Software defect prediction is an important means to guarantee software quality. Because there are no sufficient historical data within a project to train the classifier, cross-project defect prediction (CPDP) has been recognized as a fundamental approach. However, traditional defect prediction methods using feature attributes to represent samples, which can not avoid negative transferring, may result in poor performance model in CPDP. This paper proposes a multi-source cross-project defect prediction method based on dissimilarity space ( DM-CPDP). This method first uses the density-based clustering method to construct the prototype set with the cluster center of samples in the target set. Then, the arc-cosine kernel is used to form the dissimilarity space, and in this space the training set is obtained with the earth mover’s distance (EMD) method. For the unlabeled samples converted from the target set, the KNN algorithm is used to label those samples. Finally, we use TrAdaBoost method to establish the prediction model. The experimental results show that our approach has better performance than other traditional CPDP methods.

Selective laser melting (SLM) is one of the widely used techniques in metallic additive manufacturing, in which high-density laser powder is utilized to selectively melting layers of powders to create geometrically complex parts. Temperature distribution and molten pool geometry directly determine the balling effect, and concentrated balling phenomenon significantly deteriorates surface integrity and mechanical properties of the part. Finite element models have been developed to predict temperature distribution and molten pool geometry, but they were computationally expensive. In this paper, the three-dimensional temperature distributions are predicted by analytical models using point moving heat source and semi-ellipsoidal moving source respectively. The molten pool dimensions under various process conditions are obtained from the three-dimensional temperature predictions and experimentally validated. Ti-6Al-4V alloy is chosen for the investigation. Good agreements between the predictions and the measurements are observed. The presented models are also suitable for other metallic materials in the SLM process.

This study was undertaken to forecast waste generation rates of accommodation sector of North Cyprus as a case. Three predictor models including multiple linear regression (MLR), artificial neural networks (ANNs) and central composite design (CCD) were applied to predict the waste generation rate during the lean and peak seasons. ANN showed highest prediction performance, specifically, lowest values of the standard error of prediction (SEP = 2.153), mean absolute error (MAE=1.378) and highest R2 value (0.998) confirmed the accuracy of the model. The analysed wastes were categorised into recyclable, general waste and food residues. The authors estimated the total waste generated during the lean season as 2010.5 kg/day, in which large-sized hotel accounted for largest fraction (66.7%), followed by the medium hotels (19.4%) and guesthouse accounted for smallest part (2.6%). During the peak season, about 49.6% increases in the waste generation rates were obtained. Interestingly, 45% of the wastes were generated by the British tourists while the least waste was generated by African tourists (7.5%). The ANN predicted that the small and large hotels would produce 5.45 and 22.24 tons of waste by the year 2020, respectively. The findings herein are promising and useful in establishing a sustainable waste management system.

Clinical metagenomics (CMg), referred to as the application of next-generation sequencing (NGS) to clinical samples, is a promising tool for the diagnosis of hospital-acquired pneumonia (HAP). Indeed, CMg allows identifying pathogens and antibiotic resistance genes (ARGs), thereby providing the information required for the optimization of the antibiotic regimen. Hence, provided that CMg would be faster than conventional culture, the probabilistic regimen used in HAP could be tailored faster, which should lead to an expected decrease of mortality and morbidity. While the inference of the antibiotic susceptibility testing from metagenomic or even genomic data is challenging, a limited number of antibiotics are used in the probabilistic regimen of HAP (namely beta-lactams, aminoglycosides, fluoroquinolones, glycopeptides and oxazolidinones). Accordingly in the perspective of applying CMg to the early diagnostic of HAP, we aimed at reviewing the performances of whole genomic sequencing (WGS) of the main HAP-causing bacteria (Enterobacteriaceae, Pseudomonas aeruginosa, Acinetobacter baumannii, Stenotrophomonas maltophilia and Staphylococcus aureus) for the prediction of susceptibility to the antibiotic families advocated in the probabilistic regimen of HAP.

In the current study, the failure behavior of retrofitted steel structures was studied experimentally and theoretically with steel/CFRP double strap joints (DSJs) under quasi-static tensile loading. A series of DSJs with different bonding lengths are also considered and examined to experimentally assess the effective bond length. To predict the failure load values of the tested specimens, a new stress-based criterion, namely the point stress (PS) criterion is proposed. Although some theoretical predictive modelling for the strength between steel/CFRP joints under various loading conditions has been presented, in this work by using the new proposed approach, one can calculate rapidly and conveniently the failure loads of the steel/CFRP specimens. Furthermore, to assess the validity of the new proposed criterion, further experimental data on steel/CFRP DSJs available in the open literature are predicted using the PS criterion. Finally, it was found that a good agreement exists between the experimental results and the theoretical predictions based on the PS criterion.

In metal additive manufacturing (AM), precise temperature field prediction is crucial for process monitoring, automation, control, and optimization. Traditional methods, primarily offline and data-driven, struggle with adapting to real-time changes and new process scenarios, which limits their applicability for effective AM process control. To address these challenges, this paper introduces the first physics-informed (PI) online learning framework specifically designed for temperature prediction in metal AM. Utilizing a physics-informed neural network (PINN), this framework integrates a neural network architecture with physics-informed inputs and loss functions. Pretrained on a known process to establish a baseline, the PINN transitions to an online learning phase, dynamically updating its weights in response to new, unseen data. This adaptation allows the model to continuously refine its predictions in real-time. By integrating physics-informed components, the PINN leverages prior knowledge about the manufacturing processes, enabling rapid adjustments to process parameters, geometries, deposition patterns, and materials. Empirical results confirm the robust performance of this PI online learning framework in accurately predicting temperature fields for unseen processes across various conditions. It notably surpasses traditional data-driven models, especially in critical areas like the Heat Affected Zone (HAZ) and melt pool. The PINN’s use of physical laws and prior knowledge not only provides a significant advantage over conventional models but also ensures more accurate predictions under diverse conditions. Furthermore, our analysis of key hyper-parameters—learning rate and batch size of the online learning phase—highlights their roles in optimizing the learning process and enhancing the framework’s overall effectiveness. This approach demonstrates significant potential to improve the online control and optimization of metal AM processes.

This study investigates the correlation between the California Bearing Ratio (CBR) and the Dynamic Cone Penetrometer (DCP) for subgrade soil analysis. The paper aims to provide practical equations for predicting CBR values from DCP test results, enhancing the efficiency of soil assessments in engineering practice. By analyzing test data and proposing correlations for different soil groups, the study introduces recalibrated correlations that demonstrate high accuracy in predicting CBR values. The newly proposed equations offer reliable predictions with R2 values of 0.89, 0.92, and 0.94 for clean sand, silty sand or sandy silt, and cohesive soil, respectively. These correlations serve as valuable tools for engineers, enabling rapid and accurate CBR estimations for improved decision-making in various engineering projects.

Accurate and reliable mid-long runoff prediction (MLTRP) is of great importance in water re-sources management. However the MLTRP is not suitable in each basin and how to evaluate the applicability of MLTRP is still a question. Therefore, the total mutual information (TMI) index is developed in this study based on the predictor selection method using mutual information (MI) and partial MI (PMI). The relationship between the TMI and the predictive performance of five models is analyzed by applying five models in 222 forecasting scenarios in Australia. The results over 222 forecasting scenarios demonstrate that, compared with the MI, the developed TMI index can better represent the available information in the predictors, and has more significant negative correlation with the RRMSE with the correlation coefficient between -0.62 and -0.85. This means the model's predictive performance will become better along with the increase of TMI, and there-fore the developed TMI index can be used to evaluate the applicability of MLTRP. When TMI is more than 0.1, the available information in the predictors can support the construction of MLTRP models. In addition, the TMI is used to partly explain the difference of predictive performance among five models. In general, the complex models, which can better utilize the contained infor-mation, are more sensitive to the TMI, and have more significant improvement in terms of predic-tive performance along with the increase of TMI. This research can provide support for the study of MLTRP.

Non-neural Machine Learning (ML) and Deep Learning (DL) are used to predict system failures in industrial maintenance. However, only a few studies have assessed the effect of varying the amount of past data used to make a prediction and the extension in the future of the forecast. This study evaluates the impact of the size of the reading window and of the prediction window on the performances of models trained to forecast failures in three data sets of (1) an industrial wrapping machine working in discrete sessions, (2) an industrial blood refrigerator working continuously and (3) a nitrogen generator working continuously. A binary classification task assigns the positive label to the prediction window based on the probability of a failure to occur in such an interval. Six algorithms (logistic regression, random forest, support vector machine, LSTM, ConvLSTM and Transformers) are compared using multivariate time series. The dimension of the prediction windows plays a crucial role and the results highlight the effectiveness of DL approaches in classifying data with diverse time-dependent patterns preceding a failure and the effectiveness of ML approaches in classifying similar and repetitive patterns preceding a failure.

In the era of mounting water scarcity, particularly in arid regions, the agricultural sector is striving to optimize the water resource management practices. Treated wastewater (TWW) has emerged as a viable alternative to freshwater for irrigation, offering a sustainable solution to water conservation. However, ensuring the safety and quality of TWW is paramount to safeguard for both crop health and environmental integrity. Electrical conductivity (EC), a critical factor in assessing TWW suitability for irrigation, can significantly impact crop yields and soil health since it is directly linked to the concentration of dissolved salts and ions. Therefore, this study delves into the development of advanced predictive models for EC assessment by employing supervised machine learning (ML) techniques like the Support Vector Regression (SVR), Adaptive Network-based Fuzzy Inference System (ANFIS), and Multiple Linear Regression (MLR). The TWW samples collected from Al-Qatif area, Saudi Arabia were assessed in the lab through a sensor-based real-time monitoring system integrated with Internet of Things (IoT) network and a multiprobe device. The key water quality parameters assessed involved, temperature (T), pH, Oxidation Reduction Potential (ORP), Resistivity (RES), Total Dissolved Solids (TDS), Salinity and Turbidity which served as the foundation for these models, given their profound influence on and their anticipated impact on EC levels. Following feature selection, two distinct model combinations were identified for the SVR, ANFIS and MLR models. Furthermore, to evaluate prediction performance, four statistical criteria, including coefficient of determination (R²), correlation coefficient (R), mean square error (MSE), and root mean square error (RMSE), were employed. Overall, the comparative performance results proved that ANFIS-M2 indicated the strongest predictive capability with the R² value of 0.99572 and 0.75145 and the RMSE values of 0.00965 and 0.01134, respectively in both calibration and verification stages.

This paper proposes training improvement methods of artificial neural networks (ANN) trajectory predictors. First, a dynamic power system time-series trajectory is split into several different segments to simplify the original ANN training problem. Moreover, the time-derivative of the trajectory is included to obtain an augmented loss function. Compared to previous studies which mainly focused on increasing the prediction accuracy, the aim of these novel techniques is to reduce the computational burden where the ANN output performance is still acceptable. The effectiveness of the developed methods is validated based on the WSCC three-machine nine-bus and IEEE 39-bus system models. The mean absolute error (MAE) and trajectory prediction results are analyzed, in which the numbers of neurons, hidden layers, and training epochs are constrained during the ANN training process. Rotor-angle difference between generators and the system frequency are investigated as the dynamic trajectories of the power system models. It is revealed that when the ANN architecture and epochs are constrained, the MAE results can be reduced, and the ANN training results can better reflect the original trajectory using the improvement approaches.

Pedestrian object detection plays a significant role in intelligent systems such as intelligent traffic and monitoring. Traditional machine learning methods on pedestrian detection have shown various drawbacks, \eg{} low accuracy, slow speed, \etc The Convolutional Neural Network (CNN) based object detection algorithms have demonstrated remarkable advantages in the field of pedestrian detection. However, the mainstream CNNs still face the problems of slow speed and low detection accuracy, especially on small and occluded targets from aerial perspective. In this paper, we propose Multi-Scale Attention YOLO (MSA-YOLO) detection algorithm to address the above issues. MSA-YOLO includes a Squeeze, Excitation and Cross Stage Partial (SECSP) channel attention module for CNNs to extract richer pedestrian features with a small number of extra parameters. It also contains a multi-scale prediction module to capture the information among different pedestrian scales, which can recognize the small objects with higher accuracy and significantly reduce the missed detection. To sufficiently evaluate our proposed model, we manually collect and annotate a new benchmark dataset, Luoyang Pedestrian Dataset \footnote{The dataset can be downloaded through this anonymous link: \url{https://drive.google.com/drive/folders/13po1FX7Qk5RDgb60-dzOi74cq_kqDJtM?usp=sharing} }, which has much more sample annotations, features, scenes and image view angles than the existing benchmark datasets. In addition, the images in our dataset have higher resolution than most of benchmark pedestrian detection datasets, which can provide more detailed features of pedestrians and thus improve the model performance. When tested on Luoyang Pedestrian Dataset, our proposed MSA-YOLO algorithm significantly outperform the most commonly used baseline models with almost the same model size. This shows the efficiency of our proposed model. (The code and new dataset will be released to the public later.)

