase-locked loop (PLL) and thus compensate for the real-time circuit phase delay. The experimental results show that the correction system can accurately measure and compensate the circuit phase delay in real time. Furthermore, the unwanted IQ coupling can be eliminated and the ZRO is decreased by 755% to 0.095°/s. This correction system realizes a small angle random walk of 0.978°/√h, and a low bias instability of 9.458°/h together with a scale factor nonlinearity of 255 ppm at room temperature. Besides, the thermal drift of ZRO is reduced to 0.0034°/s/°C at a temperature range from -20°C to 70°C.

For gravitational wave (GW) detected neutron star mergers, one of the leading candidates for electromagnetic (EM) counterparts is the afterglow from an ultra-relativistic jet. Where this afterglow is observed, it will likely be viewed off-axis, such as the afterglow following GW170817/GRB 170817A. The temporal behaviour of an off-axis observed GRB afterglow can be used to reveal the lateral jet structure, and statistical model fits can put constraints on the various model free-parameters. Amongst these parameters is the inclination of the system to the line of sight. Along with the GW detection, the afterglow modelling provides the best constraint on the inclination to the line-of-sight and can improve the estimates of cosmological parameters e.g. the Hubble constant, from GW-EM events. However, modelling of the afterglow depends on the assumed jet structure and, often overlooked, the effects of lateral spreading. Here we show how the inclusion of lateral spreading in the afterglow models can affect the estimated inclination of GW-EM events.

The goal of this paper is to present a low-cost, low-power prototype of a pulsed Ultra Wide Band UWB) oscillator and an UWB elliptical dipole antenna integrated on the same Radio Frequency (RF) Printed Circuit Board (PCB) and its digital control board for Real Time Locating System (RTLS) applications. The design is compatible with IEEE 802.15.4 high rate pulse repetition UWB standard being able to work between 6 GHz and 8.5 GHz with 500 MHz bandwidth and with a pulse duration of 2 ns. The UWB system has been designed using the CST Microwave Studio transient Electro-Magnetic (EM) circuit co-simulation method. This method integrates the functional circuit simulation together with the full wave (EM) simulation of the PCB’s 3D model allowing fast parameter tuning. The PCB has been manufactured and the entire system has been assembled and measured. Simulated and measured results are in excellent agreement with respect to the radiation performances as well as the power consumptions.

The continuous flowing spacetime forms a spacetime group G, one of its fundamental groups is the Poincare group PO(1,3), and the matter and interaction fields are representations of its intrinsic spacetime group. As a kind of quantized space-time unit, space-time group elements generate both space-time manifolds and matter. Matter and fields are aggregates of the quantum space-time within them and determine their type: the Lorentz group SO(1,3) represents a rotating spacetime corresponding to visible matter and the translation group P^1,3 represents a translational spacetime corresponding to dark matter and dark energy. The aggregation mode of space-time degrees of freedom in matter reveals that charge conjugation symmetry is the inverse symmetry of internal time of charged particles, and the external parity breaking of neutrinos is also due to their internal spatial aggregation mode.

Negative corona discharges occur widely in high voltage transmission lines and charged aircraft, which can cause strong electromagnetic interference. Negative corona discharge is typically performed simultaneously at multiple discharge points. In this study, the current and its EM radiation characteristics of single-needle and multi-needle negative corona discharge in different conditions were tested. The current and electromagnetic radiation characteristics of the two discharge structures were compared. The dipole radiation model was established to analyze the EM radiation characteristics of the negative corona discharge.The results show that, It is only when the voltage reaches a certain threshold that the current and electromagnetic radiation fields of the multi-needle discharge structure will be superimposed and their amplitudes will increase significantly. The frequency of electromagnetic radiation signal does not change with the number of needles, cathode geometry and applied voltage, but only depends on ambient pressure. It provides a basis for detecting corona discharge sources under different conditions.

Ensuring a protection scheme in DC distribution is more difficult to achieve against pole-to-ground fault than in AC distribution system because of the absence of zero crossing points and low line impedance. To complement the major obstacle of limiting the fault current, several compositions have been proposed related to mechanical switching and solid-state switching. Among them, solid-state circuit breakers(SSCBs) are considered a possible solution to limit fast fault current. However, they may cause problems in circuit complexity, reliability and cost-related troubles due to the use of multiple power semiconductor devices and additional circuit configuration to commutate current. This paper proposes the SSCB with a coupled inductor(SSCB-CI) which has symmetrical configuration. The circuit is comprised of passive components like commutation capacitors, a CI and damping resistors. Thus, proposed SSCB-CI offers the advantages of simple circuit configuration and fewer utilized power semiconductor devices than another typical SSCBs in LVDC microgrid. For analysis, six operation states are described for the voltage across main switches and fault current. The effectiveness of the SSCB-CI against a short-circuit fault is proved via simulation and experimental results in a lab-scale prototype.

In GDI engine applications, high-pressure (H.P.) injectors typically require to be designed to be capable of rapid response for GDI engines in order to be driven in the rapid response with respect to magnetic actuators, allowing for example more precise air-fuel ratio control in the GDI engines. The H.P. fuel injector is a highly dynamic component requiring careful voltage and pressure input modulation to achieve the required fuel injection quantities of GDI engines. The accurate fuel injection curves are a key influence for this technology, therefore will require the estimation of the fuel flow rate to be realized. In this paper, a PIC microchip for programming injector drive circuits is implemented to improve the performance of a H.P. fuel injector and tested to verify its feasibility. In the proposed injector drive circuit, powers MOSFETs directly control the charging/discharging current by a dsPIC30F4011 microchip. Design and analysis of the proposed injector drive circuit are presented. Next, effects of total pulse width, injector supply voltage, fuel system pressure and PWM operation on fuel injection quantities of a H.P. fuel injector are measured. Also, the measured data of the H.P. fuel injector fed by the injector driving circuit are defined as the fuel injection curves. Finally experimental results are provided for verification of the proposed injector drive circuit.

The most common and taught membrane theory assumes that the membrane behaves as a kind of electrical capacitance that is exposed to an electrical current generated by an ionic flow. If this statement is verifiable, it can be confirmed by the laws of physics, mathematics and in particular electricity. We will demonstrate that this hypothesis is not verified and that it is necessary to modify biophysics according to already established and experimentally verified principles of physics.

Learning models of the cerebellum propose that the cerebellum implements an algorithm which makes iterative adjustments to synaptic transmission strength that collectively determine the response to input in learned patterns following training. We propose instead that pattern recognition and control of firing by output cells are separately handled functions which process independently variable data. This can account for the evidence without a machine learning algorithm. The model is a hybrid of physiological arguments and computational methods used to test and quantify the ideas. We argue inter alia that learning operates at the level of functional groups of Purkinje cells defined by their shared climbing fibre input; Golgi cells have several functions and regulation of parallel fibre activity by Golgi cells is not in the expected way; recoding of input to the cerebellum received in the granular layer converts the number of input variables (variables expressed in mossy fibre input to the system) into a much reduced number of functional variables expressed by internal signals traffic; circuits simultaneously execute separate but integrated functions of pattern memory and output coding; they are able to operate separately because the expression of data used in each varies independently of the other; output rates are not learned but controlled by recent relevant input signals in a window opened by pattern memory; the moment-to-moment probability that a Purkinje cell spikes is synchronised across a microzone; a principal function of functional organisation of Purkinje cells into microzones is to increase resolution of rate coded information received by the output cells of the circuit, and to do so in a very short integration window, so that circuit architecture can be explained partly as a device with this function.

