Wetlands are recognized as one of the world’s most valuable natural resources. With the increasing world population, human demands on wetland resources for agricultural expansion and urban development continue to increase. In addition, global climate change has pronounced impacts on wetland ecosystems through alterations in hydrological regimes. To better manage and conserve wetland resources, we need to know the distribution and extent of wetlands and monitor their dynamic changes. Wetland maps and inventories can provide crucial information for wetland conservation, restoration, and management. Geographic Information System (GIS) and remote sensing technologies have proven to be useful for mapping and monitoring wetland resources. Recent advances in geospatial technologies have greatly increased the availability of remotely sensed imagery with better and finer spatial, temporal, and spectral resolution. This chapter presents an introduction to the uses of GIS and remote sensing technologies for wetland mapping and monitoring. A case study is presented to demonstrate the use of high-resolution light detection and ranging (LiDAR) data and aerial photographs for mapping prairie potholes and surface hydrologic flow pathways.

Imaging lidars are one of the hottest topics in the optronics industry. The need to sense the surroundings of every autonomous vehicle has pushed forward a career to decide the final solution to be implemented. The diversity of state-of-the art approaches to the solution brings, however, a large uncertainty towards such decision. This results often in contradictory claims from different manufacturers and developers. Within this paper we intend to provide an introductory overview of the technology linked to imaging lidars for autonomous vehicles. We start with the main single-point measurement principles, and then present the different imaging strategies implemented 8 in the different solutions. An overview of the main components most frequently used in practice is also presented. Finally, a brief section on pending issues for lidar development has been included, 10 in order to discuss some of the problems which still need to be solved before an efficient final implementation.Beyond this introduction, the reader is provided with a detailed bibliography containing both relevant books and state of the art papers.

QSO B0218+357 is a blazar located at a cosmological redshift of 0.944. The source is gravitationally lensed by a spiral galaxy located at the redshift of 0.68. Strong gravitational lensing splits the signals emitted by the source into two components separated by 10-12 days, as observed in radio and gamma-ray bands. In July 2014 a GeV flare was observed by Fermi-LAT, triggering follow-up observations with the MAGIC telescopes at energies above 100 GeV. The expected time delay between the components allowed us to plan broad band MWL observations before, during and after the trailing component of the emission. The MAGIC observations at the expected time of arrival of the trailing component resulted in the first detection of QSO B0218+357 in Very-High-Energy (VHE, >100 GeV) gamma rays. It is both the farthest known VHE object and one of only a few Flat Spectrum Radio Quasars detected in this energy range. We report here the observed multiwavelength spectral and temporal properties of the emission during the 2014 flare.

In this paper, the technical aspects of a multi-lidar instrument, the long-range WindScanner system, will be presented accompanied by an overview of the results from several field campaigns. The long-range WindScanner system consists of three spatially separated coherent Doppler scanning lidars and a remote master computer that coordinates them. The lidars were carefully engineered to perform arbitrary and time controlled scanning trajectories. Their wireless coordination via the master computer allows achieving and maintaining lidars’ synchronization within ten milliseconds. As a whole, the long-range WindScanner system can measure an entire wind field by emitting and directing three laser beams to intersect, and then by moving the beam intersection over the points of interest. The long-range WindScanner system was developed to tackle the need for high-quality observations of wind fields from scales of modern wind turbine and wind farms. It has been in operation since 2013.

One of the important features of polymethine (cyanine) dyes is isomerization around one of C–C bonds of the polymethine chain. In this review, spectral properties of the isomers, photoisomerization and thermal back isomerization of carbocyanine dyes, mostly meso-substituted carbocyanine dyes, are considered. meso-Alkyl-substituted thiacarbocyanine dyes are present in polar solvents mainly as cis isomers and, hence, exhibit no photoisomerization, whereas in nonpolar solvents, in which the dyes are in the trans form, photoisomerization takes place. In contrast, the meso-substituted dyes 3,3′-dimethyl-9-phenylthiacarbocyanine and 3,3′-diethyl-9-(2-hydroxy-4-methoxyphenyl)thiacarbocyanine occur as trans isomers and exhibit photoisomerization in both polar and nonpolar solvents. The behavior of these dyes may be explained by the fact that the phenyl ring of the substituent in their molecules can be twisted at some angle, removing the substituent from the plane of the molecule and reducing its steric effect on the conformation of the trans isomer. In some cases, photoisomerization of cis isomers of meso-substituted carbocyanine dyes is also observed (for some meso-alkyl-substituted dyes complexed with DNA and chondroitin-4-sulfate; for 3,3′-diethyl-9-methoxythiacarbocyanine in moderate polarity solvents). The cycle photoisomerization–thermal back isomerization of cyanine dyes can be used in various systems of information storage and deserves further investigation using modern research methods.

Ecosystem physical structure, defined by the quantity and spatial distribution of biomass, influences a range of ecosystem functions. Remote sensing tools permit the non-destructive characterization of canopy and root features, potentially providing opportunities to link above- and belowground structure at fine spatial resolution in functionally meaningful ways. To test this possibility, we employed ground-based portable canopy lidar (PCL) and ground penetrating radar (GPR) along co-located transects in forested sites spanning multiple stages of ecosystem development and, consequently, of structural complexity. We examined canopy and root structural data for coherence at multiple spatial scales ≤ 10 m within each site using wavelet analysis. Forest sites varied substantially in vertical canopy and root structure, with leaf area index and root mass more evenly distributed by height and depth, respectively, as forests aged. In all sites, above- and belowground structure, characterized as mean maximum canopy height and root mass, exhibited significant coherence at a scale of 3.5-4 meters, and results suggest that the scale of coherence may increase with stand age. Our findings demonstrate that canopy and root structure are linked at characteristic spatial scales, which provides the basis to optimize scales of observation. Our study highlights the potential, and limitations, for fusing lidar and radar technologies to quantitatively couple above- and belowground ecosystem structure.

We present a comprehensive database of near-shore wind observations that were carried out during the experimental campaign of the RUNE project. RUNE aims at reducing the uncertainty of the near-shore wind resource estimates from model outputs by using lidar, ocean, and satellite observations. Here we concentrate in describing the lidar measurements. The campaign was conducted from November 2015 to February 2016 at the west coast of Denmark and comprises measurements from eight lidars, an ocean buoy and three types of satellites. The wind speed was estimated based on measurements from a scanning lidar performing PPIs, two scanning lidars performing dual synchronized scans, and five vertical profiling lidars, of which one was operating offshore on a floating platform. The availability of measurements is highest for the profiling lidars, followed by the lidar performing PPIs, those peforming the dual setup, and the lidar buoy. Analysis of the lidar measurements reveals good agreement between the estimated 10-m wind speeds, although the instruments used different scanning strategies and measured different volumes in the atmosphere. The campaign is characterized by strong westerlies with occasional storms.

Nacelle-based Doppler wind lidars have shown promising capabilities to assess power performance, detect yaw misalignment or perform feed-forward control. The power curve application requires uncertainty assessment. Traceable measurements and uncertainties of nacelle-based wind lidars can be obtained through a methodology applicable to any type of existing and upcoming nacelle lidar technology. The generic methodology consists in calibrating all the inputs of the wind field reconstruction algorithms of a lidar. These inputs are the line-of-sight velocity and the beam position, provided by the geometry of the scanning trajectory and the lidar inclination. The line-of-sight velocity is calibrated in atmospheric conditions by comparing it to a reference quantity based on classic instrumentation such as cup anemometers and wind vanes. The generic methodology was tested on two commercially developed lidars, one continuous wave and one pulsed systems, and provides consistent calibration results: linear regressions show a difference of ∼ 0.5 % between the lidar-measured and reference line-of-sight velocities. A comprehensive uncertainty procedure propagates the reference uncertainty to the lidar measurements. At a coverage factor of two, the estimated line-of-sight velocity uncertainty ranges from 3.2 % at 3 m s⁻¹ to 1.9 % at 16 m s⁻¹. Most of the line-of-sight velocity uncertainty originates from the reference: the cup anemometer uncertainty accounts for ∼ 90 % of the total uncertainty. The propagation of uncertainties to lidar-reconstructed wind characteristics can use analytical methods in simple cases, which we demonstrate through the example of a two-beam system. The newly developed calibration methodology allows robust evaluation of a nacelle lidar’s performance and uncertainties to be established in order to further be used for various wind turbines’ applications in confidence.

In August 4 2011, United Nations Environmental Program (UNEP) submitted an unprecedented, scientific, groundbreaking Environmental Assessment Report (EAR) of Ogoniland, to the Nigerian government. This was the outcome of a 14–month intensive evaluation of the extent of pollution. It was intended that UNEP’s recommendations would be implemented to restore the devastated environment, on the one hand, and on the other, counteract the numerous environmental health issues that have for decades, plagued Ogoniland. However, five years post EAR, and, despite the seriousness of the situation, no significant resolution has occurred, both on the part of the government, and on the part of Shell Petroleum Development Company (SPDC) or Shell. To date, millions of Niger Delta residents, particularly those living in the oil-bearing communities, continue to suffer severe consequences. Although, the assessment was conducted in Ogoniland, other communities in the Niger Delta are also affected. This article explores prevailing issues, using Ogoniland (a microcosm of the Niger Delta) as an example. A multidisciplinary approach for sustainable mitigation of environmental health risks in the Niger Delta is paramount, and Environmental Management tools offer valuable strategies. Adopting UNEP’s recommendations for addressing environmental health problems requires implementing the Environmental Management/Environmental Management System (EM/EMS) model.

For multi-sensor integrated systems, such as a mobile mapping system (MMS), data fusion at sensor-level, i.e., the 2D-3D registration between optical camera and LiDAR, is a prerequisite for higher level fusion and further applications. This paper proposes a line-based registration method for panoramic images and LiDAR point cloud collected by a MMS. We first introduce the system configuration and specification, including the coordinate systems of the MMS, the 3D LiDAR scanners, and the two panoramic camera models. We then establish the line-based transformation model for panoramic camera. Finally, the proposed registration method is evaluated for two types of camera models by visual inspection and quantitative comparison. The results demonstrate that the line-based registration method can significantly improve the alignment of the panoramic image and LiDAR datasets under either the ideal spherical or the rigorous panoramic camera model, though the latter is more reliable.

Taiwan developing offshore wind power to promote green energy and self-electricity production. In this study, a Light Detection and Ranging (Lidar) was set up at Chang-Hua development zone one on the sea and 10km away from the seashore. At Lidar location, WRF (3.33km & 2km grid lengths) model and WAsP were used to simulate the wind speed at various elevations. Three days mean wind speed of simulated results were compared with Lidar data. From the four wind data sets, developed five different comparisons to find an error% and R-Squared values. Comparison between WAsP and Floating Lidar was shown good consistency. Lukang meteorological station 10 years wind observations at 5m height were used for wind farm energy predictions. The yearly variation of energy predictions of traditional and TGC wind farm layouts are compared under purely neutral and stable condition. The one-year cycle average surface heat flux over the Taiwan Strait is negative (-72.5 (W/m2) and 157.13 STD), which represents stable condition. At stable condition TGC (92.39%) and 600(92.44%), wind farms were shown higher efficiency. The Fuhai met mast wind data was used to estimate roughness length and power law exponent. The average roughness lengths are very small and unstable atmosphere.