The new energy structure needs to balance energy security and dual carbon goals, which has brought major challenges to coal-fired power plants, the pollution reduction and carbon emissions reduction of coal-fired power plants will be a key task in the future. This article proposes an optimization operation of electrostatic precipitators(ESP), based on the working mechanism and historical data of ESP, voltage-current characteristic model and outlet dust concentration prediction model are constructed by deep learning algorithm, Particle Swarm Optimization(PSO) is used to achieve the optimal energy consumption while ensuring stable outlet dust concentration. By training with historical data collected on site, accurate prediction of secondary current and outlet dust concentration of ESP has been achieved, the Mean Absolute Percentage Error(MAPE) of secondary current is less than 1.5%, and the MAPE of outlet dust concentration of ESP on the test set is less than 5.2%. Finally, the optimization experiment is carried out in a 330MW coal-fired power plants, the results showed that the fluctuation of the outlet dust concentration is more stable, and the energy saving is about 43% after optimization, according to the annual operation of 300 days, the annual average carbon reduction is approximately 2621.34 tons. This method is effective and can be applied widely.

This work presents a heat transfer and boiling model that computes the evolution of the temperature field in a representative steel workpiece quenched from 850 or 930°C by immersion in water flowing at average velocities of 0.2 or 0.6 m/s, respectively. Under these conditions, all three boiling regimes were present during cooling: stable vapor film, nucleate boiling, and single-phase convection. The model was based on the numerical solution of the heat conduction equation coupled to the solution of the energy and momentum equations for water. The mixture phase approach was adopted using the Lee model to compute the rates of water evaporation-condensation. Heat flux at the wall was calculated for all regimes using a single semi-mechanistic model. Therefore, evolution of boiling regimes at every position on the wall surface was automatically determined. Predictions were validated using laboratory results, namely: a) Videorecording the upward motion of the wetting front along the workpiece wall surface, and b) cooling curves obtained with embedded thermocouples in the steel probe. Wall heat flux calculations were used to determine the importance of the simultaneous presence of all three boiling regimes on the heat flux distribution. It was found that this simultaneous presence leads to high heat flux variations that should be avoided in production lines.

Weather has significant impact on growth and plants development. It is important to analyze the influence of changing climate conditions on expression of plants agronomical characters. Two flax varieties were grown from 1987 to 2018 in the North-West of Russia. Whether conditions and their influence on flax agronomic characters were analyzed using variance and correlations analyses. Significant influence of year conditions on the manifestation of all evaluated characters was revealed. Starting from June high temperatures accelerate the development of plants at all stages. Prolongation of germination - flowering period is the most important for fiber productivity improvement. Oppositely, for formation of high quality fiber fast ripening in hot weather after flowering is preferable. Such data give possibility to predict the amount and quality of yield. Usage of weather conditions data also permits to compare results obtained in different years. Suggested method of year’s meteorological conditions classification can be used in other genebanks for systematization and analyses of crops field evaluation results. Correlation analyses reviled 3 correlated pleiades: (1) pleiade of productivity, (2) pleiade of fiber quality and yield, (3) pleiade of the growing season phases duration, the sums of active temperatures and precipitation during each period. Great influence of growing conditions on economically valuable traits indicates the necessity of searching for genotypes with stable characters manifestation for breeding new varieties, which will give stable yield and fiber of good quality.

In this communication, we present an innovative approach leveraging advanced Machine Learning (ML) and Artificial Intelligence (AI) techniques, specifically the Non-Negative Matrix Factorization (NMF) method, to analyze downward and upward light spectra collected by Hyperspectral Ocean Color Radiometer (HyperOCR, HOCR) sensors in the water column. Our work focuses on the development of a robust and efficient tool for unraveling the structure and activities of natural microbial assemblages in the ocean. By applying the NMF method to HyperOCR data, we successfully extracted five spectral signatures, representing unique patterns in the data. These signatures were instrumental in predicting the abundances of various microbial components, including bacteria, heterotrophic nanoflagellates, and picoeukaryotes, showcasing the potential of ML and AI in advancing oceanographic studies. To validate the methods, the study area included a shallow coastal area under the influence of freshwater inflow and an open offshore area with a depth of 100 m. The study sites in coastal and offshore waters (Kaštela Bay and Stončica Vis, respectively) had significantly different hydrographic and microbiological characteristics. Kaštela Bay had lower temperatures and salinity than the site on Vis. We have proved by application of different AI and ML methods with specific HOCR sensors prediction of the structure of the microbial community.

This paper proposes a new method for network screening on rural low-volume roads. These roads are important as they provide critical access to agricultural land and tourist attractions. Most low-volume roads belong to the lowest functional class (local rural roads) and thus are built to lower design standards. The conventional hot spot network screening techniques may not be appropriate for low-volume roads due to the sporadic nature of crashes occurring on these roads. Contrarily sophisticated network screening approaches require extensive roadway and traffic data that are often unavailable to local agencies for lack of resources, and/or lack of technical expertise. This research attempts to address these obstacles in low-volume roads network screening which aims to identify candidate sites for safety improvements. The research used an extensive low-volume road sample from the state of Oregon and the Empirical Bayes expected number of crashes in developing the proposed models for network screening. The proposed models do not require exact measurement of roadway geometric features as all geometric variables were classified into categories that are easy to compile by local agencies. Further, the method could be used with and without traffic data, without compromising the effectiveness of the network screening process.

In this study, a design of Morlet wavelet neural networks (MWNNs) is presented to solve the prediction differential model (PDM) using the global approximation capability of genetic algorithm (GA) and local quick interior-point algorithm scheme (IPAS), i.e., MWNN-GAIPAS. The famous PDM is known as a variant of functional differential system that works as an opposite of the historical delay differential models. A fitness function is optimized using the mean square error by applying the GA-IPAS for solving the PDM. Three PDM examples have been presented numerically to check the authenticity of the MWNN-GAIPAS. For the perfection of the designed MWNN-GAIPAS, the comparability of the obtained results and exact results is performed. Moreover, the neuron analysis is performed by taking the 3, 10 and 20 number of neurons. The statistical observations have been performed to authenticate the reliability of the MWNN-GAIPAS for solving the PDM.

The escalation of climate change and the increasing frequency of extreme weather events have amplified the importance of precise and timely lightning prediction. This predictive capability is pivotal for the preservation of life, protection of property, and maintenance of crucial infrastructure safety. Recently, the rapid advancement and successful application of data-driven deep learning across diverse sectors, particularly in computer vision and spatio-temporal data analysis, have opened up innovative avenues for enhancing both the accuracy and efficiency of lightning prediction. This article presents a comprehensive review of the broad spectrum of existing lightning prediction methodologies. Starting from traditional numerical forecasting techniques, we traverse the path to the most recent breakthroughs in deep learning research. We encapsulate these diverse methods, shedding light on their progression and summarizing their capabilities, while also predicting their future development trajectories. This exploration is designed to enhance our understanding of these methodologies, allowing us to better utilize their strengths, navigate their limitations, and potentially integrate these techniques to create novel and powerful lightning prediction tools. Through such endeavors, our aim is to bolster our preparedness against the growing unpredictability of our climate and ensure a proactive stance towards lightning prediction.

AlphaFold is a groundbreaking Deep Learning tool for protein structure prediction. It achieved remarkable accuracy in modeling the many 3D structures while taking as the input only the known amino acid sequence of proteins in question. Intriguingly though, in the early steps of each individual structure prediction procedure, AlphaFold is not respecting topological barriers that in real proteins result from the reciprocals impermeability of polypeptide chains. This study aims to investigate how this non-respecting of topological barriers affects AlphaFold predictions with respect to the topology of protein chains. We focus on such classes of proteins that during their natural folding form reproducibly the same knot type on their linear polypeptide chain as revealed by their crystallographic analysis. We use partially artificial test constructs in which the mutual non-permeability of polypeptide chains should not permit the formation of such knots during natural protein folding. We find that despite the formal impossibility that the protein folding process could produce such knots, AlphaFold predicts these proteins to be knotted. Our study underscores the necessity for cautious interpretation and further validation of topological features in protein structures predicted by AlphaFold.

This paper presents a new method of process parameters optimization, adequate for 3D printing of PLA (Polylactic Acid) components. The authors developed a new Hybrid Manufacturing Equipment (HME), suitable for producing complex parts made from a biodegradable thermoplastic polymer, for environmental sustainability. Our new HME equipment is producing PLA parts by both additive and subtractive techniques, with the aim of obtaining accurate PLA components with a good surface quality. A design of experiments has been applied for optimization purposes. The following manufacturing parameters were analyzed: rotation of the spindle, cutting depth, feed rate, layer thickness, nozzle speed, and surface roughness. Linear regression models and neural network models were developed to improve and predict the surface roughness of the manufactured parts. A new test part was designed and manufactured from PLA, to validate the new mathematical models, which can now be applied for producing complex parts made from polymer materials.

The Covid-19 pandemic and the subsequent implementation of lockdown measures have significantly impacted global electricity consumption, necessitating accurate energy consumption forecasts for optimal energy generation and distribution during a pandemic. In this study, we propose a new forecasting model called the Multivariate Multilayered LSTM with Covid-19 case injection ($\proposedModel$) for improved energy forecast during the next occurrence of a similar pandemic. We utilize data from commercial buildings in Melbourne, Australia during the Covid-19 pandemic to predict energy consumption and evaluate the model's performance against commonly used methods such as LSTM, Bi-LSTM, Linear Regression, Support Vector Machine and the previously published work of Multilayered LSTM (M-LSTM). The proposed forecasting model was analyzed using the following metrics of mean percent absolute error (MPAE), normalized root mean square error (NRMSE), and $R^2$ score values. The model $\proposedModel$ demonstrates superior performance, achieving the lowest MPAE values of 0.061, 0.093, and 0.158 for data sets from 3 different buildings, respectively. Our results highlight the improved precision and accuracy of the model, providing valuable information for energy management and decision-making during the challenges posed by the occurrence of a pandemic like Covid-19 in the future.

In light of the recent pandemic, several COVID-19 vaccines were developed, tested and approved in a very short time, a process that otherwise takes many years. Above all, these efforts have also unmistakably revealed the capacity limits and potential for improvement in vaccine production. This review aims to emphasize recent approaches for targeted rapid adaptation and production of vaccines from an interdisciplinary multifaceted perspective. Using literature research, stakeholder analysis and a value proposition canvas, we reviewed technological innovations on the pharmacological level, formulation, validation and resilient vaccine production to supply bottlenecks and logistic networks. We identified four main drivers to accelerate the vaccine product life cycle: computerized candidate screening, modular production, digitized quality management and a resilient business model with corresponding transparent supply chains. In summary, the results presented here can serve as a guide and implementation tool for flexible, scalable vaccine production to respond swiftly to pandemic situations in the future.

Financial markets require a great deal of decision making from the investors and market makers. One metric that can help ease the process of decision making is investment risk which can be measured in two parts; systematic risk and idiosyncratic risk. Clear understanding of the volatilities in each risk component can be a powerful signal in recognizing the right assets to maximize the investment returns. In this paper, we focus on the idiosyncratic volatility values and pre-calculate the idiosyncratic volatility values for 31,198 members of NYSE, Amex and Nasdaq markets for the trades occurring between January 1963 and December 2019. Utilizing a subset of dataset, limited to Nasdaq100 index, we consider the application of machine learning techniques in predicting the idiosyncratic volatility values using the raw trade data to explore a data extension option for the future market trade records that have not yet occurred. We offer a deep learning based regression model and compare it with traditional tree-based methods on a small subset of our per-calculated idiosyncratic volatility dataset. Our analytical results show that the performance of the deep learning techniques is much more robust in comparison to that of the traditional tree-based baselines.

In order to realize the performance degradation trend prediction accurately, a prediction method based on multi-domain features and temporal convolutional network (TCN) is proposed. Firstly, construct a high-dimensional feature set in the multi-domain of vibration signals, and use comprehensive evaluation indicators to preliminarily screen performance degradation indexes with good sensitivity and strong trend. Secondly, the kernel principal component analysis (KPCA) method is adopted to eliminate redundant information between multi-domain features, and construct a health index (HI) based on convolutional auto-encoder (CAE) network. Thirdly, a TCN-based performance degradation trend prediction model is constructed, and direct multi-step prediction is used to predict the performance degradation trend of the monitored object. On this basis, the validity of the proposed method is verified using the bearing public data, and it is successfully applied to performance degradation trend prediction of rolling contact fatigue specimen. The results show that the feature set can be reduced from 14 dimensions to 4 dimensions by using KPCA, while 98.33% of the information of the original feature set is retained. Furthermore, the method of constructing HI based on CAE network is effective. The change process of the HI constructed truly reflects the performance degradation process of the rolling contact fatigue specimen. Compared with the two commonly used HI construction methods, auto-encoding (AE) network and gaussian mixture model (GMM), this method has obvious advantages. At the same time, the prediction model based on TCN can accurately predict the performance degradation of the rolling contact fatigue specimen with the root mean square error 0.0146 and the mean absolute error 0.0105, which has better performance and higher prediction accuracy than the prediction model based on the long short-term memory (LSTM) network and the gated recurrent unit (GRU). This method has general significance and may be extended to the performance degradation prediction of other mechanical equipment/parts.