The authors of the article performed computer simulation of buffer amplifiers (BA), which have medium and extremely small values of the offset voltage's systematic component (V_off), for different technological processes (Si, GaAs and GaN). The proposed control units are distinguished by a small number of elements and allow operation in the range of low and high temperatures. The variants of circuitry implementation of control units based on GaAs, GaN depletion-mode CMOS and JFET technological processes are considered. The results of the comparative modeling showed that the basic circuit of the BA on two field-effect transistors, when implemented on various modifications of GaN MOS and depletion-mode MOS transistors, provides sufficiently low values of the offset voltage's systematic component (less than 2 μV). The proposed BAs are designed for use in the structure of the Sallen-Key low-pass filter (LPF) when they are implemented both on mid-frequency Si CJFET and on GaAs microwave transistors. Low values of the LPF V_off have a positive effect on the effective capacity of the ADC. An example of switching on a BA in the JFET OpAmp structure based on the depletion-mode MOS input stage and a “folded” cascode, which, with 100% negative feedback, can be used in the Sallen-Key LPF, is considered. Computer simulation of the JFET/MOS OpAmp showed that the OpAmp has an open-loop voltage gain of 76-85dB, and its V_off is within 7µV in the temperature range from -60°C to +120°C. The presented circuitry of buffer amplifiers is intended, first of all, for the tasks of designing precision Sallen-Key low-pass filter (low-pass filter, high-pass filter, PF, RF).

This paper considers the principles of building a circuit model of film resistor cutting. The conductive resistive medium is defined with the component equations and the topology of the circuit model. A method of estimating the electric parameters of a resistor operating in the system with a measuring voltage source is shown. An equation system for the node voltages is defined, and the resistive layer parameters are analyzed as the circuit model structure changes during the cutting process.

Understanding mechanisms of ageing remains a complex challenge for biogerontologists, but recent adaptations of evolutionary ageing theories offer a compelling lens in which to view both age-related molecular and physiological deterioration. Ageing is commonly associated with a progressive loss of biochemical processes and degeneration of molecular material, however, the mechanisms of diminishing function are not simply a result of aberrant expression of these pathways. Natural selection pressures are at their highest in youthful periods to select genes advantageous to maximising reproductive capacity. After sexual maturation, selective pressure diminishes, subjecting individuals to maladaptive pleiotropic gene function once beneficial for developmental growth, but pathogenic later in life. Due to this selective ‘shadowing’ in ageing, mechanisms to counter hyperfunctional genes are unlikely to evolve within a given species. These genetic ‘run-on’ programmes are not dysfunctional per se and, in fact, remain highly robust. Thus, interventions capable of optimising gene function during the ageing process represent as attractive therapeutic modalities. Caenorhabditis elegans offers a unique model to explore high-throughput screening of interventions to combat hyperfunctional pathways involved in ageing. However, the majority of research to date employ whole-life vs late-life pathway manipulation of developmental/growth-related systems to claim ageing attenuation, despite significant impairments in early-life fitness and discordance with healthspan. Here, we discuss data supporting hyperfunctional changes at a global molecular and functional level in C. elegans, and how classical lifespan-extension mutants alter these dynamics. We later discuss the relevance of such mutant models for exploring mechanisms of ageing, highlighting that post-reproductive gene manipulation represents a far more translatable approach for C. elegans research not routed within pleiotropic constraints. More so, lifespan has become a routine readout for quantifying ‘ageing’, however, we make the argument that a compression of gerospan vs lifespan extension is a more meaningful goal for anti-ageing regimes with current knowledge. Similarly, mechanisms governing lifespan are distinct from those regulating health, and slowing senescent pathology accumulation appears more applicable for the abstraction to human ageing.

In this paper, the design process of BLDC adopting the dual rotor method that can reduce the overall size of the motor while generating the same torque as the conventional Permanent Magnet BLDC is analyzed. A simple size is selected by obtaining the torque per rotor volume (TRV), and a method of matching the counter electromotive force by selecting the pole arc of the magnet through a magnetic equivalent circuit is analyzed. Since the efficiency is low because the 120-degree commutation method is selected, the middle stator is optimized through detailed design through the experimental design method. Afterwards, it has the advantage of being able to shift without stopping due to the characteristic of a dual rotor. For this, an analysis of the driving characteristics for each mode is performed.

Kininogens are multidomain glycoproteins found in the blood of most vertebrates. They are important in the blood coagulation cascade pathways - in intrinsic pathway activation leading to thrombin generation partially independently from tissue factor dependent extrinsic pathway, connecting blood coagulation with the kallikrein-kinin system. Nothing is known about the shape on atomic level therefore the endeavor to obtain the good-quality spatial structure of kininogens is important for a better understanding of their role in disease and treatment. Application of cryo-EM is important for solving the spatial structure of kininogens, drawing new frontiers in understanding the function and opening new pathways for drug development.

Dyadic data which is also called co-occurrence data (COD) contains co-occurrences of objects. Searching for statistical models to represent dyadic data is necessary. Fortunately, finite mixture model is a solid statistical model to learn and make inference on dyadic data because mixture model is built smoothly and reliably by expectation maximization (EM) algorithm which is suitable to inherent spareness of dyadic data. This research summarizes mixture models for dyadic data. When each co-occurrence in dyadic data is associated with a value, there are many unaccomplished values because a lot of co-occurrences are inexistent. In this research, these unaccomplished values are estimated as mean (expectation) of random variable given partial probabilistic distributions inside dyadic mixture model.

Maintaining the high overall health of farmed animals is a central tenant of their well-being and care. Intense animal crowding in aquaculture promotes animal especially in the absence of straightforward methods for monitoring their health. Here, we used bacterial 16S ribosomal RNA gene sequencing to measure population dynamics occurring during P. salmonis outbreaks. Our findings revealed a complex bacterial community consisting of a previously undescribed core pathobiome. Notably, we detected Aliivibrio wodanis and Tenacibaculum dicentrarchi on the skin ulcers of salmon infected with P. salmonis, while Vibrio spp. were enriched on infected gills. The prevalence of these co-occurring networks indicates the influence that coinfection plays in P. salmonis pathogenicity.

Computation of circuit complexity has gained much attention in the Theoretical Physics community in recent times to gain insights about the chaotic features and random fluctuations of fields in the quantum regime. Recent studies of circuit complexity take inspiration from the geometric approach of Nielsen, which itself is based on the idea of optimal quantum control in which a cost function is introduced for the various possible path to determine the optimum circuit. In this paper, we study the relationship between the circuit complexity and Morse theory within the framework of algebraic topology using which we study circuit complexity in supersymmetric quantum field theory describing both simple and inverted harmonic oscillators up to higher orders of quantum corrections. The expression of circuit complexity in quantum regime would then be given by the Hessian of the Morse function in supersymmetric quantum field theory, and try to draw conclusion from their graphical behaviour. We also provide a technical proof of the well known universal connecting relation between quantum chaos and circuit complexity of the supersymmetric quantum field theories, using the general description of Morse theory.

Molecule radiation can be used as a tool to study colder regions in switching arc plasmas like arc fringes in contact to walls and ranges around current zero (CZ). This is demonstrated in the present study for the first time for the case of ablation-dominated high–current arcs as key elements of self–blast circuit breakers. The arc in a model circuit breaker (MCB) in CO2 with and an arc in a long nozzle under ambient conditions with peak currents between 5 and 10 kA were studied by emission and absorption spectroscopy in the visible spectral range. The nozzle material was polytetrafluoroethylene (PTFE) in both cases. Imaging spectroscopy was carried out either with high-speed cameras or with intensified CCD cameras. A pulsed high-intensity Xe lamp was applied as background radiator for the broad-band absorption spectroscopy. Emission of Swan bands from carbon dimers was observed at the edge of nozzles only or across the whole nozzle radius with highest intensity in the arc center, depending on current and nozzle geometry. Furthermore, absorption of C2 Swan bands and CuF bands were found with the arc plasma serving as background radiator. After CZ, only CuF was detected in absorption experiments.

Wall–stabilized arcs dominated by nozzle–ablation are key elements of self–blast circuit breakers. In the present study, high–current arcs were investigated using a model circuit breaker (MCB) in CO2 as gas alternative to SF6 and in addition a long polytetrafluoroethylene nozzle under ambient conditions for stronger ablation. The assets of different methods for optical investigation were demonstrated, e.g. high-speed imaging with channel filters and optical emission spectroscopy. Particularly the phase near current zero (CZ) crossing was studied in two steps. In the first step using high-speed cameras, radial temperature profiles have been determined until 0.4 ms before CZ in the nozzle. Broad temperature profiles with a maximum of 9400 K have been obtained from analysis of fluorine lines. In the second step, the spectroscopic sensitivity was increased using an intensified CCD camera, allowing single-shot measurements until few microseconds before CZ in the MCB. Ionic carbon and atomic oxygen emission were analyzed using absolute intensities and normal maximum. The arc was constricted and the maximum temperature decreased from >18000 K at 0.3 ms to about 11000 K at 0.010 ms before CZ. The arc plasma needs about 0.5-1.0 ms after both the ignition phase and the current zero crossing to be completely dominated by the ablated wall material.