The increasingly affordable price point of terrestrial laser scanners has led to a democratization of instrument availability, but the most common low-cost instruments have yet to be compared in terms of the consistency to measure forest structural attributes. Here, we compared two low-cost terrestrial laser scanners (TLS): the Leica BLK360 and the Faro Focus 120 3D. We evaluate the instruments in terms of point cloud quality, forest inventory estimates, tree-model reconstruction, and foliage profile reconstruction. Our direct comparison of the point clouds showed reduced noise in filtered Leica data. Tree diameter and height were consistent across instruments (4.4% and 1.4% error, respectively). Volumetric tree models were less consistent across instruments, with ~29% bias, depending on model reconstruction quality. In the process of comparing foliage profiles, we conducted a sensitivity analysis of factors affecting foliage profile estimates, showing a minimal effect from instrument maximum range (for forests less than ~50 m in height) and surprisingly little impact from degraded scan resolution. Filtered unstructured TLS point clouds must be artificially re-gridded to provide accurate foliage profiles. The factors evaluated in this comparison point towards necessary considerations for future low-cost laser scanner development and application in detecting forest structural parameters.

We propose a new theory beyond the standard model of elementary-particle physics. Employing the concept of a quantized spacetime, our theory demonstrates that the zero-point energy of the vacuum alone is sufficient to create all the fields, including gravity, the static electromagnetic field, and the weak and strong interactions. No serious undetermined parameters are assumed. Furthermore, the relations between the forces at the quantum-mechanics level is made clear. Using these relations, we quantize Einstein’s gravitational equation: Beginning with the zero-point energy of the vacuum, and after quantizing Newtonian gravity equation, we combine the energies of a static electromagnetic field and gravity in a quantum spacetime. Applying these results to the Einstein gravity equation, we substitute the energy density derived from the zero-point energy in addition to redefining differentials in a quantized spacetime. This is how we derive the quantized Einstein gravitational equation without assuming the existence of macroscopic masses. For the weak interaction, by considering plane-wave electron and the zero-point energy, we obtain a wavefunction that represents a β collapse. In this process, from a different point of view than Weinberg-Salam theory, we derive the masses of the W and Z bosons and the neutrino, and we calculate the radius and lifetime of the neutron. For the strong interaction, we previously reported an analytical theory for calculating the mass of a proton by providing a specific linear attractive potential obtained from the zero-point energy, which agrees well with the measurements. In the present study, we further calculate the strong interaction between two nucleons, i.e., the mass of the pi-meson. The resulting calculated quantities agree with the measurements, which verifies our proposed theory.

Today, non-expensive remote sensing (RS) data from different sensors and platforms can be obtained at short intervals and be used for assessing several kinds of forest characteristics at the level of plots, stands and landscapes. Methods such as composite estimation and data assimilation can be used for combining the different sources of information to obtain up-to-date and precise estimates of the characteristics of interest. In composite estimation a standard procedure is to assign weights to the different individual estimates inversely proportional to their variance. However, in case the estimates are correlated, the correlations must be considered in assigning weights or otherwise a composite estimator may be inefficient and its variance be underestimated. In this study we assessed the correlation of plot level estimates of forest characteristics from different RS datasets, between assessments using the same type of sensor as well as across different sensors. The RS data evaluated were SPOT-5 multispectral data, 3D airborne laser scanning data, and TanDEM-X interferometric radar data. Studies were made for plot level mean diameter, mean height, and growing stock volume. All data were acquired from a test site dominated by coniferous forest in southern Sweden. We found that the correlation between plot level estimates based on the same type of RS data were positive and strong, whereas the correlations between estimates using different sources of RS data were not as strong, and weaker for mean height than for mean diameter and volume. The implications of such correlations in composite estimation are demonstrated and it is discussed how correlations may affect results from data assimilation procedures.

This paper describes the first results of an Image Recognition Based Location (IRBL) for mobile application focusing on the procedure to generate a Database of range images (RGB-D). In an indoor environment, to estimate the camera position and orientation, a prior spatial knowledge of the surrounding is needed. In order to achieve this objective a complete 3D survey of two different environment (Bangbae metro station of Seoul and E.T.R.I. building in Daejeon – Republic of Korea) was performed using LiDAR (Light Detection And Ranging) instrument and the obtained scans were processed in order to obtain a spatial model of the environments. From this, two databases of reference images were generated using a specific software realized by the Geomatics group of Politecnico di Torino (ScanToRGBDImage). This tool allow to generate synthetically different RGB-D images) centered in the each scan position in the environment. Later, the external parameters (X, Y, Z, ω, φ, κ) and the range information extracted from the DB images retrieved, are used as reference information for pose estimation of a set of acquired mobile pictures in the IRBL procedure. In this paper the survey operations, the approach for generating the RGB-D images and the IRB strategy are reported. Finally the analysis of the results and the validation test are described.

Questions: Elevation, biodiversity, and forest structure are commonly correlated, but their relationships near the positive extremes of biodiversity and elevation are unclear. We asked 1) How does forest structure vary with elevation in a high biodiversity, high topographic complexity region? 2) Does forest structure predict vascular plant biodiversity? 3) Is plant biodiversity more strongly related to elevation or to forest structure? Location: Great Smoky Mountains National Park, USAMethods: We used terrestrial LiDAR scanning (TLS) to characterize vegetation structure in 12 forest plots. We combined two new canopy structural complexity metrics with traditional TLS-derived forest structural metrics and vascular plant biodiversity data to investigate correlations among forest structure metrics, biodiversity, and elevation. Results: Forest structure varied widely across plots spanning the elevational range of GRSM. Our new measures of canopy density (Depth) and structural complexity (σDepth) were sensitive to structural variations and effectively summarized horizontal and vertical dimensions of structural complexity. Vascular plant biodiversity was negatively correlated with elevation, and more strongly positively correlated with vegetation structure variables. Conclusions: The strong correlations we observed between canopy structural complexity and biodiversity suggest that structural complexity metrics could be used to assay plant biodiversity over large areas in concert with airborne and spaceborne platforms.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Collision avoidance is an important feature in advanced driver-assistance systems, aiming at providing correct, timely and reliable warnings before an imminent collision (objects, vehicles, pedestrians, etc.). A co-simulation framework is proposed in this paper to address the design and evaluation of collision avoidances in a cyber-physical system. The co-simulation framework is supported on the interaction between SCANeR and Matlab/Simulink. From the best of authors’ knowledge, two main contributions are reported in this paper. Firstly, the modelling and simulation of virtual on-chip LIDAR sensors in a cyber-physical system (CPS) considering traffic scenarios is presented. The CPS is designed and implemented in SCANeR. Secondly, an obstacle recognition library with three specific Artificial Intelligence-based methods is also designed based on sensory information database provided by SCANeR. Three methods for collision avoidance detection are considered, i.e.; a multi-layer perceptron neural network, a self-organization map and a support vector machine. Finally, a comparison among these methods for detecting obstacles before different weather conditions is done with very promising results in terms of accuracy. The best results are achieved using the multi-layer perceptron in sunny and fog conditions, the support vector machine in rainy and self-organized map in snowy conditions.

Active contour models present a robust segmentation approach which make efficient use of specific information about objects in the input data rather than processing all the data. They have been widely used in many applications including image segmentation, object boundary localisation, motion tracking, shape modelling, stereo matching and object reconstruction. In this paper, we investigate the potential of active contour models in extracting roads from Mobile Laser Scanning (MLS) data. The categorisation of active contours based on their mathematical representation and implementation are discussed in detail. We discuss an integrated version in which active contour models are combined to overcome their limitations. We review various active contour based methodologies which have been developed to extract roads and other features from LiDAR and digital imaging datasets. We present a small case study in which an integrated version of active contour models is applied to automatically extract road edges from MLS dataset. An accurate extraction of left and right edges from the tested road section validates the use of active contour models. The present study provides a valuable insight on the potential of active contours for extracting roads and other infrastructures from 3D LiDAR point cloud data.

This article proposes the use of a multi-scale and multi-sensor approach to collect and modelling 3D data concerning wide and complex areas in order to obtain a variety of metric information in the same 3D archive, based on a single coordinate system. The employment of these 3D georeferenced products is multifaceted and the fusion or integration among different sensors data, scales and resolutions is promising and could be useful for the generation of a model that could be defined as hybrid. The correct geometry, accuracy, radiometry and weight of the data models are hereby evaluated comparing integrated processes and results from Terrestrial Laser Scanner (TLS), Mobile Mapping System (MMS), Unmanned Aerial Vehicle (UAV), terrestrial photogrammetry, using Total Station (TS) and Global Navigation Satellite System (GNSS) as topographic survey. The entire analysis underlines the potentiality of the integration and fusion of different solutions and is a crucial part of the “Torino 1911” project whose main purpose is mapping and virtually reconstructing the 1911 Great Exhibition settled in the Valentino Park in Turin (Italy).

A new approach to the measurement with elastic lidar of depolarization produced by atmospheric aerosols is presented. The system uses two different telescopes: one for depolarization measurements and another for total-power measurements. The system architecture and principle of operation are described. The first experimental results are also presented, corresponding to a collection of atmospheric conditions over the city of Barcelona.

Mapping vegetation species is critical to facilitate related quantitative assessment, and for invasive plants mapping their distribution is important to enhance monitoring and controlling activities. Integrating high resolution multispectral remote sensing (RS) image and lidar (light detection and ranging) point clouds can provide robust features for vegetation mapping. However, using multiple source of high-resolution RS data for vegetation mapping at large spatial scale can be both computationally and sampling intensive. Here we designed a two-step classification workflow to decrease computational cost and sampling effort, and to increase classification accuracy by integrating multispectral and lidar data to derive spectral, textural, and structural features for mapping target vegetation species. We used this workflow to classify kudzu, an aggressive invasive vine, in the entire Knox County (1,362 km2) of Tennessee, the United States. Object-based image analysis was conducted in the workflow. The first-step classification used 320 kudzu samples and extensive coarsely labeled samples (based on national land cover) to generate an overprediction map of kudzu using random forest (RF). For the second step, 350 samples were randomly extracted from the overpredicted kudzu and labeled manually for the final prediction using RF and support vector machine (SVM). Computationally intensive features were only used for the second-step classification. SVM had constantly better accuracy than RF, and the Producer’s Accuracy, User’s Accuracy, and Kappa for the SVM model on kudzu was 0.94, 0.96, and 0.90, respectively. SVM predicted 1010 kudzu patches covering 1.29 km2 in Knox County. We found the sample size of kudzu used for algorithm training impacted the accuracy and number of kudzu predicted. The proposed workflow could also improve sampling efficiency and specificity. Our workflow had much higher accuracy than the traditional method conducted in this research, and could be easily implemented to map kudzu in other regions or other vegetation species.

A methodology for both accurate and smooth contour line generation from Light Detection and Ranging (LiDAR) point clouds is proposed in this paper. In order to improve the accuracy of contour lines in the area of forests, constrained triangulation networks with break lines are then constructed to generate contour lines. In break line extraction, a bi-threshold method for edge line detection is used to extract both complete and reliable break lines. A point clouds elevation adjustment with constrain of break lines and an interpolator considering a contour interval is proposed to improve the smoothness of contour lines. The proposed interpotator is also can avoid contour line intersection when contour lines are interpolated. Statistical parameters and shape index are then used to evaluate quantitatively the accuracy and smoothness of the resultant contour lines, which fill in the blank of contour lines evaluation in theory. The experiments show that high-quality contours in terms of smoothness and accuracy can be generated from LiDAR point clouds.