Ligand-based virtual screening (LBVS) is a promising approach for rapid and low-cost screening of potentially bioactive molecules in the early stage of drug discovery. Compared with traditional similarity-based machine learning methods, deep learning frameworks for LBVS can more effectively extract high-order molecule structure representations from molecular fingerprints or structures. However, the 3D conformation of a molecule largely influences its bioactivity and physical properties, and has rarely been considered in previous deep learning-based LBVS methods. Moreover, the relative bioactivity benchmark dataset is still lacking. To address these issues, we introduce a novel end-to-end deep learning architecture trained from molecular conformers for LBVS. We first extracted molecule conformers from multiple public molecular bioactivity data and consolidated them into a large-scale bioactivity benchmark dataset, which totally includes millions of endpoints and molecules corresponding to 954 targets. Then, we devised a deep learning-based LBVS called EquiVS to learn molecule representations from conformers for bioactivity prediction. Specifically, graph convolutional network (GCN) and equivariant graph neural network (EGNN) are sequentially stacked to learn high-order molecule-level and conformer-level representations, followed by attention-based deep multiple-instance learning (MIL) to aggregate these representations and then predict the potential bioactivity for the query molecule on a given target. We conducted various experiments to validate the data quality of our benchmark dataset, and confirmed EquiVS achieved better performance compared with 10 traditional machine learning or deep learning-based LBVS methods. Further ablation studies demonstrate the significant contribution of molecular conformation for bioactivity prediction, as well as the reasonability and non-redundancy of deep learning architecture in EquiVS. Finally, a model interpretation case study on CDK2 shows the potential of EquiVS in optimal conformer discovery. The overall study shows that our proposed benchmark dataset and EquiVS method have promising prospects in virtual screening applications.

Deep learning has been applied in many areas that have had a significant impact on applications that improves real-life challenges. The success of deep learning in a wide range of areas is due in part to the use of activation functions, which are particularly effective at solving non-linear problems. Activation functions are a key focus for researchers in artificial intelligence who aim to improve the performance of neural networks. This article provides a comprehensive explanation and comparison of different activation functions, with a focus on the arc tangent and its variations specifically. The paper presents experimental results that show that variations of the arc tangent using irrational numbers such as pi, the golden ratio, and Euler’s number, as well as a self-arctan function, produce promising results. Since we experimented with promising activation functions on two different problems, and datasets, we reached a result that different irrationals work well for different problems. In other words, arctan ϕ gives the best results mostly for multiclass classification and arctan e gives the best results for time series prediction problems. The paper focuses on a multiclass classification problem applied to the Reuters Newswire dataset and a time-series prediction problem on Türkiye energy trade value to show the impacts of activation functions.

With the growing of university chemistry experiment projects, scientific research personnel, specialized equipment, laboratory accident is increasing yearly. And accident data lacks a safety platform to store related information and cannot be guaranteed for efficient conditional sharing. To solve these problems, we designed a laboratory accident system to store, share related data and predict risk level. In this paper, we manually collected chemistry laboratory accidents by python software and class assignments, then analyses risk factor variables using Spsspro, finally established a prediction model using Stata. We intended to register laboratory related data into proposed chemistry accident system based on data ownership safety architecture. The chemistry accident system can break data barriers using confirmation and authorization key technology to trace non-tampered data source in real time when emergency accident happens. Meanwhile, our proposed system can use our designed accident risk model to predict risk level of any experiment project. It can also recommend appropriate safety education models.

Earliest critical context of the pandemic, preceding the first real epidemiological wave of contagion in Bulgaria, was examined in a socio-affective perspective. A retrospective and agnostic analytical approach was adopted. Our goal was to identify traits and trends that explain public health support (PHS) of Bulgarians during the first two months of the declared state of emergency. We investigated a set of variables with a unified method within an international scientific network, named International Collaboration on Social & Moral Psychology of COVID-19 (ICSMP) in April and May 2020. Conspiracy Theories beliefs were a significant predictor of lower PHS. Psychological Well-being was significantly associated with Physical Contact and Anti-Corona Policy Support. Physical Contact was significantly predicted by less Conspiracy Theories beliefs, higher Collective Narcissism, Open-mindedness, higher Trait Self-Control, Moral Identity, Risk Perception, and Psychological Well-Being. Physical Hygiene compliance was predicted by less Conspiracy Theories beliefs, Collective Narcissism, Morality-as-Cooperation, Moral Identity, and Psychological Well-Being. Results revealed two polar trends of support and non-support of public health policies. The contribution of this study is in providing evidence for affective polarization and phenomenology of (non)precarity during the outbreak of the pandemic.

This work considers the task of representation learning on the attributed relational graph (ARG). Both the nodes and edges in an ARG are associated with attributes/features allowing ARGs to encode rich structural information widely observed in real applications. Existing graph neural networks offer limited ability to capture complex interactions within local structural contexts, which hinders them from taking advantage of the expression power of ARGs. We propose Motif Convolution Module (MCM), a new motif-based graph representation learning technique to better utilize local structural information. The ability to handle continuous edge and node features is one of MCM’s advantages over existing motif-based models. MCM builds a motif vocabulary in an unsupervised way and deploys a novel motif convolution operation to extract the local structural context of individual nodes, which is then used to learn higher-level node representations via multilayer perceptron and/or message passing in graph neural networks. When compared with other graph learning approaches to classifying synthetic graphs, our approach is substantially better in capturing structural context. We also demonstrate the performance and explainability advantages of our approach by applying it to several molecular benchmarks.

Every month teachers face the dilemma of what exercises should their students practice, and what their consequences are on long-term learning. Since teachers prefer to pose their own exercises, this generates a large number of questions, each one attempted by a small number of students. Thus, we couldn’t use models based on big data such as deep learning. Instead, we developed a simple to understand state-space model that predicts end-of-year national test scores. We used 2,386 online fourth-grade mathematic questions designed by teachers and each attempted by some of the 500 students in 24 low socioeconomic schools. We found that the state-space model predictions improved month-by-month and that in most months it outperformed linear regression models. Moreover, the state-space estimator provides for each month a direct mechanism to simulate different practice strategies and compute their impact on the end-of-year standardized national test. We built iso-impact curves based on two critical variables: the number of questions solved correctly in the first attempt and the total number of exercises attempted. This allows the teacher to visualize the trade-off between asking students to do exercises more carefully or doing more exercises. To the best of our knowledge, this model is the first of its kind in education. It is a novel tool that supports teachers drive whole classes to achieve long-term learning targets.

Early stroke diagnosis remains a big challenge in healthcare partly due to the lack of reliable diagnostic blood biomarkers, which in turn leads to increased rates of mortality and disability. Current screening methods are optimised to identify patients with a high risk of cardio-vascular disease, especially among the elderly. However, in young adults and children, these methods suffer low sensitivity and specificity and contribute to further delays in their triage and diagnosis. Accordingly, there is an urgent need to develop reliable blood biomarkers for triaging patients suspected of stroke in all age groups, especially children and young adults. This review explores some of the existing blood biomarkers, as single biomarkers, or biomarker panels, and examine their sensitivity and specificity for predicting stroke. A review was performed on PubMed and Web of Science for journal articles published in English during the period 2001 to 2021 which contained information regarding biomarkers of stroke. In this review article, we provide comparative information on the availability, clinical usefulness, and time-window periods of eight single blood biomarkers and six biomarker panels that have been used for predicting stroke in emergency situations. The outcomes of this review can be used in future research for developing more effective stroke biomarkers.

Internet of Things (IoT) technologies can greatly benefit from machine learning techniques and Artificial Neural Networks for data mining and vice versa. In the agricultural field, this convergence could result in the development of smart farming systems suitable for use as decision support systems by peasant farmers. This work presents the design of a smart farming system for crop production, which is based on low-cost IoT sensors and popular data storage services and data analytics services on the Cloud. Moreover, a new data mining method exploiting climate data along with crop production data is proposed for the prediction of production volume from heterogeneous data sources. This method was initially validated using traditional machine learning techniques and open historical data of the northeast region of the state of Puebla, Mexico, which were collected from data sources from the National Water Commission and the Agri-food Information Service of the Mexican Government.

Software reliability is an important characteristic for ensuring the qualities of software products. Predicting the potential number of bugs from the beginning of a development project allows practitioners to make the appropriate decisions regarding testing activities. In the initial development phases, applying traditional software reliability growth models (SRGMs) with limited past data does not always provide reliable prediction result for decision making. To overcome this, herein we propose a new software reliability modeling method called deep cross-project software reliability growth model (DC-SRGM). DC-SRGM is a cross-project prediction method that uses features of previous projects’ data through project similarity. Specifically, the proposed method applies cluster-based project selection for training data source and modeling by a deep learning method. Experiments involving 15 real datasets from a company and 11 open source software datasets show that DC-SRGM can more precisely describe the reliability of ongoing development projects than existing traditional SRGMs and the LSTM model.

Photovoltaic (PV) generation is potentially uncertain. Probabilistic PV generation forecasting methods have been proposed with prediction intervals (PIs). However, several studies have dealt with geographically distributed PVs in a certain area. In this study, a two-step probabilistic forecast scheme is proposed for geographically distributed PV generation forecasting. Each step of the proposed scheme adopts ensemble forecasting based on three different machine-learning methods. In this case study, the proposed scheme was compared with conventional non-multistep forecasting. The proposed scheme improved the reliability of the PIs and deterministic PV forecasting results through 30 days of continuous operation with real data in Japan.

The incidence of Type 1 Diabetes (T1D) in the Arab world, particularly, oil and gas rich Gulf Cooperative Council (GCC) countries has more than doubled in the last twenty years. Therefore, there is a dire need for careful systematic familial cohort studies, especially in high-risk populations. Several immunogenetic factors affect the pathogenesis of the disease. Genes in the human leukocyte antigen (HLA) account for the major genetic susceptibility to the disease. The triggering agents initiate disease onset by destruction of pancreatic β-cells. The autoantibodies against glutamic acid decarboxylase (GADA), insulinoma antigen-2 (IA-2A), insulin (IAA), and zinc transporter-8 (ZnT-8A) comprise the most reliable biomarkers for T1D in both children and adults. Although three of the GCC countries, namely Kuwait, Saudi Arabia and Qatar are among the top 10 countries with high incidence rate of T1D, no proper diagnostic and prediction tools were applied in the region. Understanding the disease sequelae in a homogenous gene pool with high consanguinity in the GCC could help solve the challenges in understanding pathogenesis, as well as hasten the prevention of T1D. Arab states must incorporate T1D predictive and intervention policies on a war-footing basis to minimize the burden of this serious disease.

The growth of regularly generated data from many financial activities has significant implications for every corner of financial modeling. This study has investigated the utilization of these continuous growing data by a means of an automated process. The automated process can be developed by using Machine learning based techniques that analyze the data and gain experience from the underlying data. Different important domains of financial fields such as Credit card fraud detection, bankruptcy detection, loan default prediction, investment prediction, marketing and many other financial models can be modeled by implementing machine learning models. Among several machine learning based techniques, the use of parametric and non-parametric based methods are approached by this research. Two parametric models namely Logistic Regression, Gaussian Naive Bayes models and two non-parametric methods such as Random Forest, Decision Tree are implemented in this paper. All the mentioned models are developed and implemented in the field of Credit card fraud detection, bankruptcy detection, loan default prediction. In each of the aforementioned cases, the comparative study among the classification techniques is drawn and the best model is identified. The performance of each classifier on each considered domain is evaluated by various performance metrics such as accuracy, recall, precision, F1-score and mean squared error. In the credit card fraud detection model the decision tree classifier performs the best with an accuracy of 99.1% and, in the loan default prediction and bankruptcy detection model, the random forest classifier gives the best accuracy of 97% and 96.84% respectively.

Highly nonlinear characteristics of lithium-ion batteries (LIBs) are significantly influenced by the external and internal temperature of the LIB cell. Moreover, cell temperature beyond the manufacturer’s specified safe operating limit could lead to thermal runaway and even fire hazards and safety concerns to operating personnel. Therefore, accurate information of cell internal and surface temperature of LIB is highly crucial for effective thermal management and proper operation of a battery management system (BMS). Accurate temperature information is also essential to BMS for the accurate estimation of various important states of LIB such as state of charge, state of health and so on. High capacity LIB pack, used in electric vehicles and grid-tied stationary energy storage system essentially consists of thousands of individual LIB cells. Therefore, installing a physical sensor at each cell especially at the cell core is not practically feasible from the solution cost, space and weight point of view. A solution is to develop a suitable estimation strategy which led scholars to propose different temperature estimation schemes aiming to establish a balance among accuracy, adaptability, modelling complexity and computational cost. This article presented an exhaustive review of these estimation strategies covering recent developments, current issues, major challenges, and future research recommendations. The prime intention is to provide a detailed guideline to the researchers and industries towards developing a highly accurate, intelligent, adaptive, easy to implement and compute efficient online temperature estimation strategy applicable to health-conscious fast charging and smart onboard BMS.

The aim of this study was to develop a basic model to predict enteric methane emission from dairy cows and to update operational calculations for the national inventory in Norway. Basic models were developed using a database with 63 treatment means from 19 studies. The database included records for enteric CH4 production (MJ/day), dry matter intake (DMI), and dietary nutrient composition. The basic models were evaluated against an external database (n=36, from ten studies) along with other extant models. When evaluated by low root mean square prediction errors and high concordance correlation coefficients, the developed basic models that included DMI, dietary concentrations of fatty acids and neutral detergent fiber performed slightly better in predicting CH4 emissions than extant models. In order to propose country-specific values for the CH4 conversion factor Ym (% of gross energy intake partitioned into CH4) and thus to carry out the national inventory for Norway, the existing operational model was updated for the prediction of Ym over a wide range of feeding situations using energy corrected milk and dietary concentrate share as predictor variables. Input values of Ym were updated based on the results from the basic models. The predicted Ym ranged from 6.22 to 6.72%. In conclusion, the prediction of CH4 production from dairy cows was improved with the help of newly published data, which enabled an update of the operational model for calculating the national inventory of CH4 in Norway.