I propose a new strategy to suppress human cancer completely with two entirely new drug compounds exploiting cancer's Warburg effect characterized by a defective mitochondrial aerobic respiration, substituted for by cytosolic aerobic fermentation/glycolysis of D-(+)-glucose into L-(+)-lactic acid. The two essentially new drugs compound 1 [P(op)T(est)162] and compound 3 (PT167) represent new highly symmetric, four-bladed propeller-shaped polyammonium cations. The in vitro antineoplastic highly efficacious drug compound 3 represents a covalent combination of compound 1 and compound 2 (PT166). The intermediate drug compound 2 is an entirely new colchic(in)oid derivative synthesized from colchicine. Compound 2's structure was determined by X-ray crystallography. Compound 1 and compound 3 were active in vitro versus 60 human cancer cell lines of the National Cancer Institute (NCI) Developmental Therapeutics Program (DTP) 60-cancer cell testing. Compound 1 and compound 3 both not only stop the growth of cancer cells to ±0% (cancerostatic effect), but completely kill nearly all 60 cancer cells to a level of almost −100% (tumoricidal effect). Compound 1 and compound 3 induce mitochondrial apoptosis (under cytochrome c release) in all cancer cells tested by (re)activating (in most cancers impaired) p53 function which results in a decrease of cancer's dysregulated cyclin D1 and an induction of the cell cycle-halting cyclin-dependent kinase inhibitor p21^Waf1/p21^Cip1.

Based on electromagnetic heat transfer and metal phase transformation co-simulations, we modeled an AISI 1045 specimen under high-frequency heat treatment. Hardening zone predictions were confirmed through cooling and metal phase transformation simulations after obtaining the results from electromagnetic heat transfer simulations. The cooling process was modeled by applying the cooling coefficient of the cooling water in the same way as the actual heat-treatment process. To obtain the current flowing through the coil during high-frequency induction heating, the voltage was measured and applied using the resistance–inductance–capacitance circuit calculation method. Experimental and simulated results of the heating temperature and curing depth of an AISI 1045 specimen with a carbon content of 0.45% were compared; the comparison indicated good agreement between the two. Using the simulation results, we established a method for obtaining the current flowing through the induction coil for predicting the extent and depth of the hardening zone during high-frequency induction heat treatment.

Presence of lipopolysaccharides (LPSs) in the outer layer of outer membranes (OMs) is an almost universal molecular signature of Gram-negative bacteria. The O-antigen or O-polysaccharide (OPS) chains attach to millions of LPS molecule to form a continuous layer on the surface of most of Escherichia coli strains. OPS structure is one of the most variable features of bacteria, with about 200 E. coli O-serotypes currently described. In this review a analyze accumulating evidence suggesting that a vast majority of these OPS types provide robust shields that restrict the access of large molecules to the OM surface. Sophisticated mechanisms employed by bacteriophages to penetrate the OPS barrier are also considered. These are initiated with specific recognition of OPS molecules by phage receptor-binding proteins (RBP), or of other cell-surface molecules that are exposed above the OPS layer. Only after can virions gain access to secondary receptors found closer to the OM surface. The mechanisms of breaking through OPS in most if not all cases appear to rely on mechanical force generated by molecular motors of processive depolymerization or deacetylation of cell surface polysaccharides by enzymatically active RBPs, or by internal rearrangement of the virion.

While traditional AC mechanical circuit breakers have been competent for protecting AC circuits, high penetration of DC power distribution technologies like DC microgrids (MGs) obligate better disruption performance features such as quick and reliable switch-ing speeds. However, a DC circuit breaker (DCCB) novel design is challenging due to the need to quickly break high currents within milliseconds, caused by the high fault current rise in DC grids compared to AC grids. In DC grids, the circuit breaker must provide zero current crossing and be designed for absorbing surges since the arc is not naturally extinguished by the system. Additionally, the DC breaker must mitigate the magnetic energy stored in the system inductance and withstand residual over-voltages after current interruption. These challenges require a fundamentally different topology for DCCBs, which are typically made using solid-state semiconductor technology, metal oxide varistors (MOV), and ultra-fast switches. This study aims to provide a comprehensive review on development, design, and performance description of DCCBs in parallel with a specific concentration on analysis of internal topology, energy absorption path and sub-circuits in Solid-State (SS)-based DCCBs. The research explores various novel designs that introduce different structures for energy dissipation solution. The classification of these designs is based on the fundamental principles of surge mitigation and a detailed analysis of the techniques employed in DCCBs. In addition, our framework offers an advantageous reference point for the future evolution of SS-circuit breakers in numerous developing power delivery systems.

Abstract: The SARS-CoV-2 pandemic has reemphasized the urgent need for broad-spectrum antiviral therapies. We developed a computational workflow using scRNA-Seq data to assess cellular metabolism during viral infection. With this workflow we predicted the capacity of cells to sustain SARS-CoV-2 virion production in patients and found a tissue-wide induction of metabolic pathways that support viral replication. Expanding our analysis to influenza A and dengue viruses, we identified metabolic targets and inhibitors for potential broad-45 spectrum antiviral treatment. These targets were highly enriched for known interaction partners of all analyzed viruses. Indeed, phenformin, an NADH:ubiquinone oxidoreductase inhibitor, suppressed SARS-CoV-2 and dengue virus replication. Atpenin A5, blocking succinate dehydrogenase, inhibited SARS-CoV-2, dengue virus, respiratory syncytial virus, and influenza A with high selectivity indices. In vivo, phenformin showed antiviral activity against SARS-CoV-2 in a Syrian hamster model. Our work establishes host metabolism as druggable for broad-spectrum antiviral strategies, providing invaluable tools for pandemic preparedness.

This study aimed to assess the microbiological quality of set of fruits and vegetables sold on stalls in the streets and open markets of Dakar, the capital city of Senegal. Samples purchased in seven sites were analyzed to isolate E. coli, Salmonella spp. and Vibrio spp. Some primary samples with a positive microbiological culture were subjected to DNA extraction and subsequent metagenomic analysis. A total of 240 fresh fruit and vegetable samples were collected including lettuce (n=40), tomatoes (n=40), mango slices (n=40), onion slices (n=40), mint leaves (n=40), strawberries and grapes (respectively n=20). Of these samples, 50.83% (122/240) and 60.41% (145/240) was contaminated with Escherichia coli and Vibrio spp. respectively, while Salmonella was not isolated in any product. Levels of contamination with both E. coli (1.3 103 to 6 106 CFU/g) and Vibrio spp. (4.55 102 to 8.73 106 CFU/g) were significantly above the thresholds acceptable for human consumption. The most contaminated samples were lettuce with a prevalence of 98% (39/40) for E. coli and for Vibrio spp. followed by mint leaves with 100% (40/40) and 93% (37/40) of the samples containing for E. coli and Vibrio spp. respectively. Out of 46 samples sequenced, metagenomic analysis revealed high contamination rates for E. coli, Vibrio spp. and Salmonella spp. with 100%, 67.39% and 93.47% of prevalence respectively. On the other hand, the alpha diversity analysis shows a high bacterial diversity in lettuce and mint leaf samples while beta diversity analysis highlighted the presence of two major clusters. Our results stress the need of a surveillance system that extends this investigation to a national scale while increasing the number of sampling sites and products analyzed.