The study of vegetation community and structural change has been central to ecology for over a century, yet how disturbances reshape the physical structure of forest canopies remains relatively unknown. Moderate severity disturbance including fire, ice storms, insect and pathogen outbreaks, affects different canopy strata and plant species, which may give rise to variable structural outcomes and ecological consequences. Terrestrial lidar (light detection and ranging) offers an unprecedented view of the interior arrangement and distribution of canopy elements, permitting the derivation of multidimensional measures of canopy structure that describe several canopy structural traits with known linkages to ecosystem functioning. We used lidar-derived canopy structural measured within a machine learning framework to detect and differentiate among various disturbance agents, including moderate severity fire, ice storm damage, age-related senescence, hemlock woolly adelgid, beech bark disease, and chronic acidification. We found that disturbance agents such as fire and ice storms primarily affected the amount and position of vegetation within canopies, while acidification, pathogen and insect infestation, and senescence altered canopy arrangement and complexity. Only two of the six disturbance agents significantly reduced leaf area, indicating that this commonly quantified canopy feature is insufficient to characterize many moderate severity disturbances. Rather, measures of canopy structure, including those that describe multidimensional change, are needed to characterize disturbance at moderate severities because structural changes from these events are spatially and quantitatively variable. Our findings suggest that standard disturbance detection methods, such as optical based remote sensing platforms, may currently be limited in their ability to detect, differentiate, and characterize disturbance. Further, we conclude that a more broadly inclusive definition of ecological disturbance that incorporates multiple aspects of canopy structure change will improve the modeling, detection, and prediction of functional implications of moderate severity disturbance.

While lidar-based forest inventory methods have been widely demonstrated, prediction of tree diameters with lidar is not well understood. The performance metrics typically used in studies for prediction of diameters can be difficult to interpret and may not support comparative inferences between sampling designs or study areas. We evaluate a variety of lidar and k nearest neighbor (k-NN) strategies for prediction of tree diameter distributions using two indices which are easier to interpret and compare. The indices are based on the coefficient of determination (R²), and root mean square deviation (RMSD). These indices facilitate comparisons with alternative (non-lidar) inventory strategies, and with other project areas. We evaluate k nearest neighbors (k-NN) dbh density (relative frequency by dbh class) prediction strategies with lidar for 190 training plots distribute across the 800 km² Savannah River Site in South Carolina, USA. We evaluate the performance of k-NN with respect to distance metrics, number of neighbors, predictor sets, and response sets. Amongst the examined strategies we found Mahalanobis distance with k = 3 neighbors performed best according to a number of criteria.

The market for autonomous vehicles (AV) is expected to experience significant growth over the coming decades and to revolutionize the future of transportation and mobility. The AV is a vehicle that is capable of perceiving its environment and perform driving tasks safely and efficiently with little or no human intervention and is anticipated to eventually replace conventional vehicles. Self-driving vehicles employ various sensors to sense and perceive their surroundings and, also rely on advances in 5G communication technology to achieve this objective. Sensors are fundamental to the perception of surroundings and the development of sensor technologies associated with AVs has advanced at a significant pace in recent years. Despite remarkable advancements, sensors can still fail to operate as required, due to for example, hardware defects, noise and environment conditions. Hence, it is not desirable to rely on a single sensor for any autonomous driving task. The practical approaches shown in recent research is to incorporate multiple, complementary sensors to overcome the shortcomings of individual sensors operating independently. This article reviews the technical performance and capabilities of sensors applicable to autonomous vehicles, mainly focusing on vision cameras, LiDAR and Radar sensors. The review also considers the compatibility of sensors with various software systems enabling the multi-sensor fusion approach for obstacle detection. This review article concludes by highlighting some of the challenges and possible future research directions.

This article is some review of results that were obtained at 2007-2021 years development of “The Information as Absolute” concept and the informational physical model, which is based on the concept; including a number of fundamental physical problems are briefly considered in framework of the conception and the model. Recently in physics there are several publications, that present lists of the problems. However, those lists are essentially incomplete, for at least two reasons. Firsts of all, a number of phenomena are studied traditionally by philosophy, and so corresponding problems are usually considered to be “metaphysical”. However, they relate also to some concrete physical phenomena. For example, physics evidently studies Matter, and so the metaphysical problems “what is ontology of Matter”, “what is “Space”, “Time” and a few other physical phenomena and notions as well, are really a Meta-physical problems “what does physics study?” There are other fundamental physical problems, which are not considered as such in physics, and are absent in the “fundamental problems lists”. Those include the problems, which really exist, yet are incorporated into standard physical theories, and so are fundamental “implicitly”, which in physics are “solved by default” ‒ and mostly erroneously. Note, though, that a number of “Meta-physical”, and concrete fundamental, problems more in detail are considered in the paper “The Informational Conception and Basic Physics”, https://arxiv.org/abs/0707.4657, v5 (2021), so this paper is, in certain sense, an expanded conclusion of this paper, which includes, correspondingly, more in detail consideration of some more general physical problems; and, besides, in this article, the problem “what are Gravity and Electric Forces” is essentially clarified comparing with the arXiv 2021 paper version above. Besides, the concrete problem “What is Life”, and the rational cosmological model, where a few vague points in standard cosmology rather probably are rationally clarified, while the fundamental problem “matter – antimatter asymmetry” in Matter is solved practically for sure, are considered, and one of recently published rather complete “lists of fundamental problems” is commented in Appendix.

This paper first explains the theory of the origin of force from a new perspective, explaining that the origin of all forces is caused by the "missing of energy in the time dimension" (non-conservation in a certain period of time), and constructs a unified theory of force on this basis. Then, through the unified theory of force, the following phenomena are reinterpreted: (1) The common origin of the inverse square law of gravitation and electromagnetic force; (2) The origin of the repulsive force of electrons and protons at small distances; (3) The mystery of the rotation curve of galaxies and the new explanation of "dark matter"; (4) explain the origin of the magnetic field; (5) Predict that moving magnets have the same radiation effect as charged particles (electron magnetic moments also have radiation effects); (6) Reinterpret Maxwell's displacement current; (7) Reinterpret synchrotron radiation and bremsstrahlung; (8) Explain that the strong and weak forces are short-range forces; (9) Predict the true structure of black holes and the origin of gravitational waves;(10) Possible explanation for the origin of the speed of light.

It is extremely fascinating and astonishing that the gravitational field on the surface of a neutron star is with a relativistic mass density of 2.65*10¹⁶~5.87*10¹⁸kgm^-3 which can be larger than the mass density of the neutron star (~10¹⁷kgm^-3).Therefore, it is the author’s first intuitional imagining that this field could directly convert into mass. In so strong a gravitational field, electron and proton could be produced directly from graviton–photon collision. The gravitational field exists in everywhere in our universe. No vacuum that the region of a space is “empty” does exist. A particle is clearly always being acted on by the gravitational field. The quantum vacuum fluctuation and vacuum polarization need be re-understood with the interaction between photon and gravitational field. Therefore, the gravitational field is naturally one of the foundations of modern physics.

Terrestrial LiDAR becomes more and more popular to estimate leaf and plant area density. Voxel-based approaches account for this vegetation heterogeneity and significant work has been done in this recent research field, but no general theoretical analysis is available. Although estimators have been proposed and several causes of biases have been identified, their consistency and efficiency have not been evaluated. Also, confidence intervals are almost never provided. In the present paper, we solve the transmittance equation and use the Maximum Likelihood Estimation (MLE), to derive unbiased estimators and confidence intervals for the attenuation coefficient, which is proportional to leaf area density. The new estimators and confidence intervals are defined at voxel scale, and account for the number of beams crossing the voxel, the inequality of path lengths in voxel, the size of vegetation elements, as well as for the variability of element positions between vegetation samples. They are completed by numerous numerical simulations for the evaluation of estimator consistency and efficiency, as well as the assessment of the coverage probabilities of confidence intervals. • Although commonly used when the beam number is low, the usual estimators are strongly biased and the 95% confidence intervals can be ≈±100% of the estimate. • Our unbiased estimators are consistent in a wider range of validity than the usual ones, especially for the unbiased MLE, which is consistent when the beam number is as low as 5. The unbiased MLE is efficient, meaning it reaches the lowest residual errors that can be expected (for an unbiased estimator). Also the unbiased MLE does not require any bias correction when path lengths are unequal. • When elements are small (or voxel is large), 103 beams entering the voxel leads to some confidence intervals ≈±10%, but when elements are larger (or voxel smaller), it can remain wider than ±50%, even for a large beam number. This is explained by the variability of element positions between vegetation samples. Such a result shows that a significant part of residual error can be explained by random effects. • Confidence intervals are much smaller (±5 to 10%) when LAD estimates are averaged over several small voxels, typically within a horizontal layer or in the crown of individual plants. In this context, our unbiased estimators show a reduction of 50% of the radius of confidence intervals, in comparison to usual estimators. Our study provides some new ready-to-use estimators and confidence intervals for attenuation coefficients, which are consistent and efficient within a fairly large range of parameter values. The consistency is achieved for a low beam number, which is promising for application to airborne LiDAR data. They entail to raise the level of understanding and confidence on LAD estimation. Among other applications, their usage should help determine the most suitable voxel size, for given vegetation types and scanning density, whereas existing guidelines are highly variable among studies, probably because of differences in vegetation, scanning design and estimators.

Impervious surface mapping with high-resolution remote sensing imagery has attracted increasing interest as it can provide detailed information for urban structure and distribution. Previous studies have suggested that the combination of LiDAR data and high-resolution imagery for impervious surface mapping performs better than using only high-resolution imagery. However, due to the high cost of the acquisition of LiDAR data, it is difficult to obtain the multi-sensor remote sensing data acquired at the same acquisition time for impervious surface mapping. Consequently, real landscape changes between multi-sensor remote sensing data at different acquisition times would lead to the error of misclassification in impervious surface mapping. This issue has mostly been neglected in previous works. Furthermore, the observation differences generated from multi-sensor data, including the problems of misregistration, missing data in LiDAR data, and shadow in high-resolution images would also challenge the final mapping result in the fusion of LiDAR data and high-resolution images. In order to conquer these problems, we propose an improved impervious surface mapping method incorporating both LiDAR data and high-resolution imagery at different acquisition times in consideration of real landscape changes and observation differences. In the proposed method, a multi-sensor change detection by supervised multivariate alteration detection is employed to obtain changed areas and misregistration areas. The no-data areas in the LiDAR data and the shadow areas in the high-resolution imagery are extracted by independent classification yielded by its corresponding single sensor data. Finally, an object-based post-classification fusion is proposed to take advantage of independent classification results with single-sensor data and the joint classification result with stacked multi-sensor data. Experiments covering the study site in Buffalo, NY, USA demonstrate that our method can accurately detect landscape changes and obviously improve the performance of impervious surface mapping.