Effectively avoiding gas accident is vital to the security of mineral manufacture, and the coal mine gas accident is often caused by gas concentration overrun. The prediction accuracy of gas emission quantity in coal mine is the key to solve this problem. To maintain concentration of gas in a secure range，grey theory and neural network model increasingly diffusely used in forecasting gas emission quantity in coal mine critically. Nevertheless, the limitation of the grey neural network model is that researchers merely bonded the conventional neural network and grey theory. To enhance accuracy of prediction, a modified grey GM(1,1) and RBF neural network model is proposed combined amended grey GM(1,1) model and RBF neural network model. Then the proposed model was put into simulation experiment which is built based on Matlab software. Ultimately, conclusion of the simulation experiment verified that the modified grey GM(1,1) and RBF neural network model not only boosts the precision of prediction, but also restricts relative error in a minimum range. This showed that the modified grey GM(1,1) and RBF neural network model achieves effectiveness in precision of prediction much better than grey GM(1,1) model and RBF neural network model.

The food distribution process is responsible for significant quality loss in perishable products. However, preserving quality is costly and consumes a tremendous amount of energy. To tackle the challenge of minimizing transportation costs and CO2 emissions while also maximizing product freshness, a novel multi-objective model is proposed. The model integrates a vehicle routing problem with temperature, shelf life, and energy consumption prediction models, thereby enhancing its accuracy. Non-dominated sorting genetic algorithm II is adapted to solve the proposed model for the set of Solomon test data. The conflicting nature of these objectives and the sensitivity of the model to shelf life and shipping container temperature settings are analyzed. The results show that optimizing freshness objective degrade the cost and the emission objectives, and the distribution of perishable foods are sensible to the shelf life of the perishable foods and temperature settings inside the container.

The most common index for representing structural condition of the pavement is the structural number. The current procedure for determining structural numbers involves utilizing falling weight deflectometer and ground-penetrating radar tests, recording pavement surface deflections, and analyzing recorded deflections by back-calculation manners. This procedure has two drawbacks: 1. falling weight deflectometer and ground-penetrating radar are expensive tests, 2. back-calculation ways has some inherent shortcomings compared to exact methods as they adopt a trial and error approach. In this study, three machine learning methods entitled Gaussian process regression, m5p model tree, and random forest used for the prediction of structural numbers in flexible pavements. Dataset of this paper is related to 759 flexible pavement sections at Semnan and Khuzestan provinces in Iran and includes “structural number” as output and “surface deflections and surface temperature” as inputs. The accuracy of results was examined based on three criteria of R, MAE, and RMSE. Among the methods employed in this paper, random forest is the most accurate as it yields the best values for above criteria (R=0.841, MAE=0.592, and RMSE=0.760). The proposed method does not require to use ground penetrating radar test, which in turn reduce costs and work difficulty. Using machine learning methods instead of back-calculation improves the calculation process quality and accuracy.

Predictive simulation of concurrent debris flow using only pre-disaster information has proven to be difficult as a result of problems in predicting the location of debris-flow initiation (i.e., slope failure). However, because catchment topography has concave characteristics, with all channels in a catchment joining each other as they flow downstream, it is possible to predict damage to downstream area using relatively inaccurate initiation points. Based on this, this paper presents methodologies employing debris-flow initiation points generated randomly using statistical slope failure prediction. A many-case simulation across numerous initiation points was performed to quantify the effect of slope-failure location in terms of deviations in the predicted water level and terrain deformation. It was found that the relative standard deviation diminished as the points approached the downstream area, indicating a location-based predictability effect.

There are guidelines on lactation following maternal analgo-sedative exposure, but these do not consider the effect of maternal fasting, nor fluid abstention on human milk macronutrient composition. We therefore performed a structured search (PubMed) on ‘human milk composition’ and screened title, abstract and full paper on ‘fasting’ or ‘abstention’ and ‘macronutrient composition’ (lactose, protein, fat, solids, triglycerides, cholesterol). This resulted in 6 papers and one abstract related to religious fasting (n=129 women) and observational studies in lactating women (n=23, healthy volunteers, fasting). These data reflect two different ‘fasting’ patterns: an acute (18-25h) model in 71 (healthy volunteers, Yom Kippur/Ninth of Av) women and a chronic fasting (Ramadan) model in 81 women. Changes were most related to electrolytes and were moderate, with almost no changes in macronutrients during acute fasting. We therefor conclude that neither short term fasting nor fluid abstention (18-25h) affect human milk macronutrient composition, so that women can be reassured when this topic were raised during consulting. Besides the nutritional relevance, this also matters as clinical research samples – especially to estimate analgo-sedative exposure by lactation - are commonly collected after maternal procedural sedation, associated with maternal fasting and physiology-based pharmacokinetic (PBPK) models assume stable human milk composition.

Single nucleotide polymorphisms (SNP) are associated with diseases and drug response variabilities in humans. Elucidating the damaging and disease-associated SNPs using wet-laboratory approaches can be challenging and resource-demanding due to the large number of SNPs in the human genome. Due to the growth in the field of computational biology and bioinformatics, algorithms have been developed to help screen and filter out the most deleterious SNPs that are worth considering for wet-laboratory studies. Here we review the existing in-silico based methods used to predict and characterize the effects of SNPs on protein structure and function. This cutting-edge approach will facilitate the search for novel therapeutics, help understand the etiology of diseases and fast-track the personalized medicine agenda.

Background: Accurate prediction of patients’ response to therapy is clinically indispensable, howbeit challenging. With increased understanding of the human genome and malignancies, there is the renaissance of in silico pharmacogenomics with renewed interest in drug response predictability based on gene-drug interaction. Objective: Evidence-based transcript-proteome profiling is essential for synthesizing clinically applicable algorithms for predicting response to anticancer therapy, including immune checkpoint blockade (ICBT); thus, saving physicians’ time, reducing polypharmacy, and curtailing unnecessary treatment expense. In this study, we tested and validated the hypothesis that a selected proteomic signature in ICBT-naïve patients is sufficient for the prediction of response to ICBT. Methods: Using a multimodal approach consisting of computational pharmacogenomics, transcript-proteome analytics, mathematical modeling, and machine learning systems; we delineated therapy-sensitivity and stratified patients into graduated response groups based on their proteomic profile. Protein expression levels in our cohort tissue specimens were evaluated based on T cell- and non-T cell- inflamed phenotypes by immunohistochemistry. Results: We established β-catenin, PDL1, CD3 and CD8 expression-based ICBT response model. Statistical regression models validated the predictive association between our predefined algorithms and therapeutic outcome. Interestingly, our 4-gene prediction classifier was constitutively independent of tumor tissue origin, correctly stratified patients into high-, low-, and non- responders pre-treatment, with high prediction accuracy, and exhibited good association with patients’ performance status and prognosis (p < 0.01). Conclusion: Our findings demonstrate the possibility of accurate proteomics based ICBT response prediction and provide a putative basis for drug response prediction based on selective proteome profile in untreated cancer patients.

The accuracy of sales prediction models based on the big data of online word-of-mouth (eWOM) is still not satisfied. We argue that eWOM contains heat and sentiments of different product dimensions, which can improve the accuracy of these models. In this paper, we propose a dynamic topic analysis (DTA) framework in order to extract heat and sentiments of product dimensions from the big data of eWOM. Finally, we propose an autoregressive-heat-sentiment (ARHS) model, which integrates heat and sentiments of dimensions into the baseline predictive model. The empirical study in movie industry confirms that heat and sentiments of dimensions can improve the accuracy of sales prediction model. ARHS model is better for movie box-office revenue prediction than other models.

Over the past two decades, persistent occurrences of harmful algal blooms (HAB; Karenia brevis) have been reported in Charlotte County, southwestern Florida. We developed data-driven models that rely on spatiotemporal remote sensing and field data to identify factors controlling HAB propagation, provide a same-day distribution (nowcasting), and forecast their occurrences up to three days in advance. We constructed multivariate regression models using historical HAB occurrences (213 events reported from January 2010 to October 2017) compiled by the Florida Fish and Wildlife Conservation Commission and validated the models against a subset (20%) of the reported historical events. The models were designed to specifically capture the onset of the HABs instead of those that developed days earlier and continued thereafter. A prototype of an early warning system was developed through a threefold exercise. The first step involved the automatic downloading and processing of daily Moderate Resolution Imaging Spectroradiometer (MODIS) Aqua products using SeaDAS ocean color processing software to extract temporal and spatial variations of remote sensing-based variables over the study area. The second step involved the development of a multivariate regression model for same-day mapping of HABs and similar subsequent models for forecasting HAB occurrences one, two, and three days in advance. Eleven remote sensing variables and two non-remote sensing variables were used as inputs for the generated models. In the third and final step, model outputs (same-day and forecasted distribution of HABs) were posted automatically on a web-based GIS (http://www.esrs.wmich.edu/webmap/bloom/). Our findings include the following: (1) the variables most indicative of the timing of bloom propagation are bathymetry, euphotic depth, wind direction, SST, chlorophyll-a [OC3M] and distance from the river mouth, and (2) the model predictions were 90% successful for same-day mapping and 65%, 72% and 71% for the one-, two- and three-day advance predictions, respectively. The adopted methodologies are reliable, dependent on readily available remote sensing data sets, and cost-effective and thus could potentially be used to map and forecast algal bloom occurrences in data-scarce regions.

In this paper, we propose an adaptive duty-cycled hybrid X-MAC (ADX-MAC) protocol for energy-efficient forest fire prediction. The X-MAC protocol acquires the additional environmental status collected by each forest fire monitoring sensor for a certain period. And, based on these values, the length of sleep interval of duty-cycle is changed to efficiently calculate the risk of occurrence of forest fire according to the mountain environment. The performance of the proposed ADX-MAC protocol was verified through experiments the proposed ADX-MAC protocol improves throughput by 19% and was more energy-efficient by 24% compared to X-MAC protocol. As the probability of forest fires increases, the length of the duty cycle is shortened, confirming that the forest fires are detected at a faster cycle.

Vibration measurement serves as the basis for various engineering practices such as natural frequency or resonant frequency estimation. As image acquisition devices become cheaper and faster, vibration measurement and frequency estimation through image sequence analysis continue to receive increasing attention. In the conventional photogrammetry and optical methods of frequency measurement, vibration signals are first extracted before implementing the vibration frequency analysis algorithm. In this work, we demonstrated that frequency prediction can be achieved using a single feed-forward convolutional neural network. The proposed method is verified using a vibration signal generator and excitation system, and the result obtained was compared with that of an industrial contact vibrometer in a real application. Our experimental results demonstrate that the proposed method can achieve acceptable prediction accuracy even in unfavorable field conditions.

1) Landsat operational land imager (OLI) data and consequent laboratory measurements were used to predict Chlorophyll-a (Chl-a) concentration and the trophic states for an inland lake within the East Kolkata Wetland, India; 2) The most suitable band ratio was identified by performing Pearson correlation analysis between Chl-a concentrations and possible OLI band and band ratios from the study points; 3) The results showed highest correlation coefficient from the band ratio OLI5/OLI4 with an R value of 0.85. The prediction model was then developed by applying regression analysis between the band ratio OLI5/OLI4 and Chl-a concentration of the study points. The reflectance ratios of the validation points were given as input on the prediction model and the model output was considered as predicted Chl-a values of the validation points to check the efficiency of the prediction model. The regression model between laboratory-derived Chl-a value and model-fitted Chl-a value of the validation points revealed a high correlation with an R² value of 0.78. Trophic State Index (TSI) of the lake was also calculated from laboratory-derived Chl-a value and model-fitted Chl-a value of the validation points. The study presented a high correlation of TSI determined from predicted data with TSI from laboratory reference data (R = 0.88). The TSI values of the lake ranged from 65 to 75 which indicate that the lake is appeared to be eutrophic to hypereutrophic conditions. 4) This empirical study showed that Landsat 8 OLI imagery can be effectively applied to estimate Chl-a levels and trophic states for inland lakes.

Time-series analysis is a widely used technique across various fields and industries, as it helps in understanding, predicting, and forecasting the behavior of data points over time. These fields include but are not limited to finance, economics, healthcare, transportation, etc. In the case of this paper, we have focused on finance. Predicting future values of financial time series offers several benefits. Accurate forecasts can help investors make better decisions about their investments. To predict future values, deep learning algorithms are commonly used since it is an effective method with complex data. In this study, we conduct a study that investigates the use of different data pre-processing techniques on deep learning algorithms in predicting the time series values. To conduct this experimental study, we utilize an open source software, which using long short-term memory technique as the representative deep learning technique, published in github software code repository platform. With this study, we investigate the effects of autoencoder and discrete wavelet transform data pre-processing techniques in time-series prediction. We discuss the details of the experimental study and report our results. The results show that time series prediction (using backtesting methodology) without any data pre-processing leads to 12.6% for mean absolute percentage error. The results also show that, time series prediction with the data preprocessing techniques (Wavelet Transform and Stacked Autoencoder) lead to 3.4%

While the simple model of the total atmospheric carbon sink effect as a linear function of concentration has provided excellent prediction results, several problems remained to be investigated and solved. The most obvious open issue is the correct treatment of land use change emssions. It turns out that the model improves by mostly neglecting them after 1959. This effectively implies that land use change emissions have been constant and small since then. The key investigation starts with the observation, that the total carbon sink has a short term component which be explained by temperature changes commonly known as El Nin˜o. The apparent paradox is analysed and explained, why contrary to the short term changes no temperature caused trend can be detected in the model, despite the fact that several contributing processes exhibit temperature dependency. The result of this analysis leads to the model extension, where the total effect of sinks and natural emissions are a linear function of concentration and temperature. This model not only explains current measurements but also paleo climate from ice-core time series.