Various metals and semiconductors containing Printed Circuit Boards (PCBs) are abundant in any electronic device equipped with controlling and computing features. These devices inevitably constitute E-waste after the end of service life. The typical construction of PCBs includes mechanically and chemically resistive materials, which significantly reduce the reaction rate or even avoid accessing chemical reagents (dissolvents) to target metals. Additionally, the presence of relatively reactive polymers and compounds from PCBs requires high energy consumption and reactive supply due to the formation of undesirable and sometimes environmentally hazardous reaction products. Preliminarily milling PCBs into powder is a promising method for increasing the reaction rate and avoiding liquid and gaseous emissions. Unfortunately, current state-of-the-art milling methods also lead to the presence of significantly more reactive polymers still adhered to milled target metal particles. This paper aims to find a novel single and two-stage disintegration-milling approach that can provide the formation of metal-rich particle size fractions. The morphology, particle fraction sizes, bulk density, and metal content in produced particles were measured and compared. Research results show the highest bulk density (up to 6.8 g·cm-3) and total metal content (up to 95.2 wt. %) in finest sieved fractions after the single-step milling of PCBs. Therefore, the concentrations of about half tested metallic elements are higher in the single milled specimen and with lower adhered plastics concentrations, as compared to double milled specimens.

Tick-borne encephalitis virus (TBEV) is a RNA-containing enveloped virus, a member of the Flaviviridae family. Here we describe a detailed analysis of the size and structure of inactivated TBEV (the Sofyin-Chumakov TBEV strain, used in vaccines). Four analytical methods were used to analyze individual TBEV particles—negative staining TEM, cryo-EM, AFM, and NTA. All methods confirmed that the particles were monodisperse, and their mean size was ~50 nm. Cryo-EM data were used to obtain a 3D electron density model of the virus with clearly distinguishable E-proteins. STEM-EELS analysis detected phosphorous in the particles, which was interpreted as the RNA signal. Altogether, the described analytical procedures can be valuable for the further analysis of vaccine inactivated virus samples.

The shortage of quantum computers, and their current state of development, constraints research in many fields that could benefit from quantum computing. Although the work of a quantum computer can be simulated with classical computing, personal computers take so long to run quantum experiments that they are not very useful for the progress of research. This manuscript presents an open quantum computing simulation platform that enables quantum computing researchers to have access to high performance simulations. This platform, called QUTE, relies on a supercomputer powerful enough to simulate general purpose quantum circuits of up to 38 qubits, and even more under particular simulations. This manuscript describes in-depth the characteristics of the QUTE platform and the results achieved in certain classical experiments in this field, which would give readers an accurate idea of the system capabilities.

To build a stable power factor and high output accuracy, it should use balanced active and reactive power, also used ultrasonic PWM was used with the frequencies (20–500 kHz). I also used a three-phase dynamic load at the output system and was connected to the compound splicing (CS) system this is a novelty. An oscillator circuit with 4Ghz as a microcontroller is a novelty, and designing ADC is utilized to increase accuracy, as well as contribute to the reduction of loss brought on by the characteristics of voltage source inverters (VSI), such as dead time determined by the excess voltage or voltage drop in the inverter, circumstances abnormal to the load current, such as short circuit current in the production phase, and so forth. The innovation relates to the inverter's load sensing circuit, current smoothing during operation, reaction, spontaneous power factor enhancement of the inverter, and correction of reactive power of passive devices. This invention contributes to the advancement of D.C to A.C power converter by the achievement of extremely low losses, excellent precision, and lightweight construction. Additionally, the accuracy ranges from 99%, and the total harmonic distortion (THD) of the voltage and current is (0.1%-0.8%). We Power MOSFET are used, along with FPGA to improve control over the creation of ultrasonic PWM signals, the programmable peripheral interface (PPI) 8255A for regulatory work. The marks serve as proof of this.

Sorghum grain processing can improve the nutritional content by promoting dietary properties that contribute to food security and economic development. The quality, nutritional content, and processing properties of sorghum bicolor grain can greatly affected by the inbred line races and variance in pericarp colour.The current study assessed the influence of the Husking Fraction Time Units (HFTU) process, which employed set time units per second (S), on the variation in the nutritional profile of fifty-one inbred line sorghum varieties based on distinct pericarp colours. When the assessment of the nutritional profile was involved: dry matter, total protein besides, namely mineral (P, K, S, Ca, Mg, Na, Fe, Zn, and Mn). The variety groups showed a significance value of (P < 0.05), indicating the study hypothesis's truth.The results demonstrated substantial impacts implied by the Husking Fraction Time Unit (HFTU) technique. This occurrence was noted when the dry matter percentage was increased in the husked products, specifically the endosperm (grits) and bran. The protein percentage redistributed by 19.2% compared to the whole grain and bran content. In comparison, the ratio of N/S was 14:1 in the S. bicolor and 12:1 in the kafirin in the bran part. Moreover, a strong correlation was observed among the examined minerals of S.bicolor and kafirin, such as the correlation between Ca: P, K: Na, and Fe: Zn attributed 80 (S) time unit, with correlation coefficients of R = 0.784 and R = 0.586, R= 517, R= 0.884, R= 0.745, and R = 0.893, respectively. At the same time, the 80 (S) time unit showed a significant effect on the colour property profile.The study results could benefit breeders and nutrition specialists in developing genotypes and processing sorghum grains, promoting research, and aiding several industrial sectors owing to the grain's adaptability and nutritional properties.

Symbolic pole/zero analysis is an important step when designing an analog operational amplifier. Generally, a simplified symbolic analysis of analog circuits suffers from NP-hardness, i.e., an exponential growth of the number of symbolic terms of the transfer function with the circuit size. In this study, we present a mathematical model combined with a heuristic-metaheuristic solution method for the symbolic pole/zero simplification in operational transconductance amplifiers (OTA). At first, the circuit is symbolically solved and an improved root splitting method is applied to extract symbolic poles/zeroes from the exact expanded transfer function. Then, a hybrid algorithm based on heuristic information and a metaheuristic technique using simulated annealing is performed for the simplification of the derived symbolic pole/zero expressions. The developed method has been tested on three analog OTAs. The obtained results show the effectiveness of the proposed method to achieve accurate simplified symbolic pole/zero expressions with the least complexity.

The infections caused by various bacterial pathogens both in clinical and community settings represent a significant threat to public healthcare worldwide. The growing resistance to antimicrobial drugs acquired by bacterial species causing healthcare-associated infections has already become a life-threatening danger noticed by the World Health Organization. Several groups or lineages of bacterial isolates usually called ‘the clones of high risk’ often drive the spread of resistance within particular species. Thus, it is vitally important to reveal and track the spread of such clones and the mechanisms by which they acquire antibiotic resistance and enhance their survival skills. Currently, the analysis of whole genome sequences for bacterial isolates of interest is increasingly used for these purposes, including epidemiological surveillance and developing of spread prevention measures. However, the availability and uniformity of the data derived from the genomic sequences often represents a bottleneck for such investigations. In this dataset, we present the results of a comprehensive genomic epidemiology analysis of 17,546 genomes of a dangerous bacterial pathogen Acinetobacter baumannii. Important typing information including multilocus sequence typing (MLST)-based sequence types (STs), intrinsic blaOXA-51-like gene variants, capsular (KL) and oligosaccharide (OCL) types, CRISPR-Cas systems, and cgMLST profiles are presented, as well as the assignment of particular isolates to nine known international clones of high risk. The presence of antimicrobial resistance genes within the genomes is also reported. These data will be useful for researchers in the field of A. baumannii genomic epidemiology, resistance analysis and prevention measure development.

Mulberry (Morus alba L), a significant fruit tree crop, requires magnesium (Mg) for its optimal growth and productivity. Nonetheless, our understanding of the molecular basis underlying magnesium stress tolerance in mulberry plants remains unexplored. In our previous study, we identified several differential candidate genes associated with Mg homeostasis via transcriptome analysis including xyloglucan endotransglucosylase/hydrolase (XTH) gene family. The XTH gene family is crucial for plant cell wall reconstruction and stress responses. These genes have been identified and thoroughly investigated in various plant species. However, there is no research pertaining to XTH genes within the M. alba plant. This research systematically examined the M. alba XTH (MaXTH) gene family at the genomic level using a bioinformatic approach. In total, 22 MaXTH genes were discovered and contained the Glyco_hydro_16 and XET_C conserved domains. The MaXTH’s were categorized into five distinct groups by their phylogenetic relationships. The gene structure possesses four exons and three introns. Furthermore, the MaXTH gene promoter analysis reveals a plethora of cis-regulatory elements; mainly stress responsiveness, growth and development, light responsiveness, and phytohormone responsiveness. GO analysis indicated that MaXTHs encode proteins that exhibit xyloglucan xyloglucosyl transferase and hydrolase activities in addition cell wall biogenesis as well as xyloglucan and carbohydrate metabolic processes. Moreover, a synteny analysis unveiled an evolutionary relationship between the XTH genes in M. alba and those in three other species: A. thaliana, P. trichocarpa, and Zea mays. Expression profiles from RNA-Seq data displayed distinct expression patterns of XTH genes in M. alba leaf tissue during Mg treatments. Real-time quantitative PCR analysis confirmed the expression of the MaXTH genes in Mg stress response. Overall, this research enhances our understanding of the characteristics of MaXTH gene family members and lays the foundation for future functional genomic study in M. alba.