At nuclear scale, we present three heuristic relations pertaining to strong and electroweak coupling constants. With these relations, close to beta stability line, it is possible to study nuclear binding energy with a single energy coefficient of magnitude $\left(\frac{1}{{\alpha }_s}\right)\left[\frac{e^2}{4\pi {\epsilon }_0{R}_0}\right]\approx 10.0\text{MeV}\text{.}$ With reference to up and down quark masses, it is also possible to interpret that, nuclear binding energy is proportional to the mean mass of $\left[\left(2m_u+m_d\right)\text{and}\left(m_u+2m_d\right)\right]\approx 10.0\text{MeV}.$

Historical forest management practices in the southwestern US have left forests prone to high intensity, stand-replacement fires. Effective management to reduce the cost and impact of forest-fire management and allow fires to burn freely without negative impact depends on detailed knowledge of stand composition, in particular, above-ground biomass (AGB). Lidar-based modeling techniques provide opportunities to reduce costs and increase ability of managers to monitor AGB and other forest metrics. Using Bayesian Model Averaging (BMA), we develop a regionally applicable lidar-based statistical model for Ponderosa pine and mixed conifer forest systems of the southwestern USA, using previously collected field data. The selected regional model includes a mid and low canopy height metric, a canopy cover, and height distribution term. It explains 72% of the variability in field estimates of AGB, and the RMSE of the two independent validation data sets are 23.25 and 32.82 Mg/ha. The regional model developed is structured in accordance with previously described models fit to local data, and performs equivalently to models designed for smaller scale application. Developing regional models for broad scale application provides a cost-effective, robust approach for managers to monitor and plan adaptively at the landscape scale.

Forest canopy structure (CS) controls many ecosystem functions and is highly variable across landscapes, but the magnitude and scale of this variation is not well understood. We used a portable canopy lidar system to characterize variation in five categories of CS along N = 3 transects (140–800 m long) at each of six forested landscapes within the eastern USA. The cumulative coefficient of variation was calculated for subsegments of each transect to determine the point of stability for individual CS metrics. We then quantified the scale at which CS is autocorrelated using Moran’s I in an Incremental Autocorrelation analysis. All CS metrics reached stable values within 300 m but varied substantially within and among forested landscapes. A stable point of 300 m for CS metrics corresponds with the spatial extent that many ecosystem functions are measured and modeled. Additionally, CS metrics were spatially autocorrelated at 40 to 88 m, suggesting that patch scale disturbance or environmental factors drive these patterns. Our study shows CS is heterogeneous across temperate forest landscapes at the scale of 10’s of meters, requiring a resolution of this size for upscaling CS with remote sensing to large spatial scales.

Degradation of environment quality is currently the prime cause of the recent occurrence of natural disasters; it also contributes in the increase of the area that is prone to natural disasters. This research is aimed to map the potential of areas around Pesanggrahan river in DKI Jakarta by segmenting the Digital Elevation Model derived from LIDAR data. The objective of this segmentation is to find the watershed lines of the DEM image. Data processing in this research is using LIDAR data which take the ground surface data, which is overlaid with Jakarta river map and subsequently, the data is then segmented the image. The expected result of the research is the flood potential area information, especially along the Pesanggrahan river in South Jakarta.

In this paper we illustrate a new, simple and complementary ground-based methodology to retrieve the vertically resolved atmospheric precipitation intensity through a synergy between measurements from the National Aeronautics and Space Administration (NASA) Micropulse Lidar network (MPLNET), an analytical model solution and ground-based disdrometer measurements. The presented results are obtained at two mid-latitude MPLNET permanent observational sites, located respectively at NASA Goddard Space Flight Center, USA, and at the Universitat Politècnica de Catalunya, Barcelona, Spain. The methodology is suitable to be applied to existing and/or future lidar/ceilometer networks with the main objective of either providing near-real time (3h latency) rainfall intensity measurements and/or to validate satellite missions, especially for critical light precipitation (<3 mm hr⁻¹).

The catalytic parameters describing enzyme catalysis are discussed in the context of the design of de novo enzymes. It is shown that high values of the catalytic efficiency may in some cases reflect tight substrate binding and lead to an immediate levelling-off of rates to reach a low plateau, an undesirable scenario for many industrial applications. It is argued that increasing the catalytic rate constant should be a main target in de novo enzyme engineering.

The aim of this study was to investigate the role of DNA methylation in the regulation of in vitro and in vivo cartilage formation. Based on the data of an RNA chip-assay performed on chondrifying BMP2-overexpressing C3H10T1/2 cells, the relative expression of Tet1 (tet methylcytosine dioxygenase 1), Dnmt3a (DNA methyltransferase 3) and Ogt (O-linked N-acetylglucosamine transferase) genes was examined with RT-qPCR in mouse cell-line based and primary micromass cultures. RNA probes for in situ hybridization were used on frozen sections of 15-day-old mouse embryos. DNA methylation was inhibited with 5-azacytidine during culturing. We found very strong but gradually decreasing expression of Tet1 throughout the entire course of in vitro cartilage differentiation along with strong signals in the cartilaginous embryonic skeleton. Dnmt3a and Ogt expressions did not show significant changes with RT-qPCR and gave weak in situ hybridization signals. Inhibition of DNA methylation applied during early stages of differentiation reduced cartilage-specific gene expression and cartilage formation. In contrast, it had stimulatory effect when added to differentiated chondrocytes. Our results indicate that the DNA demethylation-inducing Tet1 is a significant epigenetic factor of chondrogenesis, and inhibition of DNA methylation exerts distinct effects in different phases of in vitro cartilage formation.

Depth maps produced by LiDAR based approaches are sparse. Even high-end LiDAR sensors produce highly sparse depth maps, which are also noisy around the object boundaries. Depth completion is the task of generating a dense depth map from a sparse depth map. While the traditional approaches focus on directly completing this sparsity from the sparse depth maps, modern techniques use RGB images as a guidance tool to resolve this problem. Whilst many others rely on affinity matrices for depth completion. Based on these approaches, we have sub-divided the literature into two major categories; traditional approaches and backbone-based approaches. The latter is further sub-divided into two-branch, and spatial propagation approaches. The two-branch approaches still have a sub-category named guided-kernel approaches. In this paper, for the first time ever we present a comprehensive survey of depth completion methods. We present a novel taxonomy of depth completion approaches, review and detail different state-of-the art techniques within each category for depth completion of LiDAR data, and provide quantitative results for the approaches on KITTI and NYUv2 depth completion benchmark datasets.

Here we evaluate the chemistry of mineral soil solutions collected by suction lysimeters in a small mountain catchment that was affected by acidification-related spruce die-back. The aim was to obtain new insights into spatial patterns of nutrient partitioning during acidification recovery. This was achieved by comparing nutrient concentrations in soil solutions, collected along a V-shaped valley, with those in runoff. Five nests of suction lysimeters were installed in the 33-ha UDL catchment at different topographic positions (hilltops, slopes and valley). Following a 1-year equilibration, monthly samples of soil solutions were collected over a 2-year period. In the vicinity of each lysimeter nest, soil pits were excavated for a study of soil chemistry. Soil solutions were analyzed for SO42-, NO3-, DOC, NH4+, Na+, K+, Ca2+, Mg2+, and total dissolved Al concentrations, DOC and pH. For a P release estimation, ammonium oxalate extraction of soil samples was performed. Comparison of soil water data from this study with other European studies indicated that major environmentally relevant chemical species at UDL had concentrations similar to median concentrations across numerous previously acidified sites. CEC (≤ 58 meq kg-1) and BS (≤ 13 %), however, were significantly lower at UDL than at other European sites, documenting incomplete recovery from acidification. Spatial trends and seasonality in soil water chemistry support belowground inputs from mineral-stabilized legacy pollutants and soil nutrients. Seasonal variability of soil water sulfate and nitrate was significant. High nitrate in soil solutions during summer originated during the preceding dormant season, and high sulfate concentrations observed during the winter originating from recycled organic S during the summer. Higher concentrations of SO42-, NO3-, and base cations in runoff than in soil solutions may be explained by lateral surficial runoff leaching pollutants and nutrients from very shallow soil horizons. Nearly 30 years after peak acidification, solutions in mineral subsoil at UDL exhibited similar concentrations of SO42-, Ca2+ and Mg2+ as median values at the Pan-European International Co-operative Program (ICP) Forest sites, yet NO3- concentrations were an order of magnitude higher than the ICP sites. Calcium applied on soil surface by liming 32 to 11 years ago affected runoff more than soil solutions, suggesting contribution of both shallow soil water and groundwater to runoff.

In this paper, some characterizations of fuzzifying strong compactness are given, including characterizations in terms of nets and pre -subbases. Several characterizations of locally strong compactness in the framework of fuzzifying topology are introduced and the mapping theorems are obtained.

Nowadays, the research and development of on-chip LiDAR sensors for vehicle collision avoidance is growing very fast. Therefore, the assessment of the reliability in obstacle detection using the information provided by LiDAR sensors has become a key issue to be explored by the scientific community. This paper presents the design and implementation of a self-tuning method in order to maximize the reliability of an Internet-of-Things sensors network and to minimize the number of sensors to localize with the required accuracy obstacles by a detection threshold. In order to achieve this goal, models that predict accuracy (i.e., prediction error) for object localization using data collected by LIDAR sensors are designed and implemented in Webots Automobile 3D simulation tool. The approach is based on combining different techniques. Firstly, point-cloud clustering technique and an error prediction model library composed by a multilayer perceptron neural network with backpropagation, k-nearest neighbors and linear regression are explored. Secondly the above-mentioned techniques for modeling are also combined with a supervised and reinforcement machine learning technique, Q-learning in order to minimize the detection threshold. In addition, a IoT driving assistance simulated scenario with a LiDAR sensor network is designed in order to validate the prediction model and the optimal configuration of the sensor network to guarantee reliability in obstacle localization. The results demonstrate that the self-tuning method is appropriate to increase the reliability of the sensor network whereas minimizing the detection threshold

The Greenland Ice Sheet is now the largest land ice contributor to global sea level rise, largely driven by increased surface meltwater runoff from the ablation zone, i.e. areas of the ice sheet where annual mass losses exceed gains. This small but critically important area of the ice sheet has expanded in size by ~50% since the early 1960s, and satellite remote sensing is a powerful tool for monitoring the physical processes that influence its surface mass balance. This review synthesizes key remote sensing methods and scientific findings from satellite remote sensing of the Greenland Ice Sheet ablation zone, covering progress in 1) radar altimetry, 2) laser (lidar) altimetry, 3) gravimetry, 4) multispectral optical imagery and, 5) microwave and thermal imagery. Physical characteristics and quantities examined include surface elevation change, gravimetric mass balance, reflectance, albedo, and mapping of surface melt extent and glaciological facies and zones. The review concludes that future progress will benefit most from methods that combine multi-sensor, multi-wavelength, and cross-platform datasets designed to discriminate the widely varying surface processes in the ablation zone. Specific examples include fusing laser altimetry, radar altimetry, and optical stereophotogrammetry to enhance spatial measurement density, cross-validate surface elevation change, and diagnose radar elevation bias; fusing optical imagery, radar imagery, and microwave scatterometry to discriminate between snow, liquid water, refrozen meltwater, and bare ice near the equilibrium line altitude; combining optical reflectance with laser altimetry to map supraglacial lake, stream, and crevasse bathymetry; and monitoring the inland migration of snowlines, surface melt extent, and supraglacial hydrologic features.