Software stands as one of the most rapidly evolving technologies in the present era, characterized by its swift expansion in both scale and complexity which leads to challenges in quality assurance. Software Defect Prediction (SDP) emerges as a methodology crafted to anticipate undiscovered defects, leveraging known defect data from existing codes. This methodology serves to facilitate software quality management, thereby ensuring overall product quality. Machine Learning (ML) and Deep Learning (DL) methodologies exhibit superior accuracy and adaptability compared to traditional statistical approaches catalyzing active researches in this domain. However, it makes us hard to generalize not only because of the disparity between open-source project and commercial project but also the difference on each industrial sectors. Consequently, further research utilizing datasets sourced from diverse real-world sectors becomes imperative to bolster the applicability of these findings. In this study, we utilized embedded software for telecommunication systems of SAMSUNG ELECTRONICS, supplemented by the introduction of nine novel features to train the model, and subsequent analysis of results ensued. Experimental outcomes revealed that the F-measurement metric has been enhanced from 0.58 to 0.63 upon integration of the new features, thereby signifying a performance augmentation of 8.62%. This case study is anticipated to contribute to bolster the application of SDP methodologies within analogous industrial sectors.

This article describes the POTENTIALS project, which aimed to develop business models for the reuse of former industrial and mining sites in different regions. The project focused on the creation of eco-industrial parks as a result to enable sustainable energy production and reduce waste and pollution. A key aspect was the Territorial Impact Assessment (TIA), a new and complex policy assessment tool. Therefore, the TEQUILA (Territorial Efficiency Quality and Identity Layer Assessment) approach is used to describe the TIA and emphasizes its application in assessing the impact of EU policies and projects on territorial cohesion. It underlines the need for a differentiated understanding of the regional characteristics and potential impacts of policies; and stresses the importance of regionalized impact models for the assessment. Furthermore, the process and results of applying the TEQUILA methodology to assess the territorial impact of different scenarios of business models within the POTENTIALS project is given.

Website defacement is an illegal electronic act of changing a website. In this paper, robust machine learning classifiers’ capabilities were exploited to select the best input feature set for evaluating a website’s defacement risk. Zone-H, a private organization, offered us a defacement mining dataset. A sample of 93644 datapoints was concisely pre-processed and used for modelling purposes. Considering multidimensional features as input, reason and hackmode variables were chosen as outputs. Massive machine learning models were examined; however, decision tree (DT), k-nearest neighbour (k-NN), and random forest (RF) were the most powerful algorithms used to predict the target model. The input variables 'domain', 'system', 'web_server','redefacement', 'type', 'def_grade', and 'reason/hackmode' were tested and used to shape the final model. Using the cross-validation (CV) technique, the model’s key performance factors were calculated and reported. After calculating the average scores for the hyperbolic metrics (i.e., max-depth, min-sample-leaf, weight, max-features, and CV), both targets were evaluated, and the learning algorithms were ranked as RF, DT, and k-NN. The reason and hackmode variables were thoroughly analysed. The average score accuracies for the reason and hackmode targets were 0.85 and 0.585, respectively. The results showed a significant development in terms of modelling and optimizing website defacement risk. The study also successfully addresses the main cybersecurity concerns, in particular website defacement.

The assessment and prediction of drought risk under future climate change and land use land cover (LULC) scenarios is critically important for drought prevention and mitigation, as it enables a clearer understanding of potential shifts in drought patterns. The primary aim of this study is to evaluate sub-seasonal and seasonal meteorological and hydrological drought hazards across the Yellow River Basin (YRB) under projected future climate conditions and LULC patterns. The BCC-CSM1-1 climate model projections from the NASA Earth Exchange Global Daily Downscaled Projections (NEX-GDDP) dataset are utilized to represent future climate for 2025-2060 under RCP 4.5 and 8.5 scenarios. The CA-Markov model is employed to predict future LULC distributions. Meteorological and hydrological drought risks across different YRB zones are evaluated through a copula-based risk assessment approach, based on the joint probability distribution of drought duration and severity. The results indicate that sub-seasonal meteorological and hydrological droughts will likely be the primary concern moving forward. Specifically, the upper YRB (zones A, B, C) exhibits greater vulnerability to sub-seasonal meteorological drought, while the Loess Plateau (zones C, E) shows higher susceptibility to sub-seasonal hydrological drought. Moreover, zone F in the downstream region may experience increased seasonal hydrological drought risk due to projected urban expansion in the middle and lower portions of the YRB.

The problem of low soil fertility and limited research in agricultural data driven tools, may lead to low crop productivity which makes it imperative to research in applications of high throughput computational algorithms such as of machine learning (ML) for effective soil analysis and fertility status prediction in order to assist in optimal soil fertility management decision-making activities. However, difficulties in the choice of the key soil properties parameters for use in reliable soil nutrients analysis and fertility prediction. Also, individual ML algorithms setbacks and modelling expert implementation procedures subjectivity, may lead to exploitation of worst fertility level targets and soil fertility status targets classification models performance reported variations. This paper surveys state-of-affair in ML for agricultural soil nutrients analysis and fertility status prediction. Prominent soil properties and widely used classical modelling algorithms and procedures are identified. Empirically exploited fertility status target classes are scrutinized, and reported soil fertility prediction model performances are depicted. The three pass method, with mixed method of qualitative content analysis and qualitative simple descriptive statistics were used in this survey. Observably, the frequently used soil nutrients and chemical properties were organic carbon, phosphorus, potassium, and potential Hydrogen, followed by iron, manganese, copper and zinc. Predominant algorithms included Random Forest, and Naïve Bayes, followed by Support Vector Machine. Model performances varied, with highest accuracy 98.93% and 98.15% achieved by ensemble methods, and the least being 60%. Interdisciplinary ML related researchers may consider using ensemble methods to develop high performance soil fertility status prediction models.

. Identifying students who might have difficulty in their course of studies ahead of time is crucial. There can be many reasons for performance issues, such as personality, family, social, and/or economic. We advocate that educational systems should use machine learning to predict students’ performance based on performance factors. This would allow educational professionals and institutions to put in place a preventive plan to help students towards achievements of their educational goals and success. In this chapter, we propose a student performance prediction method and evaluate its performance. We provide a taxonomy of performance factors that help to gauge students performance from different perspectives and give insights on the categories and features that have more significant impact on students’ performance. The results of this work can be used by education institutions to put in place a student-centric approach to tackle performance issues before they create long-term effects on student’s life. In addition, it will help education policymakers to introduce a tailored approach for the population in specific areas.

Environmental monitoring systems play a crucial role in assessing environmental quality, detecting limits exceedances, and predicting potential ecological episodes. These systems rely on the measurement of various variables at specific locations and time intervals over an extended period. The concept of environmental monitoring encompasses the assessment of health and safety issues for public and environmental health purposes. Pollution of the atmosphere and water, climate change, and natural disasters are among the consequences of continuous industrial and municipal development and human interference in natural ecosystems. To address these challenges and to protect human lives and the environment, with a special concern on mitigating the ecological effects of industrial development, advanced technical solutions, including the technologies associated with artificial intelligence (artificial neural networks ANNs, machine learning ML) have been developed. These technologies offer powerful tools for analysing the vast amount of data collected by monitoring systems and extracting valuable insights. By applying ANNs and machine learning algorithms, environmental monitoring systems can effectively process and interpret the measured variables to assess environmental quality. Despite challenges and limitations, such as data quality and interpretability of AI models, ongoing research and interdisciplinary collaboration are paving the way for the successful implementation of AI in environmental monitoring, ultimately supporting informed decision-making and sustainable resource management.While several review papers have explored the theory of artificial intelligence (AI), here I aim to review the application of ANNs and ML, in environmental aspects, specifically in automotive and industrial emissions toxicity measurements, as well as atmospheric pollution prevention. By examining the potential of AI in these domains, the paper contributes to understanding the role of advanced technologies in environmental monitoring and protection.

Oral and parenteral delivery of first-line anticonvulsant Valproic cid (VA) are associated with serious adverse effects, high hepatic metabolism, high clearance, and low bioavailability in brain. GastroPlus program was used to predict in vivo performance of immediate (IR) and sustained release (SR) products in human. HSPiP software predicted excipients with maximum possible miscibility of the drug. Based on GastroPlus and HSPiP program, various excipients were screened for experimental solubility study and prepared cationic nanoemulsions and respective gels for nasal to brain delivery. These were characterised for size, size distribution, polydispersity index, zeta potential, morphology, pH, % transmittance, drug content, and viscosity. In vitro drug release, ex vivo permeation profile (goat nasal mucosa), and penetration studies were conducted. Result showed that in-vivo oral drug dissolution and absorption were predicted as 98.6 mg and 18.8 mg, respectively from both tablets (IR and SR) at 8 h using GastroPlus. The drug access to the portal vein was relatively predicted high in IR (115 mg) as compared to SR (82.6 mg). Plasma drug concentration-time profile predicted was in good agreement with published reports. The program predicted duodenum and jejunum as the prime site of drug absorption and no effect of nanonization on Tmax for sustained release formulation. Hansen parameters suggested suitable selection of excipients. The program recommended for nasal to brain delivery of the drug using cationic mucoadhesive product. The optimized stable CVE6 was associated with optimal size (113 nm), low PDI (0.26), high zeta potential (+34.7 mV), high transmittance (97.8%), and high strength (0.7 %w/w). In vitro release and ex vivo permeation of CVE6 were found to be substantially high as compared to anionic AVE6 and respective gels. Penetration study executed high fluorescence intensity with CVE6 and CVE6-gel as compared to suspension and ANE6 which may be attributed to electrostatic interaction between mucosal membrane and nanoglobules. Thus, cationic nanoemulsion and respective mucoadhesive gel are promising strategy for delivery of VA to brain through intransal administration for the treatment of seizure and convulsion.

In this study, we propose a radiomics-clinical probability weighted model for the prediction of prognosis for NSCLC. The model combines radiomics features extracted from RT planning images with clinical factors such as age, gender, histology, and tumor stage. CT images with radiotherapy structures of 422 NSCLC patients were retrieved from The Cancer Imaging Archive (TCIA). Radiomic features were extracted from gross tumor volume (GTV). Five machine learning algorithms, namely decision trees (DT), random forests (RF), extreme boost (EB), support vector machine (SVM) and generalized linear model (GLM), were optimized by a voted ensemble machine learning (VEML) model. A probabilistic weighted approach is used to incorporate the uncertainty associated with both radiomic and clinical features and to generate a probabilistic risk score for each patient. The performance of the model is evaluated using a receiver operating characteristic (ROC). Radiomic model, clinical factors model and combined radiomic-clinical probability weighted model demonstrated good performance in predicting NSCLC survival with AUC of 0.941, 0.856 and 0.949 respectively. The combined radiomics-clinical probability weighted enhanced model achieved significantly better performance than radiomic model in 1-year survival prediction (chi-square test, p<0.05). The proposed model has the potential to improve NSCLC prognosis and facilitate personalized treatment decisions.

Deep learning has been applied in many areas that have had a significant impact on applications that improves real-life challenges. The success of deep learning in a wide range of areas is due in part to the use of activation functions, which are particularly effective at solving non-linear problems. Activation functions are a key focus for researchers in artificial intelligence who aim to improve the performance of neural networks. This article provides a comprehensive explanation and comparison of different activation functions, with a focus on the arc tangent and its variations specifically. The paper presents experimental results that show that variations of the arc tangent using irrational numbers such as pi, the golden ratio, and Euler’s number, as well as a self-arctan function, produce promising results. Since we experimented with promising activation functions on two different problems, and datasets, we reached a result that different irrationals work well for different problems. In other words, arctan ϕ gives the best results mostly for multiclass classification and arctan e gives the best results for time series prediction problems. The paper focuses on a multi-class classification problem applied to the Reuters Newswire dataset and a time-series prediction problem on Türkiye energy trade value to show the impacts of activation functions.

Cities exposed their vulnerabilities during COVID-19 pandemic. Unprecedented policies restricted human activities but left an unique opportunity to quantify anthropogenic effects on urban air pollution. This study aimed to address the key questions of urban development behind the restrictions with the goal of supporting sustainable transition. Data from ground stations and Sentinel-5P satellite were used to assess the temporal and spatial anomalies of NO2. Beijing China was selected for a case study because this mega city maintained a “dynamic zero-COVID” policy with adjusted restrictions, allowing us better to track the effects. The time-series decomposition and prediction regression model were employed to estimate the normal NO2 levels in 2020. The anomalies between the observations and predictions as the deviation were identified due to the policy interventions and quantified different effects using spatial stratified heterogeneity statistics. The top three restrictions showing dominant effects were workplace closures, restricted public transport usage, and school closures, accounting for 54.8%, 52.3%, and 46.4% of NO2 anomalies, respectively; and they are directly linked to the mismatch of employment and housing (deter-mining the commuting patterns), educational inequality and the long-term unsolved road con-gestion. Promoting the transformation of urban spatial structure will effectively alleviate air pollution.