Memristor has attracted a lot of interest due to its high processing speed, low power consumption and high integration ability, which is critical for electronic systems and memory-centric computing. However, the memristor programming circuit and strategy are still inflexible and complex, since the signal generator/collector and stimulate pulse must be carefully matched and designed based on memristor intrinsic characteristics without reconfigurable. Here, a simple and effective circuit only consists a parallel reference-resistor-and-NMOS is designed to program memristor with a more than 99% memristance precision. And the amplitude and width of stimulate pulse are fixed to ±4V and 5ms, respectively. In order to cope with the device variation, such as ±10% tolerance of transition voltage, an optimized programming strategy was proposed and demonstrated great robustness. Additionally, a set of reference resistors and NMOSs have been added to facilitate multi-level memristance operation without requiring any changes to the circuit structure. This program circuit was also employed to program memristor crossbar remains 99% precision. In the end, a memristor-based convolutional neural network which controlled by our optimized programming circuit was used for image recognition, and 89.36% accuracy can be achieved even under 15.8% memristance tolerance. This novel circuit demonstrates a simple and flexible strategy in memristor programming, providing a new way to control memristor crossbar for practical application.

The success of Toxoplasma gondii (intracellular parasite) host cell invasion relies on the apical complex, a specialized microtubule cytoskeleton structure associated with secretory organelles. The genome encodes three isoforms of both α- and β-tubulin which are altered by specific post-translational modifications (PTMs), changing the biochemical/biophysical proprieties of microtubules, and modulating their interaction with associated proteins. Tubulin PTMs are a powerful and evolutionarily conserved mechanism to generate tubulin diversity, forming a biochemical ‘tubulin code’ that can be ‘read’ by microtubule-interacting factors. The T. gondii tubulin PTMs are: α-tubulin acetylation, α-tubulin detyrosination, Δ5α-tubulin, Δ2α-tubulin, α- and β-tubulin polyglutamylation, and α- and α-tubulin methylation. Tubulin glutamylation is a key candidate to assist microtubule remodeling in Toxoplasma, being involved in the regulation of microtubule stability, dynamics, interaction with motor proteins, and severing enzymes. The correct balance of tubulin glutamylation is achieved by the coordinated action of polyglutamylases and deglutamylating enzymes. In this work we will review and discuss the current knowledge on T. gondii tubulin glutamylation. By in silico identification of mammalian protein orthologs we explored and updated the identification of putative proteins related to glutamylation, contributing to a better understanding of the role of tubulin glutamylation in T. gondii.

Alzheimer’s Disease (AD) has no cure. Earlier, we showed that partial inhibition of mitochondrial complex I (MCI) with small molecule CP2 induces adaptive stress response activating multiple neuroprotective mechanisms. Chronic treatment reduced inflammation, improved synaptic and mitochondrial functions, and blocked neurodegeneration in symptomatic APP/PS1 mice, a translational model of AD. Here, using serial block-face scanning electron microscopy (SBFSEM) and three-dimensional (3D) EM reconstructions combined with Western blot analysis and next-generation RNA sequencing, we demonstrate that CP2 treatment also restores mitochondrial morphology and mitochondria-endoplasmic reticulum (ER) communication in the APP/PS1 mouse brain. Using 3D EM volume reconstructions, we show that mitochondria in AD dendrites exist primarily as mitochondria-on-a-string (MOAS). Compared to other morphological phenotypes, MOAS are extensively enveloped in the ER membranes forming multiple mitochondria-ER contact sites (MERCS) known to contribute to abnormal lipid and calcium homeostasis. CP2 treatment specifically reduced MOAS formation, consistent with improved energy homeostasis in the brain, with concomitant reduction in MERCS, ER stress, and improved lipid homeostasis. These data provide novel information on the role MOAS play in AD and additional support for further development of partial MCI inhibitors as disease modifying strategy for AD.

The increase in incidence of superficial fungal infections combined with the emergence of antifungal resistance represents both a global health challenge and a considerable economic burden. Recently, dermatophytes, the main culprit causing superficial fungal infections, have started to exhibit antifungal resistance. This can be observed in some of the most common species such as Trichophyton rubrum and Trichophyton mentagrophytes. Importantly, the new subspecies, known as Trichophyton indotineae, has been reported to show high resistance to terbinafine, a first-line treatment for dermatophyte infections. Compounding these issues is the realization that diagnosing the causative infectious agents requires using molecular analysis that goes beyond the conventional macroscopic and microscopic methods. These findings emphasize the importance of conducting antifungal susceptibility testing to select the appropriate antifungal necessary for successful treatment. Implementing these changes may improve clinical practices that combat resistant dermatophyte infections.

There is an urgent need to develop new therapies for cancer treatment due to high rates of resistance and tumor relapse. Moreover, chemotherapy and radiation weaken the immune system and leave patients susceptible to sudden death from infections and organ failure since antineoplastic drugs lack specificity. Hence, scientists worldwide continue the search for natural alternatives with anticancer activities and fewer side effects. In this regard, traditional medicine offers strategies for preventing and treating numerous diseases and nowadays scientific studies worldwide highlight some of the mechanisms underlying their potential as an effective alternative for the management of cancer. In Mexico, Mayan healers have been prescribed mainly medicinal plants for more than 2,000 years. Furthermore, their ethnomedical knowledge has led to drug discovery or the development of herbal remedies. Medicinal plants from the genus of Cissus remain an important element of all indigenous medical systems in Mexico including the Mayan tribes in Yucatan, particularly for the management of gastrointestinal illnesses, sores, cutaneous diseases, and tumors. In this review, we present the reported bioactivities against cancer cells of the extract and compounds from the species of Cissus with a particular focus on recent studies on the phytochemistry of C. trifoliata which is widely distributed in Mexican territory and used for tumor management in traditional medicine.

Pseudomonas aeruginosa is an opportunistic pathogen that poses a significant threat to individuals with chronic respiratory ailments, such as cystic fibrosis (CF). The pathogen is highly prevalent in CF individuals and is responsible for chronic infection, resulting in severe tissue damage and poor patient outcome. However, early detection and immediate treatment are critical to prevent bacterial persistence and establishment of chronic infection. Presently, antibiotics including aminoglycosides, beta-lactams, polymyxins, and fluoroquinolones along with anti-inflammatory medications are being used to treat P. aeruginosa infections in CF patients. However, prolonged antibiotic administration has led to the emergence of widespread multidrug resistance in P. aeruginosa (CF isolates), contributing to antimicrobial resistance (AMR) and failure of antimicrobial therapies. Thus, exploring viable alternatives such as antivirulence therapeutics can be vital towards managing pseudomonal infections in CF patients and mitigating the risk of AMR. In this direction, antivirulence strategies achieving targeted inhibition of bacterial virulence pathways/factors, including quorum sensing, efflux pumps, lectins, and iron chelators, have been widely explored against CF isolates of P. aeruginosa. Simultaneously, there have been discussions about the sufficiency of in vitro findings and their successful translation in pulmonary infection models (in vivo) for the clinical implementation of antivirulence therapies hence, this review article presents a bird’s eye view on the pulmonary infections involving P. aeruginosa in CF patients by laying emphasis on factors contributing to bacterial colonization, persistence, and disease progression along with the current line of therapeutics against P. aeruginosa in CF while underscoring the limitation of antimicrobial approaches. We further collate scientific literature and comprehensively discuss the various antivirulence strategies that have been successfully tested against P. aeruginosa isolates from CF patients. This could pave the way towards a paradigm shift towards clinical therapy of pseudomonal infections in CF and can potentially override conventional antimicrobial treatments.