Topographic mapping using stereo plotting is not effective because it takes much time and labor-intensive. Thus, this research was conducted to find the effective way to extract building footprint for mapping acceleration. Building extraction method in this process comprises four steps: ground / non-ground filtering, building classification, segmentation, and building extraction. Non-ground points from filtering process were classified as building with the algorithm based on multi-scale local dimensionality to separate points at the maximum separability plane. Segmentation using segment growing was used to separate each building, so edge detection could be conducted for each segment to create boundary of each building. Lastly, building extraction was conducted through three steps: edge points detection, building delineation, and building regularization. With 10 samples and step 0.5, classification resulted quality and miss factor of 0.597 and 0.524, respectively. The quality was improved by segmentation process to 0.604, while miss factor was getting worse to 0.561. Meanwhile, on average shape index value from extracted building had 0.02 difference and the number of errors was 30% for line segment comparison. Regarding positional accuracy using centroid accuracy assessment, this method could produce RMSE of 1.169 meters.

In terrain analysis and hydrological modeling, surface depressions (or sinks) in a digital elevation model (DEM) are commonly treated as artifacts and thus filled and removed to create a depressionless DEM. Various algorithms have been developed to identify and fill depressions in DEMs during the past decades. However, few studies have attempted to delineate and quantify the nested hierarchy of actual depressions, which can provide crucial information for characterizing surface hydrologic connectivity and simulating the fill-merge-spill hydrological process. In this paper, we present an innovative and efficient algorithm for delineating and quantifying nested depressions in DEMs using the level-set method based on graph theory. The proposed level-set method emulates water level decreasing from the spill point along the depression boundary to the lowest point at the bottom of a depression. By tracing the dynamic topological changes (i.e., depression splitting/merging) within a compound depression, the level-set method can construct topological graphs and derive geometric properties of the nested depressions. The experimental results of two fine-resolution LiDAR-derived DEMs show that the raster-based level-set algorithm is much more efficient (~150 times faster) than the vector-based contour tree method. The proposed level-set algorithm has great potential for being applied to large-scale ecohydrological analysis and watershed modeling.

Giant plasmonic surface enhancement has been observed in gold coated micron sized inverse pyramids entrapping a gold nanoparticle. The amplification of both surface enhanced Raman and photoluminescence signals was found to be dependent on the diameter of trapped gold nanoparticle and around 50-fold enhancement was detected for 250nm diameter sample relatively to the 50nm one. Finite differential time domain simulations, performed to determine the near-field distribution in the structure, showed that when the nanoparticle protrudes into the hotspot zone of the void, coupling of electromagnetic field occurs and the plasmon-related near-field enhancement is concentrated into the close vicinity of the nanoparticle, mainly into the close gaps around the tangential points of the curved sphere and the flat pyramid surface. This results in a more than 15 times increase of the near-field intensity, compared to the empty void.

As the rapid development of communication industry, especially the 5G communication and IOT, there will be plenty of electromagnetic (EM) waves in the free space, which carry lots of energies. However, some of these energies are wasted in free space. To reuse these wasted energies, significantly growing interests are towards to the energy harvesting antennas. This paper is aimed to investigate a wearable antenna which can transfer RF energy from ambient sources to direct current by a soft and portable textile antenna. Among the numerous signals in mobile network, the GSM 1800, 3G, WiFi and 4G/5G will be chosen due to the city signal intensity distribution. Hence, a corresponding triple bands antenna has been designed to cover those frequency bands. The CST STUDIO SUITE is used in whole process of antenna design and simulation. The proposed antenna is a hooked dipole antenna with tuning bar (HATB) whose ends have small folded part in each side for better bandwidth performance. The presented antenna provides a wide operating band from 1.8 GHz to 2.5 GHz below -10 dB in return loss. And methods to overcome interference between antennas is found. Furthermore, using the corresponding rectifier to achieve the RF/DC conversion. The overall efficiency of whole rectifier is about 56.8 %, and output power level of the antenna system is 45.92nW. The experimental results could indicate that my textile hooked antenna harvester is a good choice for the charging system of personal wearable attachment, which could achieve low power absorbing for long distance anytime and anywhere.

The application of 3D LiDAR technology has become increasingly extensive in tunnel monitoring due to the large density and high accuracy of the acquired spatial data. The proposed processing method aims at circle tunnels and provides a clear workflow to automatically process raw point data and easily interpretable results to analyze tunnel health state. The proposed automatic processing method employs a series of algorithms to extract point cloud of a single tunnel segment without obvious noise from entire raw tunnel point cloud mainly by three steps: axis acquisition, segments extraction and denoising. Tunnel axis is extracted by fitting boundaries of the tunnel point cloud rejection in plane with RANSAC algorithm. With guidance of axis, the entire preprocessed tunnel point cloud is segmented by equal division to get a section of tunnel point cloud which corresponds to a single tunnel segment. Then the noise in every single point cloud segment is removed by clustering algorithm twice, based on distance and intensity. Finally, clean point clouds of tunnel segments are processed by effective deformation extraction processor to get ovality and three-dimensional deformation nephogram.

Expectation maximization (EM) algorithm is a powerful mathematical tool for estimating statistical parameter when data sample contains hidden part and observed part. EM is applied to learn finite mixture model in which the whole distribution of observed variable is average sum of partial distributions. Coverage ratio of every partial distribution is specified by the probability of hidden variable. An application of mixture model is soft clustering in which cluster is modeled by hidden variable whereas each data point can be assigned to more than one cluster and degree of such assignment is represented by the probability of hidden variable. However, such probability in traditional mixture model is simplified as a parameter, which can cause loss of valuable information. Therefore, in this research I propose a so-called conditional mixture model (CMM) in which the probability of hidden variable is modeled as a full probabilistic density function (PDF) that owns individual parameter. CMM aims to extend mixture model. I also propose an application of CMM which is called adaptive regressive model (ARM). Traditional regression model is effective when data sample is scattered equally. If data points are grouped into clusters, regression model tries to learn a unified regression function which goes through all data points. Obviously, such unified function is not effective to evaluate response variable based on grouped data points. The concept “adaptive” of ARM means that ARM solves the ineffectiveness problem by selecting the best cluster of data points firstly and then evaluating response variable within such best cluster. In order words, ARM reduces estimation space of regression model so as to gain high accuracy in calculation.

There exists an implicit potential limitation in every physical discoveries that has been implemented and understood. However, the limitations can be bounded within a safe limit to prevent any constructing theory to be free from errors. As, it’s the inert nature of the humans, to go far beyond the scope of experimental findings in order to pursue any studies with the sole help of logical reasoning and mathematics, the argument can be prevailed in the form of WEAK Clampdown Effect & STRONG Clampdown Effect. More, the theories are constructed out of physical nature, more the theory gets hypothetical without any finding evidence, but that does or doesn’t actually justify the phenomenon, that too with the more increment of KARDASHEV Scale, more moderate ways of experimentation got developed curbing down the limitations within the human limit of ‘ERRORS’, that does can be neglected by approximation. Relationship being cross-judgmental on the basis of the computational limits and calculation accuracy, leading to a soft singularity, as a warning, that if computer powers cannot be checked on the basis of error approximations, then this may lead to the hitting of a hard singularity, that in phase with the forbidden gap (or after the optimum limit that arises at the core constraints of nature) to prevent the computation being carried off with respect to super-intelligence machines that are cognitive capability oriented future computers responsible for self growth & reproduction with more improvement algorithm, restricting all forms of humanity & constraints the human growth by virtue of limiting capacities of the humans as compared to computers.

In this paper, we introduce a new iteration scheme, named as the S**-iteration scheme, for approximation of fixed point of the nonexpansive mappings. This scheme is faster than Picard, Mann, Ishikawa, Noor, Agarwal, Abbas, Thakur, and Ullah iteration schemes. We show the stability of our instigated scheme and give a numerical example to vindicate our claim. We also put forward some weak and strong convergence theorems for Suzuki's generalized nonexpansive mappings in the setting of uniformly convex Banach spaces. Our results comprehend, improve, and consolidate many results in the existing literature.

In this paper, we study a three step iterative scheme to approximate fixed points of Suzuki's generalized non-expansive mappings. We establish some weak and strong convergence results for such mappings in uniformly convex Banach spaces. Further, we show numerically that iterative scheme (1.8) converges faster than some other known iterations for Suzuki's generalized non-expansive mappings. To support our claim, we give an illustrative example and approximate fixed points of such mappings using Matlab program. Our results are new and generalize several relevant results in the literature.

In this paper, a kind of single-walled carbon nanotube nonlinear model is developed, and the strongly nonlinear dynamic characteristics of such carbon nanotubes subjected to random magnetic field are studied. The nonlocal effect of microstructure is considered based on the theory of nonlocal elasticity. The natural frequency of the strongly nonlinear dynamic system is obtained by the energy function method, the drift coefficient and the diffusion coefficient are verified. The stationary probability density function of the system dynamic response is given and the fractal boundary of the safe basin is provided. Theoretical analysis and numerical simulation show that stochastic resonance occurs when varying the random magnetic field intensity. The boundary of safe basin has fractal characteristics and the area of safe basin decreases when the intensity of the magnetic field permeability increases.

Indigenous forests cover 24% of New Zealand and provide valuable ecosystem services. However, a national map of forest types, that is, physiognomic types, which would benefit conservation management, does not currently exist at an appropriate level of detail. While traditional forest classification approaches from remote sensing data are based on spectral information alone, the joint use of space-based optical imagery and structural information from synthetic aperture radar (SAR) and canopy metrics from air-borne Light Detection and Ranging (LiDAR) facilitates more detailed and accurate classifications of forest structure. We present a support vector machine (SVM) classification using data from ESA’s Sentinel-1 and 2 missions, ALOS PALSAR, and airborne LiDAR to produce a regional map of physiognomic types of indigenous forest in New Zealand. A five-fold cross-validation of ground data showed that the highest classification accuracy of 80.9% is achieved for bands 2, 3, 4, 5, 8, 11, and 12 from Sentinel-2, the ratio of bands VH and VV from Sentinel-1, HH from PALSAR, and mean canopy height and 97th percentile canopy height from LiDAR. The classification based on the optical bands alone was 73.1% accurate and the addition of structural metrics from SAR and LiDAR increased accuracy by 7.8%. The classification accuracy is sufficient for many management applications for indigenous forest in New Zealand, including biodiversity management, carbon inventory, pest control, ungulate management, and disease management. National application of the method will be possible in several years, once national LiDAR coverage is achieved, and a national canopy height model is available.