The task of determining the distance from one object to another is one of the important tasks solved in robotics systems. Conventional algorithms rely on an iterative process of predicting distance estimates, which results in an increased computational burden. Algorithms used in robotic systems should require minimal time costs, as well as be resistant to the presence of noise. To solve these problems, the paper proposes an algorithm for Kalman combination filtering with a Goldschmidt divisor and a median filter. Software simulation showed an increase in the accuracy of predicting the estimate of the developed algorithm in comparison with the traditional filtering algorithm, as well as an increase in the speed of the algorithm. The results obtained can be effectively applied in various computer vision systems.

Wheat (Triticum aestivum L.) breeding programs can take over a decade to release a new variety. However, new methods of selection such as genomic selection (GS) must be integrated to decrease the time it takes to release new varieties to meet the demand of a growing population. The implementation of GS into breeding programs is still being explored, with many studies showing its potential to change wheat breeding through achieving higher genetic gain. In this review, we explore the integration of GS for a wheat breeding program by redesigning the traditional breeding pipeline to implement GS. We propose implementing a two-part breeding strategy by differentiating between population improvement and product development. The implementation of GS in the product development pipeline can be integrated into most stages and can predict within and across breeding cycles. Additionally, we explore optimizing the population improvement strategy through GS recurrent selection schemes to reduce crossing cycle time and significantly increase genetic gain. The recurrent selection schemes can be optimized for parental selection, maintenance of genetic variation, and optimal cross-prediction. Overall, we outline the ability to increase the genetic gain of a breeding program by implementing GS and a two-part breeding strategy.

Men with non-small cell lung cancer (NSCLC) have a more favorable response to immune-checkpoint inhibitor (ICI) monotherapy, while women especially benefit from ICI-chemotherapy (CHT) combinations. To elucidate such sex differences in clinical practice, we retrospectively analyzed two cohorts treated with either ICI monotherapy (n=228) or ICI-CHT combination treatment (n=80) for advanced NSCLC. Kaplan-Meier analyses were used to calculate progression-free (PFS) and overall survival (OS), influencing variables were evaluated using Cox-regression analyses. No significant sex differences for PFS/OS could be detected in either cohort. Men receiving ICI monotherapy had a statistically significant independent impact on PFS by Eastern Cooperative Oncology Group performance status (ECOG) ≥2 (hazard ratio (HR) 1.90, 95% confidence interval (CI): 1.10-3.29, p=0.021), higher C-reactive protein (CRP; HR 1.06, 95%CI: 1.00-1.11, p=0.037) and negative programmed death-ligand 1 (PD-L1) status (HR 2.04, 95%CI: 1.32-3.15, p=0.001), and on OS by CRP (HR 1.09, 95%CI: 1.03-1.14, p=0.002). In men on ICI-CHT combinations, multivariate analyses (MVA) revealed squamous histology (HR 4.00, 95%CI: 1.41-11.2, p=0.009) significant for PFS; ECOG≥2 (HR 5.58, 95%CI: 1.88-16.5, p=0.002) and CRP (HR 1.19, 95%CI: 1.06-1.32, p=0.002) for OS. Among women undergoing ICI monotherapy, no variable proved significant for PFS, ECOG≥2 had a significant interaction with OS (HR 1.90, 95%CI 1.04-3.46, p=0.037). Women treated with ICI-CHT had significant MVA findings for CRP with both PFS (HR 1.09, 95%CI: 1.02-1.16, p=0.007) and OS (HR 1.11, 95%CI: 1.03-1.19, p=0.004). Although men and women responded similarly to both ICI mono- and ICI-CHT treatment, predictors of response differed by sex.

The Sugarcane yellow leaf virus (SCYLV) is associated with sugarcane yellow leaf disease (SCYLD) and is considered to be the most economically deleterious emerging pathogen that represents a potential threat and danger to sugarcane cultivation in China. Over the last two decades, high genetic diversity in the SCYLV genotypes was observed worldwide, with a greater chance of YLD incidence for sugarcane injury. SCYLV infection has significantly damaged its economic traits and is responsible for substantial losses in biomass production in sugarcane cultivars. This study aims to identify and comprehensively analyze sugarcane microRNAs (miRNAs) as therapeutic targets against SCYLV using plant miRNA prediction tools. Mature sugarcane miRNAs are retrieved and are used for hybridization of the SCYLV. A total of seven common sugarcane miRNAs were selected based on consensus genomic positions. The biologically significant, top ranked ssp-miR528 was consensually predicted to have a potentially unique hybridization site at nucleotide position 4162 for targeting the ORF5 of the SCYLV genome; this was predicted by all the algorithms used in this study. Then, the miRNA–mRNA regulatory network was generated using the Circos algorithm, which was used to predict novel targets. There are no acceptable commercial SCYLV-resistant sugarcane varieties available at present. Therefore, the predicted biological data offer valuable evidence for the generation of SCYLV-resistant sugarcane plants.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Defects in pre-mRNA splicing are frequently a cause of Mendelian disease. Despite the advent of next-generation sequencing, allowing a deeper insight into a patient’s variant landscape, the ability to characterize variants causing splicing defects has not progressed with the same speed. To address this, recent years have seen a sharp spike in the number of splice prediction tools leveraging machine learning approaches, leaving clinical geneticists with a plethora of choices for in silico analysis. In this Review, some basic principles of machine learning are introduced in the context of genomics and splicing analysis. A critical comparative approach is then used to describe seven recent machine learning-based splice prediction tools, revealing highly diverse approaches and common caveats. We find that, although great progress has been made in producing specific and sensitive tools, there is still much scope for personalized approaches to prediction of variant impact on splicing. Such approaches may increase diagnostic yields and underpin improvements to patient care.

In the steeply inclined and extremely thick coal seams (SIETCS) mined using the horizontal sublevel top-coal caving (HSTCC) method, the uncertainty of gas emission is a safety threat to the mining operations. In order to reduce the occurrence of accidents, the determination of gas emission is crucial. In this paper, we first proposed a prediction model for workers at the floor coalbed to calculate gas emission on site. We then put forward a finite element numerical simulation for researchers to predict gas emission from the floor coalbed. At last, we measured gas emitted from the floor coalbed of SIETCS in Wudong Coal Mine in a specific mining period and used the data to verify the applicability and accuracy of these two gas-emission prediction methods. The results showed that the gas emission from Wudong Coal Mine was 1.08 m³/min calculated based on the prediction model and 1.07 m³/min obtained using the user-defined integration method. Both methods have their own advantages, disadvantages and applicable objects, and are important in predicting gas emission from SIETCS mined using HSTCC method.

Software fault prediction is the very consequent research topic for software quality assurance. Data driven approaches provide robust mechanisms to deal with software fault prediction. However, the prediction performance of the model highly depends on the quality of dataset. Many software datasets suffers from the problem of class imbalance. In this regard, under-sampling is a popular data pre-processing method in dealing with class imbalance problem, Easy Ensemble (EE) present a robust approach to achieve a high classification rate and address the biasness towards majority class samples. However, imbalance class is not the only issue that harms performance of classifiers. Some noisy examples and irrelevant features may additionally reduce the rate of predictive accuracy of the classifier. In this paper, we proposed two-stage data pre-processing which incorporates feature selection and a new Rough set Easy Ensemble scheme. In feature selection stage, we eliminate the irrelevant features by feature ranking algorithm. In the second stage of a new Rough set Easy Ensemble by incorporating Rough K nearest neighbor rule filter (RK) afore executing Easy Ensemble (EE), named RKEE for short. RK can remove noisy examples from both minority and majority class. Experimental evaluation on real-world software projects, such as NASA and Eclipse dataset, is performed in order to demonstrate the effectiveness of our proposed approach. Furthermore, this paper comprehensively investigates the influencing factor in our approach. Such as, the impact of Rough set theory on noise-filter, the relationship between model performance and imbalance ratio etc. comprehensive experiments indicate that the proposed approach shows outstanding performance with significance in terms of area-under-the-curve (AUC).

Cold-water coral reefs are rich, yet fragile ecosystems found in colder oceanic waters. Knowledge of their spatial distribution on continental shelves, slopes, seamounts and ridge systems is vital for marine spatial planning and conservation. Cold-water corals frequently form conspicuous carbonate mounds of varying sizes, which are identifiable from multibeam echosounder bathymetry and derived geomorphometric attributes. However, the often large number of mounds makes manual interpretation and mapping a tedious process. We present a methodology that combines image segmentation and random forest spatial prediction with the aim to derive maps of carbonate mounds and an associated measure of confidence. We demonstrate our method based on multibeam echosounder data from Iverryggen on the mid-Norwegian shelf. We identified the image-object mean planar curvature as the most important predictor. The presence and absence of carbonate mounds is mapped with high accuracy (overall accuracy = 84.4%, sensitivity = 0.827 and specificity = 0.866). Spatially-explicit confidence in the predictions is derived from the predicted probability and whether the predictions are within or outside the modelled range of values and is generally high. We plan to apply the showcased method to other areas of the Norwegian continental shelf and slope where MBES data have been collected with the aim to provide crucial information for marine spatial planning.

The philosophy of testing statistical hypothesis is a natural consequence and functional extension of mathematical analysis of Probability. Along with the concept of recurrence when applied to random sequences and functions, it leads to the analysis of a priori and posterior which implies testing statistical hypothesis. Testing statistical hypothesis also involves algebraic, functional and dimensional considerations, which are found in the works of Laplace. Aspects of mathematical analysis such as universality of solutions, Laws of Large Numbers, Entropy, Information, and various functional dependencies are the main factors explained in the five properties that lead to implication of testing statistical hypothesis. Various interesting examples with modern scientific significance from genetics, astrophysics, and other areas give methodological access to answers of different problems and phenomena which are involved in the logic of testing statistical hypothesis.

The growth rate in academic and scientific publications increased very fast. Researchers must choose a good representative and significant literature in publications, which has become challenging worldwide. Usually, the paper citation number indicates this paper's potential influence and importance. However, this standard metric of citation numbers cannot be used as a measurement to judge the popularity and significance of the recently published papers. To address this challenge, this paper presents an effective prediction method called FutureCite to predict the future citation level of research articles. FutureCite combines machine learning with text and graph mining techniques, leveraging their abilities in classification, datasets in-depth analysis, and feature extraction. FutureCite aims to predict future citation levels of research articles applying a multilabel classification approach. FutureCite can extract significant semantic features and capture the interconnection relationships found in scientific articles during feature extraction using textual content, citation networks, and metadata as feature resources. Our goal is to contribute to the advancement of substantial effective approaches impacting the citation counts in scientific publications by enhancing the precision of future citations. We conducted several experiments using a comprehensive publication dataset to evaluate our method and determine the impact of using a variety of machine learning algorithms. FutureCite demonstrated its robustness and efficiency and showed promising results based on different evaluation metrics. Using the FutureCite model has significant implications in improving the researchers' ability to determine targeted literature for their research and better understand the potential impact of research publications.

Improving the quality of petroleum products and refining processes through the use of artificial intelligence and machine learning techniques is the topic of this article. It shows that expert knowledge and conventional empirical models can't get you where you want to go in a refining process. To effectively capture complex interactions and forecast fuel qualities, machine learning techniques such as principal component analysis (PCA), support vector machines (SVM), artificial neural networks (ANN), and partial least squares (PLS) are suggested. Gasoline and other petroleum products, as well as property prediction, process control, product quality, and operational efficiency in refineries, can all be improved with the help of machine learning applied to spectral or distillation curve data. An exciting new direction in optimizing operations, meeting environmental norms, and precisely estimating gasoline quality is offered by advanced machine learning algorithms.

The statistical analysis of impact of the top 50 solar flares of X-class (1997-2023) on the global seismic activity, as well as on the earthquake preparation zones located in illuminated part of the globe and in the area of 5000 km radius around the subsolar point was carried out. It is shown by a method of epoch superposition that for all cases the increase of seismicity is observed, especially in the region around the subsolar point (up to 38%) during 10 days after the solar flare in comparison with preceding 10 days. The case study of aftershock sequence of strong M=9.1 earthquake (Su-matra-Andaman Islands, 26.12.2004) after the solar flare of X7.2 class (20.01.2005) demonstrated that the number of aftershocks with magnitude M≥2.5 increases more than 20 times after the solar flare with a delay of 7 days. For the case of the Darfield earthquake (M=7.1, 04.09.2010, New Zealand) it was shown that strong solar flares of class X and M probably triggered two strong aftershocks (M>6) with the same delay of 6 days on the Port Hills fault, which is the most sensitive to external electromagnetic impact from point of view of the fault electrical conductivity and orientation. Based on the obtained results the possible application of natural electromagnetic triggering of earthquakes is discussed for a short-term earthquake prediction using confidently recorded strong external electromagnetic triggering impacts on the specific earthquake preparation zones, as well as ionospheric perturbations due to aerosol emission from the earthquake sources recorded by satellites.

High-rise building machines (HBMs) play a critical role in the successful construction of super-high skyscrapers, providing essential support and ensuring safety. The HBM’s climbing system relies on a jacking mechanism consisting of several independent jacking cylinders. A reliable control system is imperative to maintain a smooth posture of the construction steel platform (SP) under the action of the jacking mechanism. This research introduces three multivariate time series neural network models—namely, Long Short-Term Memory (LSTM), Gated Recurrent Unit (GRU), and Temporal Convolutional Network (TCN)—to predict the posture of HBM. The models take pressure and stroke measurements from the jacking cylinders as inputs, and their outputs determine the levelness of the SP and the posture of the HBM at various climbing stages. The development and training of these neural networks are based on historical on-site data, with the predictions subjected to thorough comparative analysis. All proposed neural network models exhibit the capability to dynamically predict the posture of the HBM during the climbing process, using data from sensors. Notably, the GRU model shows better predictive performance.