Burkholderia are a group of Gram-negative bacteria that can cause a variety of diseases in at-risk populations. B. pseudomallei and B. mallei, the etiological agents of melioidosis and glanders, respectively, are the two clinically relevant members of the B. pseudomallei complex (Bpc). The development of vaccines against Bpc species has been accelerated in recent years, resulting in numerous promising subunits and glycoconjugate vaccines incorporating a variety of antigens. However, a second group of pathogenic Burkholderia species exists known as the Burkholderia cepacia complex (Bcc), a group of opportunistic bacteria which tend to affect individuals with weakened immunity or cystic fibrosis. To date there have been few attempts to develop vaccines to Bcc species. Therefore, the primary goal of this review is to provide a broad overview of the various subunit antigens that have been tested in Bpc species, their protective efficacy, study limitations, and known or suspected mechanisms of protection. Then, we assess the reviewed Bpc antigens for their amino acid sequence conservation to homologous proteins found in Bcc species. We propose that protective Bpc antigens with a high degree of Bpc-to-Bcc sequence conservation could serve as components of a pan-Burkholderia vaccine capable of protecting against both disease-causing groups.

Electrical rotating machines like Induction Motors (IMs) are widely used in several industrial applications since their robust elements, provide high efficiency and give versatility in industrial applications. Nevertheless, the occurrence of faults in IMs is inherent to their operating conditions, hence, Inter-turn short-circuit (ITSC) is one of the most common failures that affect IMs and its appearance is due to electrical stresses leads to the degradation of the stator winding insulation. In this regard, this work proposes a diagnosis methodology for the assessment and detection of incipient ITSC in IMs, the proposed method is based on the processing of vibration, stator currents and magnetic stray-flux signals. Certainly, the novelty and contribution include the characterization of different physical magnitudes by estimating a set of statistical time domain features, as well as, their fusion and reduction through the Linear discriminant Analysis technique within a feature-level fusion approach. Furthermore, the fusion and reduction of information from different physical magnitudes leads to perform the automatic fault detection and identification by a simple Neural-Network (NN) structure. The proposed method is evaluated under a complete set of experimental data and the obtained results demonstrate that the fusion of information from different sources (physical magnitudes) allows to improve the accuracy during the detection of ITSC in IMs , the results make this proposal feasible to be incorporated as a part of condition-based maintenance programs in the industry.

Metagenomic analysis of Aedes aegypti and Ae. albopictus mosquitoes from diverse geographical regions of India revealed presence of several insect viruses of human interest. Most abundant reads found in Ae. aegypti mosquitoes were Phasi-Charoen like virus (PCLV), Choristoneura fumiferana granulovirus (CfGV), Cell fusing agent virus (CFAV) and Wenzhou sobemo-like virus 4 (WSLV4), whereas WSLV4 and CfGV constituted the highest percentage in Ae. albopictus viromes. Other reads which were of low percentage included Hubei mosquito virus 2, Porcine astrovirus 4 and Wild Boar astrovirus. PCLV and CFAV, which were found to be abundant in Ae. aegypti viromes, were absent in Ae. albopictus viromes. Among the viromes analyzed, Ae. aegypti sampled from Pune showed highest percentage (79.82%) of viral reads while Ae. aegypti mosquitoes sampled from Dibrugarh showed lowest percentage (3.47%). Shamonda orthobunyavirus, African swine fever virus, Aroa virus and Ilheus virus, having potential to infect vertebrates including humans, were also detected in both mosquito species, albeit in low read numbers. Reads of gemykibivirus, avian retrovirus, bacteriophages, herpesviruses and viruses infecting protozoans, algae, etc. were also detected in the mosquitoes. A high percentage of reads in the Ae. albopictus mosquito samples remained unclassified and warrant further investigation. Data generated in the present work may not only lead to studies to explain the influence of these viruses on replication and transmission of viruses of clinical importance but also find application as biocontrol agents against pathogenic viruses.

Antimalarial drug resistance has become a real public health problem despite WHO measures. New sequencing technologies make it possible to investigate genomic variations associated with resistant phenotypes at the genome-wide scale. Based on the use of hemisynthetic nanopores, the PromethION technology from Oxford Nanopore Technologies can produce long-read sequences, in contrast to previous short-read technologies used as gold-standard to sequence Plasmodium. Two clones of P.falciparum (Pf3D7 and PfW2) were sequenced in long-read using the PromethION sequencer from Oxford Nanopore Technologies without genomic amplification. This made it possible to create a processing analysis pipeline for human Plasmodium with ONT Fastq only. De novo assembly revealed N50 lengths of 18,488 kb and 17,502 kb for the Pf3D7 and PfW2, respectively. The genome size was estimated at 23,235,407 base pairs for the Pf3D7 clone and 21,712,038 base pairs for the PfW2 clone. The average genome coverage depth was estimated at 787X and 653X for the Pf3D7 and PfW2 clones, respectively. This study proposes an assembly processing pipeline for the human Plasmodium genome using software’s adapted to large ONT data and the high AT percentage of Plasmodium. This search provides all the parameters, which have been optimized, for use with the software selected in the pipeline.

Toxoplasma gondii, a protozoan parasite with the ability to infect various warm-blooded vertebrates, including humans, is the causative agent of toxoplasmosis. This infection poses significant risks, leading to severe complications in immunocompromised individuals and potentially affecting the fetus through congenital transmission. A comprehensive understanding of the intricate molecular interactions between T. gondii and its host is pivotal for the development of effective therapeutic strategies. This review emphasizes the crucial role of proteomics in T. gondii research, with a specific focus on host-parasite interactions, post-translational modifications (PTMs), PTM crosstalk, and ongoing efforts in drug discovery. Additionally, we provide an overview of recent advancements in proteomics techniques, encompassing interactome sample preparation methods such as BioID, APEX, and Y2H, as well as various proteomics approaches, including single-cell analysis, DIA, targeted, top-down, and plasma proteomics. Furthermore, we discuss the integration of proteomics with other omics technologies, highlighting its potential in unraveling the intricate mechanisms of T. gondii pathogenesis and identifying novel therapeutic targets.

The load cell is an indispensable component of many engineering machinery and industrial automation for measuring and sensing force and torque. This paper describes the design and analysis of the strain gauge load cell, from the conceptional design stage to shape optimization (based on the finite element method (FEM) technique) and calibration, providing ample load capacity with low-cost material (aluminum 6061) and highly accurate force measurement. The amplifier circuit of the half Wheatstone bridge configuration with two strain gauges has been implemented experimentally with an actual load cell prototype. The calibration test was conducted to evaluate the load cell characteristics and derive the governing equation for sensing the unknown load depending on the measured output voltage. The measured sensitivity of the load cell is approximately 15 mV/N and 446.8 µV/V at a maximum applied load of 30 kg. The findings are supported by FEM results and experiments with an acceptable percentage of errors, which revealed an overall error of 6% in the worst situation. Therefore, the proposed load cell meets the design considerations for axial force measurement for the laboratory test bench, which has a light weight of 20 g and a maximum axial force capacity of 300 N with good sensor characteristics.