The aim of this expository article is to present recent developments in the centuries-old discussion on the interrelations between several types of domination in graphs. However, the novelty even more prominent in the newly discovered simplified presentations of several older results. Domination can be seen as arising from real-world application and extracting classical results as first described by this article.The main part of this article, concerning a new domination and older one, is presented in a narrative that answers two classical questions: (i) To what extend must closing set be dominating? (ii) How strong is the assumption of domination of a closing set? In a addition, we give an overview of the results concerning domination. The problem asks how small can a subset of vertices be and contain no edges or, more generally how can small a subset of vertices be and contain other ones. Our work was as elegant as it was unexpected being a departure from the tried and true methods of this theory that had dominated the field for one fifth a century. This expository article covers all previous definitions. The inability of previous definitions in solving even one case of real-world problems due to the lack of simultaneous attentions to the worthy both of vertices and edges causing us to make the new one. The concept of domination in a variety of graphs models such as crisp, weighted and fuzzy, has been in a spotlight. We turn our attention to sets of vertices in a fuzzy graph that are so close to all vertices, in a variety of ways, and study minimum such sets and their cardinality. A natural way to introduce and motivate our subject is to view it as a real-world problem. In its most elementary form, we consider the problem of reducing waste of time in transport planning. Our goal here is to first describe the previous definitions and the results, and then to provide an overview of the flows ideas in their articles. The final outcome of this article is twofold: (i) Solving the problem of reducing waste of time in transport planning at static state; (ii) Solving and having a gentle discussions on problem of reducing waste of time in transport planning at dynamic state. Finally, we discuss the results concerning holding domination that are independent of fuzzy graphs. We close with a list of currently open problems related to this subject. Most of our exposition assumes only familiarity with basic linear algebra, polynomials, fuzzy graph theory and graph theory.

Data on the atmospheric gas concentrations can be received with high efficiency and on a large spatial scale only from remote laser sounding instruments. The remote laser techniques with the use of lidars are widely used in the study of the atmosphere and control of its state. The aims of this work are the design and test in numerical and field experiments of a DIAL OPO lidar system based on KTA and KTP crystals for gas analysis of the atmosphere. Lidar measurements of atmospheric gases in the near/mid infrared region have been numerically simulated. The differential absorption lidar system based on optical parametric oscillators with nonlinear KTA and KTP crystals which allow laser radiation tuning both in the near and in the middle IR spectral region is described; it allows tuning laser radiation in the near/mid-IR wavelength regions. Lidar echo signals have been experimentally recorded in the 1.8–2.5 and 3–4 m wavelength ranges. The results of H2O and CO2 profile measurements along the surface sounding path are presented.

Maximum likelihood estimation (MLE) is a popular method for parameter estimation in both applied probability and statistics but MLE cannot solve the problem of incomplete data or hidden data because it is impossible to maximize likelihood function from hidden data. Expectation maximum (EM) algorithm is a powerful mathematical tool for solving this problem if there is a relationship between hidden data and observed data. Such hinting relationship is specified by a mapping from hidden data to observed data or by a joint probability between hidden data and observed data. In other words, the relationship helps us know hidden data by surveying observed data. The essential ideology of EM is to maximize the expectation of likelihood function over observed data based on the hinting relationship instead of maximizing directly the likelihood function of hidden data. Pioneers in EM algorithm proved its convergence. As a result, EM algorithm produces parameter estimators as well as MLE does. This tutorial aims to provide explanations of EM algorithm in order to help researchers comprehend it. Moreover some improvements of EM algorithm are also proposed in the tutorial such as combination of EM and third-order convergence Newton-Raphson process, combination of EM and gradient descent method, and combination of EM and particle swarm optimization (PSO) algorithm.

Currently, the most important challenge in any assessment of state-of-the-art sensor technology and its reliability is to achieve road traffic safety targets. The research reported in this paper is focused on the design of a procedure for evaluating the reliability of Internet-of-Things (IoT) sensors and the use of a Cyber-Physical System (CPS) for the implementation of that evaluation procedure to gauge reliability. An important requirement for the generation of real critical situations under safety conditions is the capability of managing a co-simulation environment, in which both real and virtual data sensory information can be processed. An IoT case study that consists of a LiDAR-based collaborative map is then proposed, in which both real and virtual computing nodes with their corresponding sensors exchange information. Specifically, the sensor chosen for this study is a Ibeo Lux 4-layer LiDAR sensor with IoT added capabilities. Implementation is through an artificial-intelligence-based modeling library for sensor data-prediction error, at a local level, and a self-learning-based decision-making model supported on a Q-learning method, at a global level. Its aim is to determine the best model behavior and to trigger the updating procedure, if required. Finally, an experimental evaluation of this framework is also performed using simulated and real data

The interaction of electrons with strong laser fields is usually treated with semiclassical theory, where the laser is represented by an external field. There are analytic solutions for the free electron wave functions, which incorporate the interaction with the laser field exactly, but the joint effect of the atomic binding potential presents an obstacle for the analysis. Moreover, the radiation is a dynamical system, the number of photons changes during the interactions. Thus, it is legitimate to ask how can one treat the high order processes nonperturbatively, in such a way that the electron-atom interaction and the quantized nature of radiation be simultaneously taken into account? An analytic method is proposed to answer this question in the framework of nonrelativistic quantum electrodynamics. As an application, a quantum optical generalization of the strong-field Kramers-Heisenberg formula is derived for describing high-harmonic generation. Our formalism is suitable to analyse, among various quantal effects, the possible role of arbitrary photon statistics of the incoming field. The present paper is dedicated to the memory of Prof. Dr. Fritz Ehlotzky, who had significantly contributed to the theory of strong-field phenomena over many decades.

In the coded pulse scanning light detection and ranging (LIDAR) system, the number of laser pulses used at a given measurement point changes depending on the modulation and the method of spreading used in optical code-division multiple access (OCDMA). The number of laser pulses determines the pulse width, output power, and duration of the pulse transmission of a measurement point. These parameters determine the maximum measurement distance of the laser and the number of measurement points that can be employed per second. In this paper, we evaluate the performance and characteristics of combinations of modulation and spreading technology that can be used for OCDMA, and study optimal combinations according to varying operating environments.

We review the basics of nuclear binding energy scheme assumed to be associated with the existence of a new strong elementary charge associated with square root of reciprocal of the strong coupling constant.

We present simple relations for nuclear stability and nuclear binding energy with respect to three gravitational constants associated with electroweak, strong and electromagnetic interactions.

Highly-correlated electrons – electrons that engage in strong electron-electron interactions – have been observed in transition metal oxides and quantum dots and can create unusual material behavior that is difficult to model, such as switching between a low resistance metal state and a high resistance Mott insulator state. Tests of devices using a layer-by-layer deposition process for forming multilayer arrays of ferritin (a transition metal (iron) oxide storage protein) have been previously reported that indicate that highly-correlated electron transport is occurring, consistent with models of electron transport in quantum dots. This paper reports the results of the effect of various degrees of structural homogeneity on the electrical characteristics of these ferritin arrays, as well as demonstrating that these structures can provide a switching function associated with the circuit that they are contained within, consistent with the observed behavior of highly-correlated electrons.

We introduce a new variation on the domination theme which we call vertex domination as reducing waste of time in transportation planning and optimization of transport routes. We determine the vertex domination number $\gamma_v$ for several classes of fuzzy graphs. The bounds is obtained for it. In fuzzy graphs, monotone decreasing property and monotone increasing property are introduced. We prove both of the vizing's conjecture and the Grarier-Khelladi's conjecture are monotone decreasing fuzzy graph property for vertex domination. We obtain Nordhaus-Gaddum (NG) type results for these parameters. The relationship between several classes of operations on fuzzy graphs with the vertex domination number of them is studied. Finally, we discuss about vertex dominating set of a fuzzy tree by using the bridges and $\alpha$-strong edges equivalence.

Storm Ophelia made landfall over Ireland as an extra-tropical storm on the morning of the 16th of October 2017. The storm caused major power outages, lifted roofs, caused coastal flooding in Ireland, and resulted in the loss of three lives. A model’s capability to forecast extreme weather events such as Storm Ophelia is of utmost importance and now with a changing climate, it becomes more important to improve and enhance model forecasting capability. The Weather Research and Forecasting (WRF) model V3.9 has been configured for the Irish domain and this study presents a preliminary evaluation of the Model during Storm Ophelia. Simulated wind speed and direction were compared with hourly remote sensing (lidar) and in-situ (wind speed and wind direction at 10m) observations at the coastal site of Mace Head Atmospheric Research Station on the West coast of Ireland (53.33◦ N, 9.90 49 ◦ W). The model simulation has generally small biases in the simulated wind speed and wind direction during this case study. The model also realistically simulated the magnitude and geographical distribution of the wind speed and wind direction observed during Ophelia.

Fire-tolerant eucalypt forests of south eastern Australia are assumed to fully recover from even the most intense fires but surprisingly very few studies have quantitatively assessed that recovery. Accurate assessment of horizontal and vertical attributes of tree crowns after fire is essential to understand the fire’s legacy effects on tree growth and on forest structure. In this study, we quantitatively assessed individual tree crowns 8.5 years after a 2009 wildfire that burnt extensive areas of eucalypt forest in temperate Australia. We used airborne lidar data validated with field measurements to estimate multiple metrics that quantified the cover, density, and vertical distribution of individual-tree crowns in 51 plots of 0.05 ha in fire-tolerant eucalypt forest across four wildfire severity types (unburnt, low, moderate, high). Significant differences in the field-assessed mean height of fire scarring as a proportion of tree height, and in the proportions of trees with epicormic (stem) resprouts were consistent with the gradation in fire severity. Linear mixed-effects models indicated persistent effects of both moderate- and high-severity wildfire on tree crown architecture. Trees at high-severity sites had significantly less crown projection area and live crown width as a proportion of total crown width than those at unburnt and low-severity sites. Significant differences in lidar-based metrics (crown cover, evenness, leaf area density profiles) indicated that tree crowns at moderate- and high-severity sites were comparatively narrow and more evenly distributed down the tree stem. These conical-shaped crowns contrasted sharply with the rounded crowns of trees at unburnt and low-severity sites, and likely influenced both tree productivity and the accuracy of biomass allometric equations for nearly a decade after the fire. Our data provide a clear example of the utility of airborne lidar data for quantifying the impacts of disturbances at the scale of individual trees. Quantified effects of contrasting fire severities on the structure of resprouter tree crowns provide a strong basis for interpreting post-fire patterns in forest canopies and vegetation profiles in lidar and other remotely-sensed data at larger scales.

The high-resolution bistatic lidar developed at the Physikalisch-Technische Bundesanstalt (PTB) aims to overcome the limitations of conventional monostatic lidar technology which is widely used for wind velocity measurements in wind energy and meteorology applications. Due to the large measurement volume of a combined optical transmitter and receiver tilting in multiple directions, monostatic lidar generally has poor spatial and temporal resolution. It also exhibits large measurement uncertainty when operated in inhomogeneous flow, for instance, over complex terrain. In contrast, PTB’s bistatic lidar uses three dedicated receivers arranged around a central transmitter, resulting in an exceptionally small measurement volume. The coherent detection and modulation schemes used allow the detection of backscattered, Doppler shifted light down to the scale of single aerosols, realising the simultaneous measurement of all three wind velocity components. This paper outlines design details and the theory of operation of PTB’s bistatic lidar and provides an overview of selected comparative measurements. The results of these measurements have shown that the measurement uncertainty of PTB’s bistatic lidar is well within the measurement uncertainty of traditional cup anemometers, while being fully independent of its site and traceable to the SI units. This allows its use as a transfer standard for the calibration of other remote sensing devices. Overall, PTB’s bistatic lidar shows great potential to universally improve the capability and accuracy of wind velocity measurements, such as for the investigation of highly dynamic flow processes upstream and in the wake of wind turbines.