The synthesis and characterization of the multicomponent crystals formed by 2,2’-thiodiacetic acid (H2tda) and 2,6-diaminopurine (Hdap) or N9-(2-hydroxyethyl)adenine (9heade) are reported. The crystals are in the salt rather than cocrystal form, as witnessed by single crystal X-ray diffractometry where a structural analysis revealed their ionic nature, confirming the proton transfer from the 2,2’-thiodiacetic acid to the basic groups of the coformers. The new multicomponent crystals have molecular formulas [(H9heade+)(Htda)] (1) and [(H2dap+)2(tda2)]·2H2O (2), and were also characterized by FTIR, elemental analysis as well as thermogravimetric/differential scanning calorimetry (TG/DSC) analyses. In the crystal packing the ions interact with each other via O–H···N, O–H···O. N–H···O and N–H···N hydrogen bonds generating cyclic hydrogen bonded motifs with graph-set notation of R22(16), R22(10), R32(10), R33(10), R22(9), R32(8) and R42(8), to form different supramolecular homo- and hetero-synthons. In addition, in the crystal packing of 2, pairs of diaminopurinium ions display an strong anti-parallel ,-stacking interaction, with short inter-centroids and interplanar distances (3.39 and 3.24 Å respectively) and fairly tight angle (17.5°). These assemblies have been further analyzed energetically by using DFT calculations, MEP surface analysis and QTAIM characterization.

Abstract: In recent years, the construction engineering sector has undergone a transformative shift towards the integration of machine learning (ML) techniques, particularly in predicting the properties of steel fiber-reinforced concrete (SFRC). Despite the theoretical sophistication of existing models, a persistent challenge remains – their opacity, lacking transparency and real-world relevance for practi-tioners. To address this gap and advance our current understanding, this study employs the extra gradient (XG) Boosting algorithm, crafting a comprehensive ap-proach. Grounded in a meticulously curated database drawn from 43 seminal pub-lications, encompassing 420 distinct records, this research focuses predominantly on three primary fiber types: crimped, hooked, and mil-cut. Complemented by hands-on experimentation involving 20 diverse SFRC mixtures, this empirical campaign is further illuminated through the strategic use of Partial Dependence Plots (PDPs), revealing intricate relationships between input parameters and con-sequent compressive strength. A pivotal revelation of this research lies in the identification of optimal SFRC formulations, offering tangible insights for real-world applications. The developed ML model stands out not only for its sophistication but also its tangible accuracy, evidenced by exemplary performance against inde-pendent datasets, boasting a commendable mean target-prediction ratio of 99%. To bridge the theory-practice gap, we introduce a user-friendly digital interface, thri-ughly designed to guide professionals in optimizing and accurately predicting the compressive strength of SFRC. This research thus contributes to the construction and civil engineering sectors by enhancing predictive capabilities and refining mix designs, fostering innovation, and addressing the evolving needs of the industry.

Cotton leaf curl Kokhran virus (CLCuKoV) (genus, Begomovirus; family, Geminiviridae) is highly infectious, widespread and the most dangerous pathogen of cotton (Gossypium hirsutum L.) that is responsible to a serious disorder, cotton leaf curl disease (CLCuD). Begomoviruses are spread very efficiently by the whitefly Bemisia tabaci cryptic species, causing economic losses to cotton crop, all over the world. The ‘Lucknow’ strain of CLCuKoV has emerged as a divergent isolate that could cause CLCuD. The monopartite ssDNA genome of CLCuKoV-Lu (2.7 Kb) contains six open reading frames (ORFs) that was shown to encode four major proteins. RNA interference (RNAi)-based antiviral innate immunity is a sequence-specific biological phenomenon and a powerful tool to control plant viruses. The present study aims to determine cotton locus-derived microRNAs (ghr-miRNAs) that are identified for targeting the CLCuKoV-Lu ss-DNA-encoded mRNAs using a predictive approach that involves four computational algorithms, miRanda, RNA22, psRNATarget and RNAhybrid. Mature ghr-miRNA sequences (n=80) from allotetraploid upland cotton (2n = 4x = 52) were selected from the miRBase and were tested for alignment with the CLCuKoV-Lu genome. Among the 80 cotton locus-derived ghr-miRNAs evaluated, only one consensus cotton locus-derived ghr-miRNA (ghr-miR2950) was concluded to have effective ghr-miRNA target site at common nucleotide position 82 in the CLCuKoV-Lu genome respectively, using a stringent criterion, identified by all the algorithms used. The miRNA targeting is reliant on base pairing of miRNA-mRNA target pairings. Conservation of the hybridization binding site of the predicted ghr-miR2950 was validated using multiple sequence alignment within all the strains of CLCuKoV. We constructed a regulatory interaction network of miRNA–mRNA to identify novel targets. The efficacy of the predicted miRNAs against CLCuKoV-Lu was evaluated by RNAi-mediated targeted mRNA cleavage. The current investigated miRNA targets provide evidence for the development of CLCuD-resistant cotton plants.

Transportation authorities aim to boost road safety by identifying risky locations and applying suitable safety measures. The Highway Safety Manual (HSM) is a vital resource for US transportation professionals, aiding in the creation of Safety Performance Functions (SPFs), which are predictive models for crashes. These models rely on Negative Binomial distribution-based regression and misinterpreting them due to unmet statistical assumptions can lead to erroneous conclusions, including inaccurately assessing crash rates or missing high-risk sites. The Florida Department of Transportation (FDOT) has introduced context classifications to HSM SPFs, complicating assumption violation identification. This study, part of an FDOT-sponsored project, investigates established statistical diagnostic tests to identify model violations and proposes a novel approach to determine optimal spatial regions for Empirical Bayes adjustment. This adjustment aligns HSM-SPFs with regression assumptions. The study employs a case study involving Florida roads. Results indicate that a 20-mile radius offers an optimal spatial sample size for modeling crashes of all injury levels, ensuring accurate assumptions. For severe injury crashes, which are less frequent and harder to predict, a 60-mile radius is suggested to fulfill statistical modeling assumptions. This methodology guides FDOT practitioners in assessing the conformity of HSM-SPFs with intended assumptions and determining appropriate region sizes.

Strong convective storms can be a serious threat to modern society, influencing both the economy and human life. Thunderstorms can bring much-needed rain after a dry spell, but the nature of thunderstorm mostly causes damage due to high wind associated with it and heavy intensity rain that mostly causes quick overlandflow and flashfloods. The paper focused on the 2011 Pukkelpop event in Belgium where due to heavy thunderstorm a lot of financial damage occurred, and five casualties. In this paper we look into the basic elements that enforces the creation of a thunderstorm like CAPE and windshear. A representative grid has been taken from the Alaro-0 model of 12.5 km resolution for the analysis of the thunderstorm over Belgium which is detailed out in the methodology. The model runs of Alaro-0 from Royal Meteorological Institute of Belgium (RMI) is used for historical and future years for CAPE and Shear. We look into STEnv which is a composite number that can provide some insight on occurrence of thunderstorm, and STEnv is when CAPE*Shear exceeds certain threshold. In this study the threshold has been chosen as 97%. Only summer months have been taken into account into this study as summer(s) has the most thunderstorm in Belgium. The analysis of CAPE and STEnv over historical period (1977-2005), near future (2041-2069) and far future (2071-2099) shows significant increase in occurrence of thunderstorm in the 2071-2099s, specially in extreme cases such as 97% and 99% quantile. CAPE (J/Kg) increases in all future scenarios compared to the historical period. In 2071-2099s, CAPE increases from 2100 J/Kg to 2300 J/Kg (90% quantile) and from 3500 J/Kg to 3900 J/Kg (99% quantile) compared to the historical period. The number of STEnv increases from 300 to 378 in top 10% storm case (90% quantile), 158 to 218 in top 5% storm (95% quantile), 97 to 153 in top 3% storm (97% quantile) and 33 to 66 in top 1% storm (99% quantile) with a 90% confidence interval overall. Shear mostly remains unchanged. The study also shows spatial variation of CAPE, shear and STEnv over Belgium for present and future scenarios in different extremities (90%, 95%, 97% and 99% quantiles). There is a good indication that increase in CAPE translates to increase in STEnv, which is an accepted measure to predict occurrence of thunderstorm. Future climate change also amplifies the occurrence of thunderstorm, which is coherent with relevant studies. The uncertainty related to the study can be reduced with more detailed dataset and involvement of numerical weather prediction models beyond data statistics.

Electroencephalography (EEG) signals are the primary source for discriminating the preictal from the interictal stage, enabling early warnings before the seizure onset. The epileptic seizure prediction models face significant challenges due to data scarcity, diversity, and privacy. This paper proposes a three-tier architecture for epileptic seizure prediction associated with the Federated Learning (FL) model that enhances the capability by utilizing the significant amount of seizure patterns from globally distributed patients with data privacy. The determination of the preictal state is influenced by global and local model-assisted decision-making by modeling the two-level edge layer. Integrating the Spiking Encoder (SE) with Graph Convolutional Neural Network (Spiking-GCNN) works as the local model trained using the bi-timescale approach. Each local model utilizes the aggregated seizure knowledge from the different medical centers through FL and determines the preictal probability in the coarse-grained personalization. The Adaptive Neuro-Fuzzy Inference System (ANFIS) is utilized in fine-grained personalization to recognize epileptic seizure patients by examining the outcomes of the FL model, heart rate variability features, and patient-specific clinical features. The proposed seizure prediction is evaluated using benchmark datasets by comparing them with the existing works to demonstrate the potential results.

Anti-islet autoantibodies serve as key markers in immune-mediated type 1 diabetes (T1D) and slowly-progressive T1D (SPIDDM), also known as latent autoimmune diabetes in adults (LADA). Autoantibodies to insulin (IAA), glutamic acid decarboxylase (GADA), tyrosine phosphatase-like protein IA-2 (IA-2A), and zinc transporter 8 (ZnT8A) are currently employed in the diagnosis, pathological analysis, and prediction of T1D. GADA can also be detected in non-diabetic patients with autoimmune diseases other than T1D and may not necessarily reflect insulitis. Conversely, IA-2A and ZnT8A serve as surrogate markers of pancreatic β-cell destruction. Combinatorial analysis of these four anti-islet autoantibodies demonstrated that 93-96% of acute-onset T1D and SPIDDM cases were diagnosed as immune-mediated T1D, while the majority of fulminant T1D cases were autoantibody-negative. Evaluating the epitopes and immunoglobulin subclasses of anti-islet autoantibodies help distinguish between diabetes-associated and non-diabetes-associated autoantibodies and is valuable for predicting future insulin deficiency in SPIDDM (LADA) patients. Additionally, GADA in T1D patients with autoimmune thyroid disease reveals the polyclonal expansion of autoantibody epitopes and immunoglobulin subclasses. Recent advancements in anti-islet autoantibody assays include nonradioactive fluid-phase assays and the simultaneous determination of multiple biochemically defined autoantibodies. Developing a high-throughput assay for detecting epitope-specific or immunoglobulin isotype-specific autoantibodies will facilitate more accurate diagnosis and prediction of autoimmune disorders.

(1) Birth asphyxia is the major cause for delivery room resuscitation. Subsequent organ failure and hypoxic-ischemic encephalopathy (HIE) account for 25% of all early postnatal deaths. The neonatal Sequential Organ Failure Assessment (nSOFA) considers platelet count, respiratory and cardiovascular dysfunction in neonates with sepsis. To evaluate whether nSOFA is also a useful predictor for in-hospital mortality in neonates (≥ 36+0 weeks of gestation (GA)) following asphyxia with HIE and therapeutic hypothermia (TH), (2) nSOFA was documented at ≤ 6 hours of life. (3) 65 infants fulfilled inclusion criteria for TH. All but one infant received cardiopulmonary resuscitation and/or respiratory support at birth. nSOFA was lower in survivors (median 0 [IQR 0-2]; n = 56, median GA 39+3, female n = 28 (50%)) than in non-survivors (median 10 [4-12], p < 0.001; n = 9, median GA 38+6, n = 4 (44.4%)). This was also observed for the respiratory (p < 0.001), cardiovascular (p < 0.001), and hematologic sub scores (p = 0.003). The odds ratio for mortality was 1.6 [95% CI = 1.2 – 2.1] per one-point increase in nSOFA. The optimal cut-off value of nSOFA to predict mortality was 3.5 (sensitivity 100.0%, specificity 83.9%). (4) Since early accurate prognosis following asphyxia with HIE and TH is essential to guide end-of-life decisions, nSOFA (≤ 6 hours of life) offers the potential to identify infants at risk of mortality.

As one of the fastest-growing new energy sources, wind power technology has attracted widespread attention from all over the world. In order to improve the quality of wind power generation, wind speed prediction is an indispensable task. In this paper, an error correction based Variational Mode Decomposition and Broad Learning System (VMD-BLS) hybrid model is proposed for wind speed prediction. First, the wind speed is decomposed into multiple components by the VMD algorithm, and then an ARMA model is established for each component to find the optimal number of sequence divisions. Second, the BLS model is used to predict each component, and the prediction results are summed to obtain the wind speed forecast value. However, in some traditional methods, there is always time lag, which will reduce the forecast accuracy. To deal with this, a novel error correction technique is developed by utilizing BLS. Through verification experiment with actual data, it proves that the proposed method can reduce the phenomenon of prediction lag, and can achieve higher prediction accuracy than traditional approaches, which shows our method’s effectiveness in practice.