In the face of climate change, bringing more useful alleles and genes from wild relatives of wheat is crucial to develop climate-resilience varieties. We used two populations of backcrossed recombinant inbred lines (BIL1 and BIL2), developed using two intra-specifically diverse Aegilops tauschii accessions from lineage 1 and lineage 2, respectively, and backcrossing to common wheat cultivar ‘Norin 61’. The study aimed to identify quantitative trait loci (QTL) associated with heat stress (HS) tolerance. The two BILs were evaluated under heat stress environments in Sudan for phenology, plant height (PH), grain yield (GY), biomass (BIO), harvest index (HI), and thousand kernel weight (TKW). Grain yield was significantly correlated with BIO and TKW under HS; therefore, stress tolerance index (STI) was calculated for these traits as well as for GY. A total of 16 heat tolerant lines were identified based on GY and STI-GY. The QTL analysis performed using inclusive composite interval mapping identified a total of 40 QTLs in BIL1 and 153 QTLs in BIL2 across all environments. We detected 39 QTLs associated with GY-STI, BIO-STI, and TKW-STI in both populations (14 in BIL1 and 25 in BIL2). The QTL associated with STI were detected on chromosomes 1A, 3A, 5A, 2B, 4B, and all the D-subgenomes. We found that QTL detected only under HS for GY on chromosome 5A, TKW on 3B and 5B, PH on 3B and 4B, and grain filling duration on 2B. The higher number of QTLs identified in BIL2 for heat stress tolerance suggests the importance of assessing the effects of intraspecific variation of Ae. tauschii in wheat breeding as it could modulate the heat stress responses/adaptation. Our study provides useful genetic resources for uncovering heat-tolerant QTLs for wheat improvement for heat stress environments.

The identification of a new virus Kiparis-144 (KiparisV) in a half-fed tick I persulcatus, removed from a person in the south of the Russian Far East, determined the goal of further research - to study its role in human pathology and the characteristics of its behavior in the tick microbiome. An ELISA study of 439 blood samples from people affected by tick bites indicated a fairly frequent (up to 16.4±1.7%) encounter of people with the KiparisV virus in the territory of natural foci of the Primorsky Territory. It has been shown that this virus, when mono-infected, can cause clinical symptoms characteristic of acute respiratory diseases. During co-infection under the influence of the KiparisV, there was an increase in the activity of Borrelia spp. with the constant production of antibodies to them only of the IgM class and clinical symptoms of Lyme disease for one year (observation period). Electron microscopy of the KiparisV found in a tick removed from a patient showed a picture of the relationship of the KiparisV (up to 100 nm in size) with unknown representatives of the tick microbiome - pathogens of a viral or bacterial nature. In a comparative aspect, a similar electron microscopic picture of the interaction of the KiparisV virus with a known pathogen of viral nature, the ectromelia virus (ECTV), is presented. The importance of the electron microscopy method in describing the tick microbiome is shown. Thus, it has been established that when co-cultivated in the system the helper-virus KiparisV probably tends to use another pathogen of the tick microbiome for its reproduction, influencing its pathogenicity.

This paper introduces an innovative energy circuit that challenges conventional understandings of energy conservation, marking a significant departure from traditional frameworks. Seeking to enhance energy generation within existing paradigms, this innovation holds promise for addressing pressing global issues such as the energy crisis and environmental sustainability, while also stimulating scientific inquiry. In contrast to prevalent misconceptions rooted in philosophical and scientific constraints, this study refutes the notion of generating energy from nothing and questions the viability of perpetual motion machines as conceptual models. Instead, it proposes a novel circuit design derived from an unconventional electrical short circuit, which is shown to disrupt the established principles of energy conservation. This circuit offers a transformative approach with diverse applications, including self-recharging capabilities for electric vehicles, bolstering microgrid infrastructure, and facilitating the integration of renewable energy sources. Transcending conventional scientific boundaries, this paper prompts philosophical reflections on the evolving nature of scientific exploration. Ultimately, the energy circuit represents a pivotal step towards mitigating the global energy crisis by reducing reliance on finite resources and fostering sustainability. The paper concludes by illustrating the circuit's potential to revolutionize energy systems and contribute to a more resilient and sustainable future.

Salmonella enterica serovar Typhi, is one of the major infection spreading from consuming contaminated food and water. The poor sanitation is one the major cause for successful infection. S. typhi is responsible for causing typhoid fever, which is a growing public health concern in developing countries. This bacterium has acquired antimicrobial resistance to many promising which is a growing health concern for community. This study is aim to elucidate the molecular complexity of flouroquinolone resistance in S. Typhi isolates (n=286). Genomic data was downloaded from NCBI and analysis was done by Resfinder, MLST, and Pointfinder. Genomic analysis unveils a complex resistance profile, featuring antimicrobial resistance genes (ARG) including blaCTXM-15, blaTEM-1D, catA1, dfrA7, qnrS1, sul1, sul2, and tetA(B). The investigation focuses on mutations in DNA gyrA, parC, and qnrS1 genes which plays an important role in quinolone resistance. Mutation analysis reveals mutations such as DNA gyrA_S83F, DNA gyrA_D87N, DNA gyrA_S83Y, DNA gyrB_S464F, parC_S80I, and parE_L416F with the presence of qnrS1 gene produces resistance against quinolones. The Docking studies was conducted by “Autodock vina” and visualize by “Discovery studio” which demonstrate that these mutations leads to ciprofloxacin resistance, indicating reduced binding affinity, and altered solvent accessibility which indicates the structural changes at mutation sites. This study provides crucial insights into the molecular mechanisms driving flouroquinolone resistance in S. typhi, guiding future strategies to combat antibiotic resistance. Further validation through experimental mutagenesis is recommended, for targeted therapeutic interventions against the mounting threat of antibiotic-resistant S. typhi.

The integrated DC-DC converter is appropriate for use in many domains, namely, display, cellular, and portable applications. This paper presents an integrated monolithic voltage-mode DC-DC boost converter with a low-power control circuit. The driver circuit requires an integrated converter to power up a digital logic circuit and converts the unregulated DC input to the controlled DC output at the desired voltage level. It is the integration of both power switches and control circuitry within the same CMOS technology to buck down and boost voltages using a switch mode regulator. In order to increase power efficiency in the DC-DC boost converter that provides low-power operation with a small chip size, a low-voltage operation is applied to the unique circuit characteristic. The operational transconductance amplifier(OTA), comparator, and oscillator in the control circuit are designed with the supply voltage of 3.3V and the operating frequency of 5.5 MHz. A compensator is used to create a pole that has sufficient phase margin for high stability. The DC- DC boost converter is measured in both experiment and simulation. Testing of the proposed circuit on the 0.35μm CMOS process shows that the output transient time of the amplifier can be controlled within of 7μsec and the output voltage is accurately controlled with a ripple ratio of 3%.

In recent decades, given the important role of gamma-aminobutyric acid (GABA) in human health, scientists have paid great attention to the enrichment of this chemical compound in food using various methods, including microbial fermentation. Moreover, GABA or GABA-rich products have been successfully commercialized as food additives or functional dietary supplements. Several microorganisms can produce GABA, including bacteria, fungi, and yeasts. Among GABA-producing bacteria, lactic acid bacteria (LAB) are commonly used in the production of many fermented foods. Lactiplantibacillus plantarum (previously Lactobacillus plantarum) has a long history of natural occurrence and safe use in a variety of food products. This LAB species provides functional properties to various fermented foods by producing a variety of bioactive compounds, including GABA. The present review aims, after a preliminary excursus on the function and biosynthesis of GABA, to provide an overview on the current uses of microorganisms and in particular of L. plantarum in the production of GABA, with a detailed focus on fermented foods.

Probiotics are microorganisms infused in products for health benefits including acceleration of nutrient digestion, however, it is also important to ensure the safety prior to incorporation. Here, we present evidence of the ability of two probiotic isolates,Lacticaseibacillus paracasei BCRC-16100 and Lacticaseibacillus paracasei ZFM54, in the (1) enhancement of carbohydrate digestion, (2) tolerance to stress, and (3) antibiotic resistance. Approaches include whole genome sequence (WGS) analysis and bioactivity assays. WGS revealed genes suggesting the ability of the two isolates to promote carbohydrate digestion, tolerance to stress and antibiotic resistance. Carbohydrate digestive ability was confirmed through a biochemical assay where the two isolates cause glucose release from starch. The two isolates also showed versatility in a range of temperature and alcohol concentration. For antibiotic resistance particularly on vancomycin, there are three mechanisms namely transporter control, transcriptional regulation, and efflux pump. Furthermore, promoter and transposable element analysis showed that some of the active antibiotic resistant (AbR) genes can be laterally transferred. Altogether, we show the potential of two probiotic isolates to be incorporated in products for improved carbohydrate digestion and the need to address the removal of active and mobile antibiotic resistance genes that may compromise safety.