Forests are critical in regulating the world’s climate and they maintain overall Earth’s energy balance. The variability in forest canopy structure, topography and underneath vegetation background condition creates uncertainty in the estimation and modelling of Earth’s surface radiation particularly for boreal regions in high latitude. We studied seasonal variation in surface reflectance with respect to land cover classes, canopy structures, and topography in a boreal region of Alaska by fusing together Landsat 8 surface reflectance and LiDAR-derived canopy matrices. Our study shows that canopy structure and topography interplay and influence surface reflectance in a complex way particularly during the snow season. Topographic aspect and elevation control vegetation growth, type and structure. The southern slope is featured with more deciduous and taller trees having greater rugosity than the northern slope. Higher elevation is associated with taller trees for both vegetation types, particularly in the southern slope. In general, surface reflectance shows similar relationships with canopy cover, height and rugosity, mainly due to close relationships between these parameters. Surface reflectance decreases with canopy cover, tree height, and rugosity especially for evergreen forest. Deciduous forest shows larger variability of surface reflectance, particularly in March, mainly due to the mixing effect of snow and vegetation. The relationship between vegetation structure and surface reflectance is greatly impacted by topography. The negative relationship between elevation and surface reflectance may be due to taller and denser vegetation distribution in higher elevation. Surface reflectance in the southern slope is slightly larger than the northern slope for both deciduous and evergreen forest. The shadow effect from topography and tree crowns on surface reflectance play a different role for deciduous and evergreen forests. For deciduous forest, topographic shadow effect on surface reflectance is stronger than from tree shadowing in all seasons. For evergreen forest, shadow effects from topography and tree crowns on surface reflectance are both equally dominant, however tree shadow effect is more significant in March than in May and August. The generalized additive models (GAM) based on non-linear relationships between response (surface reflectance) and predictor (canopy structures and topography) variables confirms such observations. Our study not only provides accurate quantification of surface radiation budget but also helps in parametrization of climate change models.

Metal nanoparticles supporting plasmons are widely used to enhance electromagnetic fields, resulting in strong light-matter interactions at the nanoscale in a diverse range of applications. Recently, it has been shown that when metal nanorods are periodically arranged with proper lattice periods, surface lattice resonances (SLRs) can be excited and near fields can be greatly enhanced over extended volumes. In this work, we report significant near field enhancement over even larger volumes by placing the metal nanorod array within a Fabry-Pérot (F-P) microcavity. Results show that taking advantage of strong coupling between the SLR and the photonic F-P resonances, the electric field intensity of the bonding split mode can be enhanced by up to 1935 times, which is about three times of the enhancement of the SLR, and the greatly enhanced field can extend over most of the F-P microcavity. We further show that the F-P resonances of both odd and even orders can strongly couple to the SLR by varying the nanorods position from the middle of the microcavity. We expect that the proposed plasmonic-photonic coupling system will find promising applications in nanolasers, nonlinear optics and sensing.

The amount and spatial distribution of foliage in a tree canopy have fundamental functions in ecosystems as they affect energy and mass fluxes through photosynthesis and transpiration. They are usually described by the Leaf Area Index (LAI) and the Leaf Area Density (LAD), which can be measured through a variety of methods, including voxel-based methods applied to LiDAR point clouds. A theoretical study recently compared the numerical errors arising from different voxel-based estimation methods for Plant Area Density (PAD) based on Beer’s law-based, contact frequency and Maximum-Likelihood Estimation, showing that the bias-corrected Maximum Likelihood Estimator was theoretically the most efficient. However, this earlier study i) ignored wood volumes; ii) neglected vegetation clumping inside the voxel; iii) ignored instrument characteristics in terms of effective footprint, iv) was limited to a single viewpoint. In practice, retrieving LAD from PAD is not straightforward, vegetation is not randomly distributed in volumes of interest, beams are divergent and forestry plots are usually sampled from more than one viewpoint, to mitigate the effect of occlusion. In the present short communication, we extend the previous efficient formulation to actual field conditions to i) account for the presence of both wood volumes and wood hits, ii) rigorously include correction terms for vegetation and instrument characteristics, iii) integrate multiview data. A numerical comparison with other methods commonly used to combine information from different viewpoints led to error reduction, especially in poorly-explored volumes, which are frequent in actual canopies. Beyond its concision, completeness and efficiency, this new formulation -which can be applied to multiview TLS, but also UAV LiDAR scanning - can help reducing errors in LAD estimation.

The vulnerability of alpine environments to climate change presses an urgent need to accurately model and understand these ecosystems. Popularity in use of digital elevation models (DEMs) to derive proxy environmental variables has increased over the past decade, particularly as DEMs are relatively cheaply acquired at very high resolutions (VHR; <1m spatial resolution). Here, we implement a multiscale framework and compare DEM-derived variables produced by Light Detection and Ranging (LiDAR) and stereo-photogrammetry (PHOTO) methods, with the aims of assessing their relevance and utility in species distribution modelling (SDM). Using a case study on the arctic-alpine plant Arabis alpina in two valleys in the western Swiss Alps, we show that both LiDAR and PHOTO technologies can be relevant for producing DEM-derived variables for use in SDMs. We demonstrate that PHOTO DEMs rivalled the accuracy of LiDAR, putting the current paradigm of LiDAR being the more accurate of the two methods into question. We obtained DEMs at spatial resolutions of 6.25cm-8m for PHOTO and 50cm-32m for LiDAR, where we determined that the optimal spatial resolutions of DEM-derived variables in SDM were between 1 and 32m, depending on the variable and site characteristics. We found that the reduced extent of PHOTO DEMs altered the calculations of all derived variables, which had particular consequences on their relevance at the site with heterogenous terrain. However, for the homogenous site, we found that SDMs based on PHOTO-derived variables generally had higher predictive powers than those derived from LiDAR at matching resolutions. From our results, we recommend carefully considering the required DEM extent to produce relevant derived variables. We also advocate implementing a multiscale framework to appropriately assess the ecological relevance of derived variables, where we caution against the use of VHR-DEMs finer than 50cm in such studies.

The accuracy of wind field simulation and prediction is one of the most significant parameters in the field of atmospheric science and wind energy. Limited by the observation data, there are few researches on wind energy development. A 3D Doppler wind lidar (DWL) providing the high-vertical-resolution wind data over the urban complex underlying surface in February 2018 was employed to evaluated the accuracy of vertical wind field simulation systematically for the first time. 11 PBL schemes of the Weather Research and Forecasting Model (WRF) were employed in simulation. The model results were evaluated in groups separated by weather (sunny days, haze days and windy days), observation height layers, and various observation wind speeds. The test results presented that the vertical layer altitude of the observation point position was the most important factor. The simulation is fairly well at a height of 1000-2000m, as most of the relative mean bias of wind speed and wind direction are less than 20% and 6% respectively. Below 1000 m, the wind speed and direction biases are about 30%-150% m.s-1 and 6%-30% respectively. Moreover, when the observed wind speed was lower than 5 m.s-1, the bias were usually large, and the wind speed relative mean bias is up to 50-300%. In addition, the accuracy of simulated wind profile is better in 10-15m.s-1 than other speed ranges, and is better up 1000m than below 1000m in the boundary layer. We see that the WRF boundary layer schemes have different applicability to different weather conditions. The WRF boundary layer schemes have significant differences in wind field simulation with larger error under the complex topography. A PBL scheme is not likely to maintain its advantages in the long term under different conditions including altitude and weather conditions.

With reference to electromagnetic interaction and Abdus Salam’s strong (nuclear) gravity, 1) Square root of ‘reciprocal’ of the strong coupling constant can be considered as the strength of nuclear elementary charge. 2) ‘Reciprocal’ of the strong coupling constant can be considered as the maximum strength of nuclear binding energy. 3) In deuteron, strength of nuclear binding energy is around unity and there exists no strong interaction in between neutron and proton. $G_s\cong 3.32688\times {10}^{28}{\mathrm{m}}^3{\mathrm{kg}}^{-1}{\sec }^{-2}$ being the nuclear gravitational constant, nuclear charge radius can be shown to be, $R_0\cong \frac{2G_s{m}_p}{c^2}\cong 1.24\mathrm{fm}.$ $e_s\cong \left(\frac{G_s{m}_p^2}{\hslash c}\right)e\cong 4.716785\times {10}^{-19}\mathrm{C}$ being the nuclear elementary charge, proton magnetic moment can be shown to be, ${\mu }_p\cong \frac{e_s\hslash }{2m_p}\cong \frac{e{G}_s{m}_p}{2c}\cong 1.48694\times {10}^{-26}\mathrm{J}{.\mathrm{T}}^{-1}.$ ${\alpha }_s\cong {\left(\frac{\hslash c}{G_s{m}_p^2}\right)}^2\cong 0.1153795$ being the strong coupling constant, strong interaction range can be shown to be proportional to $\exp \left(\frac{1}{{\alpha }_s^2}\right).$ Interesting points to be noted are: An increase in the value of ${\alpha }_s$ helps in decreasing the interaction range indicating a more strongly bound nuclear system. A decrease in the value of ${\alpha }_s$ helps in increasing the interaction range indicating a more weakly bound nuclear system. From $Z\cong 30$ onwards, close to stable mass numbers, nuclear binding energy can be addressed with, ${\left(B\right)}_{A_s}\cong Z\times \left\{\left(\frac{1}{{\alpha }_s}+1\right)+\sqrt{\sqrt{30\times 31}}\right\}\left(m_n-m_p\right)c^2\approx Z\times 19.66\mathrm{MeV}.$ With further study, magnitude of the Newtonian gravitational constant can be estimated with nuclear elementary physical constants. One sample relation is, $\left(\frac{G_N}{G_s}\right)\cong \frac{1}{2}{\left(\frac{m_e}{m_p}\right)}^{10}\left[\sqrt{\frac{G_F}{\hslash c}}/\left(\frac{\hslash }{m_{e}c}\right)\right]$ where $G_N$ represents the Newtonian gravitational constant and $G_F$ represents the Fermi’s weak coupling constant. Two interesting coincidences are, ${\left(m_p/m_e\right)}^{10}\cong \exp \left(1/{\alpha }_s^2\right)$ and $2G_s{m}_e/c^2\cong \sqrt{G_F/\hslash c}.$

Recent studies indicate that the Cloud-Aerosol Lidar with Orthogonal Polarization (CALIOP) aboard the Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) satellite provides valuable information about ocean phytoplankton distributions. CALIOP’s attenuated backscatter coefficients, measured at 532 nm in receiver channels oriented parallel and perpendicular to the laser’s linear polarization plane, are significantly improved in the Version 4 data product. However, due to non-ideal instrument effects, a small fraction of the backscattered optical power polarized parallel to the receiver polarization reference plane is misdirected into the perpendicular channel, and vice versa. This effect, known as polarization crosstalk, typically causes the measured perpendicular signal to be higher than its true value and the measured parallel signal to be lower than its true value. Therefore, the ocean optical properties derived directly from CALIOP’s measured signals will be biased if the polarization crosstalk effect is not taken into account. This paper presents methods that can be used to estimate the CALIOP crosstalk effects from on-orbit measurements. The global ocean depolarization ratios calculated both before and after removing the crosstalk effects are compared. Using CALIOP crosstalk-corrected signals is highly recommended for all ocean subsurface studies.