The deformation monitoring information of concrete dams contains some high-frequency com-ponents, and the high-frequency components are strongly nonlinear, which reduces the accuracy of dam deformation prediction. In order to solve such problems, this paper proposes a concrete dam deformation monitoring model based on empirical mode decomposition (EMD) combined with wavelet threshold noise reduction and sparrow search algorithm (SSA) optimization of long short-term memory network (LSTM). The model uses EMD combined with wavelet threshold to decompose and denoise the measured deformation data. On this basis, the LSTM model based on SSA optimization is used to mine the nonlinear function relationship between the reconstructed monitoring data and various influencing factors. The example analysis shows that the model has good calculation speed, fitting and prediction accuracy and it can effectively mine the date char-acteristics inherent in the measured deformation, and reduce the influence of noise components on the modeling accuracy.

While thunderstorms can pose severe risks to property and life, forecasting remains challenging, even at short lead times, as these often arise in meta-stable atmospheric conditions. In this paper, we examine the question of how well we could perform short-term (up to 180min) forecasts using exclusively multi-spectral satellite images and past lighting events as data. We employ representation learning based on deep convolutional neural networks in an “end-to-end” fashion. Here, a crucial problem is handling the imbalance of the positive and negative classes appropriately in order to be able to obtain predictive results (which is not addressed by many previous machine-learning-based approaches). The resulting network outperforms previous methods based on physically-based features and optical flow methods (similar to operational prediction models) and generalizes across different years. A closer examination of the classifier performance over time and under masking of input data indicates that the learned model actually draws most information from structures in the visible spectrum, with infrared imaging sustaining some classification performance during the night.

The following article presents an analysis of the determinants of diabetes using a dataset containing the surveys of 2000 patients from the Frankfurt Hospital in Germany. The data were analyzed using the following models, namely: Tobit, Probit, Logit, Multinomial Logit, OLS, WLS with heteroskedasticity. The results show that the presence of diabetes is positively associated with "Pregnancies", "Glucose", "BMI", "Diabetes Pedigree Function", "Age" and negatively associated with "Blood Pressure". A cluster analysis is realized using the fuzzy c-Means algorithm optimized with the Elbow method and three clusters were found. Finally a confrontation among eight different machine learning algorithms is realized to select the best performing algorithm to predict the probability of patients to develop diabetes.

Burrs form due to plastic deformation of materials during machining processes, such as milling and drilling. Deburring can be very difficult when the burrs are not easily accessible for removal. In this study, abrasive flow machining (AFM) was adopted for deburring the edges of milling specimens. Based on the experimental observations on AL6061 specimens, the deburring performance was characterized in terms of flow speed, the local curvature of the streamline near the burr edge, and shear stress. A new objective function that can predict the extent of deburring is proposed based on these characteristics and validated through experiments. Based on this new objective function, a prediction of deburring performance on the burr edge of the intersecting holes with offset was performed. The results between the predicted and experimental observation results were in reasonable agreement.

Concussion, also known as mild traumatic brain injury (mTBI), commonly causes transient neurocognitive symptoms, but in some cases, it causes cognitive impairment, including working memory (WM) deficit, which can be long-lasting and impede a patient’s return to work. The predictors of long-term cognitive outcomes following mTBI remain unclear because abnormality is often absent in structural imaging findings. The purpose of the study was to determine whether machine learning-based models using functional magnetic resonance imaging (fMRI) biomarkers and demographic or neuropsychological measures at baseline could effectively predict 1-year cognitive outcomes of concussion. We conducted a prospective, observational study of patients with mTBI who were compared with demographically-matched healthy controls enrolled between September 2015 to August 2020. Baseline assessments were collected within the first week of injury, and follow-ups were conducted at 6 weeks, 3 months, 6 months, and 1 year. Potential demographic, neuropsychological, and fMRI features were selected according to the significance of correlation with the estimated changes in WM ability. The support vector machine classifier was trained using these potential features and estimated changes in WM between the predefined time periods. Patients demonstrated significant cognitive recovery at the third month, followed by worsened performance after 6 months, which persisted until 1 year after concussion. Approximately half of the patients experienced prolonged cognitive impairment at 1-year follow up. Satisfactory predictions were achieved for patients whose WM function did not recover at 3 months (accuracy=87.5%), 6 months (accuracy=83.3%), 1 year (accuracy=83.3%), and performed worse at 1-year follow-up compared to baseline assessment (accuracy=83.3%). This study demonstrated the feasibility of personalized prediction for long-term postconcussive WM outcomes based on baseline fMRI and demographic features, opening a new avenue for early rehabilitation intervention in selected individuals with possible poor long-term cognitive outcomes.

Deep reinforcement learning (DRL) has achieved significant results in many Machine Learning (ML) benchmarks. In this short survey we provide an overview of DRL applied to trading on financial markets, including a short meta-analysis using Google Scholar, with an emphasis on using hierarchy for dividing the problem space as well as using model-based RL to learn a world model of the trading environment which can be used for prediction. In addition, multiple risk measures are defined and discussed, which not only provide a way of quantifying the performance of various algorithms, but they can also act as (dense) reward-shaping mechanisms for the agent. We discuss in detail the various state representations used for financial markets, which we consider critical for the success and efficiency of such DRL agents. The market in focus for this survey is the cryptocurrency market.

An accurate outbreak prediction of COVID-19 can successfully help to get insight into the spread and consequences of infectious diseases. Recently, machine learning (ML) based prediction models have been successfully employed for the prediction of the disease outbreak. The present study aimed to engage an artificial neural network-integrated by grey wolf optimizer for COVID-19 outbreak predictions by employing the Global dataset. Training and testing processes have been performed by time-series data related to January 22 to September 15, 2020 and validation has been performed by time-series data related to September 16 to October 15, 2020. Results have been evaluated by employing mean absolute percentage error (MAPE) and correlation coefficient (r) values. ANN-GWO provided a MAPE of 6.23, 13.15 and 11.4% for training, testing and validating phases, respectively. According to the results, the developed model could successfully cope with the prediction task.

IoT system becomes hot topic nowadays for smart home, IoT helps devices to communicate together without human intervention inside home, so it is offering many challenges. A new smart home IoT platform powered using electromagnetic energy harvesting is proposed in this paper. It contains a high gain transmitted antenna array and efficient circular polarized array rectenna system to harvest enough power from any direction to increase life time of the batteries used in IoT system. Optimized energy consumption, the software with adopting the Zigbee protocol of the sensor node and low power microcontroller are used to operate in lower power modes. The proposed system has an 84.6 days lifetime which is approximately 10 times the lifetime for similar system. On the other hand, the proposed power management circuit operated at 0.3 V DC to boost the voltage to ~3.7V from radio frequency energy harvesting and manage battery level to increase the batteries lifetime. A predictive indoor environment monitoring system is designed based on a novel hybrid system to provide a non-static plan, approve energy consumption and avoiding failure of sensor nodes in smart home.

Evaporation is one of the main processes in the hydrological cycle, and it is one of the most critical factors in agricultural, hydrological, and meteorological studies. Due to the interactions of multiple climatic factors, the evaporation is a complex and nonlinear phenomenon; therefore, the data-based methods can be used to have precise estimations of it. In this regard, in the present study, Gaussian Process Regression (GPR), Nearest-Neighbor (IBK), Random Forest (RF) and Support Vector Regression (SVR) were used to estimate the pan evaporation (PE) in the meteorological stations of Golestan Province, Iran. For this purpose, meteorological data including PE, temperature (T), relative humidity (RH), wind speed (W) and sunny hours (S) collected from the Gonbad-e Kavus, Gorgan and Bandar Torkman stations from 2011 through 2017. The accuracy of the studied methods was determined using the statistical indices of Root Mean Squared Error (RMSE), correlation coefficient (R) and Mean Absolute Error (MAE). Furthermore, the Taylor charts utilized for evaluating the accuracy of the mentioned models. The outcome indicates that the optimum state of Gonbad-e Kavus, Gorgan and Bandar Torkman stations, Gaussian Process Regression (GPR) with the error values of 1.521, 1.244, and 1.254, the Nearest-Neighbor (IBK) with error values of 1.991, 1.775, and 1.577, Random Forest (RF) with error values of 1.614, 1.337, and 1.316, and Support Vector Regression (SVR) with error values of 1.55, 1.262, and 1.275, respectively, have more appropriate performances in estimating PE. It found that GPR for Gonbad-e Kavus Station with input parameters of T, W and S and GPR for Gorgan and Bandar Torkmen stations with input parameters of T, RH, W, and S had the most accurate performances and proposed for precise estimation of PE. Due to the high rate of evaporation in Iran and the lack of measurement instruments, the findings of the current study indicated that the PE values might be estimated with few easily measured meteorological parameters accurately.

Accurate and stable cost forecasting of substation projects is of great significance to ensure the economic construction and sustainable operation of power engineering projects. In this paper, a forecasting model based on the improved least squares support vector machine (ILSSVM) optimized by wolf pack algorithm(WPA) is proposed to improve the accuracy and stability of the cost forecasting of substation projects. Firstly, the optimal features are selected through the data inconsistency rate (DIR), which helps reduce redundant input vectors. Secondly, the wolf pack algorithm is used to optimize the parameters of the improved least square support vector machine. Lastly, the cost forecasting method of WPA-DIR-ILSSVM is established. In this paper, 88 substation projects in different regions from 2015 to 2017 are chosen to conduct the training tests to verify the validity of the model. The results indicate that the new hybrid WPA-DIR-ILSSVM model presents better accuracy, robustness and generality in cost forecasting of substation projects.

This paper presents a methodology for determining the sensitivity of the main air flow directions in ventilation subnetworks to changes of aerodynamic resistance and of air density in mine workings. Formulae for determination of the sensitivity of the main subnetwork air flows by establishing the degree of dependency of the air volume stream in a given working on the variations in resistance or air density of other workings of the network have been developed. They have been implemented in the VentGraph mine ventilation network simulator. This software, widely used in Polish collieries provides an extended possibility to predict the process of ventilation, air distribution and, in the case of underground fire, also the spread of combustion gasses. The new method facilitates assessment by mine ventilation services of the stability of ventilation systems in exploitation areas and determine of the sensitivity of the main subnetwork air flow directions to changes of aerodynamic resistance and air density. Recently in some Polish collieries new longwalls are developed in seams located deeper then the bottom of the intake shaft. Such solution is called “exploitation below the level of access” or “sublevel”. The new approach may be applied to such developments to assess the potential of changes of direction and air flow rates. In addition, interpretation of the developed sensitivity indicator is presented. While analyzing air distributions for sublevel exploitation, application of current numerical models for calculations of the distribution results in tangible benefits, such as the evaluation of the safety or risk levels for such exploitation. Application of the VentGraph computer program, and particularly the module POŻAR (fire) with the newly developed options, enables an additional approach to the sensitivity indicator in evaluating air flow safety levels for the risks present during exploitation below the level of the intake shaft. The analyses performed and examples presented enabled useful conclusions in mining practice to be drawn.

In the rapidly evolving field of real estate economics, the prediction of house prices continues to be a complex challenge, intricately tied to a multitude of socio-economic factors. However, traditional predictive models have often overlooked the spatial interdependencies that play a vital role in shaping housing prices. This study applies Graph Neural Networks (GNNs) on Open Statistics Knowledge Graphs to model spatial dependencies and predict house prices across Scotland’s 2011 data zones. To this end, integrated statistical indicators are retrieved from the official Scottish Open Government Data portal. The three representative GNN algorithms employed - ChebNet, GCN, and GraphSAGE - demonstrate higher prediction accuracy than traditional models, including the tabular-based XGBoost and a simple Multi-Layer Perceptron (MLP). In addition, local and global explainability are employed to increase transparency and trust in the predictions made by the most accurate GNN - GraphSAGE. The global feature importance is determined by a logistic regression surrogate model while the local, region-level understanding of the GNN predictions is achieved through the use of GNNExplainer. Explainaibility results are compared with those from a previous work that applied the XGBoost machine learning algorithm and the SHapley Additive exPlanations (SHAP) explainability framework on the same dataset. Interestingly, both global surrogate model and the SHAP approach underscored the Comparative Illness Factor, a health indicator, and the ratio of detached dwellings as the most crucial features in the global explainability. In the case of local explanations, while both methods showed similar results, the GNN approach provided a richer, more comprehensive understanding of the predictions for two specific data zones.

This review focuses on the emerging evidence for the association between estimated cardiorespiratory fitness (eCRF) and metabolic risk factors. Given the challenges associated with directly measuring cardiorespiratory fitness (CRF) in large populations, eCRF presents a practical alternative for predicting metabolic health risks. A literature search identified six relevant cohort studies from 2021 to 2024 that investigated the association of eCRF with hypertension, hyperglycemia, dyslipidemia, and obesity. The review findings highlight a consistent inverse relationship between higher eCRF and lower incidence of metabolic risks in line with CRF cohort studies. This review highlights the importance of low eCRF as a primordial indicator for metabolic risks and underscores the need for broader application. Future research directions should include exploring eCRF's predictive accuracy across diverse populations and health outcomes and testing its real-world applicability in healthcare and public health settings.