Having access to a unique quantum circuit that one wants to protect against use by others is a very likely scenario. However currently users rely on classical computer security schemes, which have known shortcomings. In this chapter we introduce a novel protection scheme along with a survey of other known methods to protect quantum information. In particular we review physically unclonable functions (PUFs), obfuscation, and introduce quantum logic locking.

Our environment has been impacted by man-made pollutants mainly industries make substantial use of synthetic dyes which exhibit cytotoxicity and have significant environmental consequences. Effective photocatalyst-based approaches for degrading synthetic dyes into less toxic chemical are of great interest. Synthesizing NPs using biological approaches, particularly plant-based approaches offer advantages, decreasing the risk of NPs losing biocompatibility during synthesis, cost-effectiveness, and eco-friendliness. In this study, we employed a green synthesis method to produce manganese oxide nanoparticles (MnO NPs) utilizing leaf extract from the Lathyrus Aphaca plant. The synthesized MnOx NPs were characterized through various techniques; X-ray diffraction (XRD), scanning electron microscopy (SEM), energy-dispersive X-ray spectroscopy (EDX), Fourier-transform infrared spectroscopy (FTIR), and UV–visible spectroscopy. XRD analysis showed distinct peaks, indicated the presence crystallographic planes within the MnO₂ nanoparticles, thus confirming their crystalline structure. SEM study highlighted closely packed configurations with average size of approximately ≥ 50-70 nm, with well-defined boundaries. EDX analysis showed the presence of elemental manganese (Mn) in the samples, with peaks corresponding to Mn detected at lower energy levels, predominantly represented by MnO. FTIR, showed the presence of the O-O stretching mode at a frequency of 719 cm^-1, the presence of MnO₆ oxides of manganese, and peak at 548 cm^-1 corresponded to the Mn-O stretching mode. Furthermore, the green-synthesized manganese oxide nanoparticles exhibited promising photocatalytic and adsorption capabilities against Methylene Blue (MB) dye, leading to approximately 93.21% degradation of MB when treated with the green-synthesized MnO nanoparticles derived from plant extract. This highlights the efficacy and potential of these nanoparticles in environmental remediation applications, particularly in the degradation of methylene blue contaminants.

A challenge in building large-scale superconducting quantum processors is the precise control and manipulation of the qubit state. However, the crosstalk between the microwave control lines impedes the parallel execution of high-fidelity digital and analog quantum operations. Here, we propose and demonstrate a universal compensation protocol for calibrating the microwave signal crosstalk. We also introduce amplified error sequences to optimize the accuracy. Furthermore, we show a definitive improvement in parallel gate operations with crosstalk cancellation, demonstrating the technique's effectiveness. This work paves the way for superconducting hardware that features automated calibration of microwave crosstalk, leading to enhanced fidelities in multiqubit circuits.

Leishmania infantum is an hemopathogen of importance for the health of domestic dogs (Canis lupus familiaris), causing canine leishmaniasis (CanL), as well as it is the etiological agent of human visceral leishmaniasis (HVL). This parasite was not reported in southern Brazil until the early 2000s, but CanL and HVL were increasingly reported in the last 15 years, mainly in cities bordering Argentina. The present study aimed to detect L. infantum in urban dogs and to determine the main clinical manifestations in the infected animals from Uruguaiana, a city with a high incidence of CanL. Fifty-one dogs suspected of having CanL in the urban perimeter of the city were clinically examined by veterinarians and investigated for the occurrence of L. infantum with two immunoassays (rapid chromatography test and ELISA) and real-time PCR. Clinical signs were compared in positive and negative L. infantum animals. A total of 31 dogs (60.8%) were infected with L. infantum. The main clinical manifestations associated to CanL dogs were onychogryphosis and peeling (p&lt;0.05). L. infantum was frequently detected in urban dogs from Uruguaiana, highlighting the health concerning situation in this city. The occurrence of some clinical signs (onychogryphosis/peeling) could help to detect more frequently CanL in the canine population.

Based on the analysis of the working principle, circuit design and working loss of the common charger DC/DC converter, this paper designs a ZVS half-bridge three-level DC/DC converter based on non-phase-shift control mode, and proposes a multi-stage constant current and voltage limiting charging control strategy based on modulation wave selection control. The simulation results show that the proposed method and control strategy have faster voltage regulation ability and wider stability margin, and can achieve stable current sharing control in the charging process.

Glucosinolates, the main secondary metabolites accumulated in cruciferous flora, have a major impact on fortifying plant immunity against diverse pathogens. Although Botrytis cinerea exhibits varying sensitivity to these compounds, current research has yet to fully understand the intricate mechanisms governing its response to glucosinolates. Different species of the genus Botrytis were exposed to glucosinolate-breakdown products revealing that B. fabae, B. deweyae and B. convoluta, species lacking the mfsG transporter gene (Bcin06g00026), were more sensitive to glucosin-olate-breakdown products than Botrytis species containing that gene such as B. cinerea, B. pseudo-cinerea and B. byssoidea. This finding was further corroborated by the inability of species lacking the mfsG gene to infect plants with a high concentration of glucosinolate breakdown products. These results challenge established correlations, revealing varying aggressiveness on different plant substrates. Expression analysis highlighted the gene's induction in the presence of isothiocyanate, and bioinformatic investigation identified homologous genes in other Botrytis species. Our study underscored the importance of advanced biotechnology to help understand these proteins and thus offer innovative solutions for agriculture

Gullele Botanic Garden was established to preserve and safeguard indigenous, rare, endemic and endangered plant species that have economic significance. A study was conducted to identify and map non-native plant species that exist in various land use types, including natural vegetation, plantation, roadside, and garden edges. The research involved placing plots at different distances in each land use type and collecting vegetation data with geo-location information for exotic and invasive species. The data was analyzed using Sorensen's similarity index to measure the similarity between plant communities. Invasive species were identified using ArcGIS, and descriptive statistical methods were employed to analyze the remaining data. The recorded a total of 80 plant species belonging to 70 genera in 44 families in the garden, with Fabaceae and Asteraceae having the most species. Acacia decurrens, Acacia melanoxylon, Cuscuta campestris, Galinsoga parviflora, Nerium oleander, and Cyathula uncinulata are the most prevalent invasive or potentially invasive species among the species that have been documented. These species are spreading quickly and may displace native plant species if not properly managed. The study found that roadside and garden edge land use types had the most diverse exotic plants, with Acacia decurrens, Nerium oleander, Acacia melanoxylon, Agave species, Cyathula uncinulata, and Eucalyptus species being the most dominant exotic species in the garden. The total density of exotic species was 2.36 plants/m2. The study provides valuable information for managing and conserving both native and exotic plant species in the garden.

Taeniid infections pose a significant threat to both animal and public health, as certain tapeworms within this group can also infect humans, potentially leading to severe health conditions. Therefore, this calls for preventive and control measures, such as regular deworming of dogs. While the efficacy of deworming has been established in developed countries, there is a paucity of reported deworming practices in rural areas of developing countries, such as Tanzania. This study aims to understand determinants for helminth treatment-seeking behavior towards control of cestodial taeniid infections in rural settings in northern Tanzania. A cross-sectional study was undertaken in agropastoral and pastoral areas of northern Tanzania. Comprehensive data from household surveys in selected sub-villages were collected to ascertain dog ownership, dog deworming practices, and the availability of dewormers. Analytical methods were employed to discern how various determinants influenced deworming practices among dog owners in these communities. Awareness of dewormers specifically formulated for dogs emerged as a pivotal factor affecting dog deworming practices. Dog owners who were informed about appropriate dog dewormers were nearly two times more likely to engage in deworming compared to those with limited knowledge (OR = 1.78, 95% CI 1.77 - 4.18, p < 0.001). A majority 32(51.6%, 95% CI: 38.7-64.3) acknowledged accessing dewormers for livestock within their wards. Praziquantel a potent dewormer on cestodes was least known to most dog owners 2(13%, 95% CI: 2.3-41.6). Praziquantel, a potent and common dewormer effective against cestodial taeniid infections, remains relatively unknown in rural areas of northern Tanzania. Therefore, more awareness on appropriate deworming agents against taeniids in dogs should be raised in rural dog-keeping communities.