In the aftermath of pyroclastic-flow –dominated eruptions, lahars are the main geomorphic agent, but at the decadal scale, different sets of processes take place in the volcanic sediment cascade. At Unzen Volcano, in the Gokurakudani Gully we investigated the geomorphologic evolution and how the topographic change and the sediment change over time is controlling this transition. For this purpose, a combination of LiDAR data, aerial photography and photogrammetry, Ground Penetrating Radar and sediment grain-size analysis was done. The results show chocking zones and zones of enlargement of the gully, partly controlled by pre-eruption topography, but also by the overlapping patterns of the pyroclastic flow deposits of 1990 – 1995. The Ground Penetrating Radar revealed that on top of the typical lahar structure at the bottom of the gully, side-wall collapses were trapping finer sandy sediments formed in relatively low-energy deposition environment. This shows that secondary processes are taking place in the sediment transport process, on top of lahar activity, but also that these temporary dams may be a source of sudden sediment and water release, leading to lahars. Finally, the sediments from the gully walls are being preferentially oozed out of the pyroclastic-flow deposit, meaning that over longer period of time, there may be a lack of fines, increasing permeability and reducing internal pore-pressure needed for lahar triggering. It also poses the important question of how much of a past-event one can understand from outcrops in coarse heterometric material, as the deposit structure can remain, even after loosing part of its fine material.

The world is facing a great technological transformation towards full autonomous vehicles, where optimists predict that by 2030, autonomous vehicles will be sufficiently reliable, affordable and common to displace most human driving. To cope with these trends, reliable perception systems must enable vehicles to hear and see all the surroundings, being light detection and ranging (LiDAR) sensors a key instrument for recreating a 3D visualization of the world in real time. However, perception systems must rely in accurate measurements of the environment. Thus, sensors must be calibrated and benchmarked before being placed on the market or assembled in a car. This article presents an Evaluation and Testing Platform for Automotive LiDAR sensors with the main goal of testing not only commercially available sensors, but also sensor prototypes currently under development in Bosch Automotive Electronics division. The testing system can benchmark any LiDAR sensor under different conditions, recreating the expected driving environment to which such devices are normally subjected. To characterize and validate the sensor under test, the platform evaluates several parameters such as the field of view (FoV), angular resolution, sensor’s range, etc. This project results from a partnership between the University of Minho and Bosch Car Multimedia Portugal, S.A.

On the 6th September at 03:08AM local time, the Iburi-Hokkaido Earthquake, only 33 km deep triggers >5,000 co-seismic mass-movements in the hills in a 25 km radius from the epicenter. Although the majority of the mass-movements occurred in complex-geometry valley with the coalescence of deposits, a small sub-set of 59 events deposited on the semi-horizontal val-ley-floor generating separated deposits that were studied in the present contribution. The aim of the present contribution was to contribute to the existing databases of empirical relationships based on planform and vertical dataset, and to define the scalars of those relations that charac-terize the mass-movements of the Iburi-Hokkaido earthquake, with the overarching goal of generating predictors for hazard-mapping. To reach these objectives, the methodology relies on LiDAR data flown in the aftermath of the earthquake as well as aerial photographs. Using Geo-graphical Information Science (GIS) tools planform and vertical parameters were extracted to calculate the power-law relations between areas and volume, between the Fahrböschung and the volume of the deposits, as well as other geometric relationships. Results have shown that the relation S=k〖V_d〗^(2/3) where S is the surface area of a deposit and Vd the volume, and k a scalar that is function of S: k=2.1842 ln⁡(S)-10.167 with a R2 of 0.52, and this relation is improved for the open-slope mass-movements but not the valley-confined ones, that present more varia-bility. The Fahrböschung for events that started as valley-confined mass-movements was Fc = -0.043ln(D) + 0.7082 with a R2 of 0.5m while for open-slope mass-movements, the Fo = -0.046ln(D) + 0.7088 with a R2 of 0.52. These results contribute to the growing co-seismic land-slide database and they can also be the base to understand the role of the counter-slopes and complex topography on the spread and distance travelled by the mass-movement deposits.

In this paper, we introduce a new formulation based on Floquet (Fourier) spectral analysis combined with a spectral modulation technique (and its spatial form) to study strongly coupled sublattices predefined in the infinite and large finite extent of almost periodic antenna arrays (e.g metasurfaces). This analysis is very relevant for dense massive MIMO, intelligent surfaces, 5G, and 6G applications (used for very small areas with a large number of elements such as millimeter and terahertz waves applications). The numerical method that is adopted to model the structure is the method of moments simplified by equivalent circuits MoM GEC. Other numerical methods (as the ASM array scanning method and windowing Fourier method) used this analysis in their kernel that to treat periodic and pseudo-periodic (or quasi-periodic) arrays.

A new method for wide-area urban roof assessment of suitability for solar photovoltaics is introduced and validated. Knowledge of roof geometry and physical features is essential for evaluation of the impact of multiple rooftop solar photovoltaic (PV) system installations on local electricity networks. This paper begins by reviewing and testing a range of existing techniques for identifying roof characteristics. It was found that no current method is capable of delivering accurate results with publicly available input data. Hence a different approach is developed, based on slope and aspect using LIDAR data, building footprint data, GIS tools and aerial photographs. It assesses each roof’s suitability for PV installation. That is, its properties should allow the installation of at least a minimum size photovoltaic system. In this way the minimum potential solar yield for region or city may be obtained. The accuracy of the new method is then established, by ground-truthing against a database of 886 household systems. This is the largest validation of a rooftop assessment method to date. The method is flexible with few prior assumptions. It is based on separate consideration of buildings and can therefore generate data for various PV scenarios and future analyses.

For gravitational wave (GW) detected neutron star mergers, one of the leading candidates for electromagnetic (EM) counterparts is the afterglow from an ultra-relativistic jet. Where this afterglow is observed, it will likely be viewed off-axis, such as the afterglow following GW170817/GRB 170817A. The temporal behaviour of an off-axis observed GRB afterglow can be used to reveal the lateral jet structure, and statistical model fits can put constraints on the various model free-parameters. Amongst these parameters is the inclination of the system to the line of sight. Along with the GW detection, the afterglow modelling provides the best constraint on the inclination to the line-of-sight and can improve the estimates of cosmological parameters e.g. the Hubble constant, from GW-EM events. However, modelling of the afterglow depends on the assumed jet structure and, often overlooked, the effects of lateral spreading. Here we show how the inclusion of lateral spreading in the afterglow models can affect the estimated inclination of GW-EM events.

Archaeological topography identification from high-resolution DEMs is a current method that is used with high success in archaeological prospecting of wide areas. I present a methodology trough which burial mounds (tumuli) from LiDAR DEMS can be identified. This methodology uses geomorphometric and statistical methods to identify with high accuracy burial mound candidates. Peaks, defined as local elevation maxima are found as a first step. In the second step, local convexity watershed segments and their seeds are compared with positions of local peaks and the peaks that correspond or have in vicinity local convexity segments seeds are selected. The local convexity segments that correspond to these selected peaks are further feed to a Random Forest algorithm together with shape descriptors and descriptive statistics of geomorphometric variables in order to build a model for the classification. Multiple approaches to tune and selected the proper training dataset, settings and variables were tested. The validation of the model was performed on the full dataset where the training was performed and on an external dataset in order to test the usability of the method for other areas in a similar geomorphological and archaeological setting. The validation was performed against manually mapped and field checked burial mounds from two neighbor study areas of 100 km² each. The results show that by training the Random Forest on a dataset composed of between 75% to 100% of the segments corresponding to burial mounds and ten times more non-burial mounds segments selected using latin hypercube sampling, 93% of the burial mound segments from the external dataset are identified. There are 42 false positive cases that need to be checked, and there are two burial mound segments missed. The method shows great promise to be used for burial mound detection on wider areas by delineating a certain number of tumuli mounds for model training.

The purpose of this paper is to bring to light a method through which the global in time existence for arbitrary large in H¹ initial data of a strong solution to 3D periodic Navier-Stokes equations follows. The method consists of subdividing the time interval of existence into smaller sub-intervals carefully chosen. These sub-intervals are chosen based on the hypothesis that for any wavenumber m, one can find an interval of time on which the energy quantized in low-frequency components (up to m) of the solution u is lesser than the energy quantized in high-frequency components (down to m) or otherwise the opposite. We associate then a suitable number m to each one of the intervals and we prove that the norm ||u(t)||_H1 is bounded in both mentioned cases. The process can be continued until reaching the maximal time of existence T_max which yields the global in time existence of strong solution.

With reference to our earlier published views on large nuclear gravitational constant , nuclear elementary charge and strong coupling constant , in this paper, we present simple relations for nuclear stability range, binding energy of isotopes and magic proton numbers.

The goal of this paper is to present a low-cost, low-power prototype of a pulsed Ultra Wide Band UWB) oscillator and an UWB elliptical dipole antenna integrated on the same Radio Frequency (RF) Printed Circuit Board (PCB) and its digital control board for Real Time Locating System (RTLS) applications. The design is compatible with IEEE 802.15.4 high rate pulse repetition UWB standard being able to work between 6 GHz and 8.5 GHz with 500 MHz bandwidth and with a pulse duration of 2 ns. The UWB system has been designed using the CST Microwave Studio transient Electro-Magnetic (EM) circuit co-simulation method. This method integrates the functional circuit simulation together with the full wave (EM) simulation of the PCB’s 3D model allowing fast parameter tuning. The PCB has been manufactured and the entire system has been assembled and measured. Simulated and measured results are in excellent agreement with respect to the radiation performances as well as the power consumptions.

The continuous flowing spacetime forms a spacetime group G, one of its fundamental groups is the Poincare group PO(1,3), and the matter and interaction fields are representations of its intrinsic spacetime group. As a kind of quantized space-time unit, space-time group elements generate both space-time manifolds and matter. Matter and fields are aggregates of the quantum space-time within them and determine their type: the Lorentz group SO(1,3) represents a rotating spacetime corresponding to visible matter and the translation group P^1,3 represents a translational spacetime corresponding to dark matter and dark energy. The aggregation mode of space-time degrees of freedom in matter reveals that charge conjugation symmetry is the inverse symmetry of internal time of charged particles, and the external parity breaking of neutrinos is also due to their internal spatial aggregation mode.

As a critical transmitter, the compact 532 nm lasers operating on high repetition and narrow pulse widths have been used widely for airborne or space-borne laser active remote sensing. We developed a free space pumped TEM₀₀ mode sub-nanosecond 532 nm laser that occupied a volume of less than 125 mm × 50 mm × 40 mm (0.25 liters). The fundamental 1064 nm laser consists of a passively Q-switched composite crystal microchip laser and an off-axis, two-pass power amplifier. The pump sources were two single-emitter semiconductor laser diodes (LD) of 808 nm with a maximum continuous wave (CW) power of 10 W each. The average power of fundamental 1064 nm laser was 1.26 W with the laser operating at 16 kHz repetition rates, and 857ps pulse widths. Since the beam distortion would be severe in microchip lasers in terms of the increase in heat load, for obtaining a high beam quality of 532 nm, the beam distortion was compensated by adjusting the distribution of pumping beam in our experiment of fundamental amplification. Furthermore, better than 0.6 W average power, 770 ps, beam quality of M² ＜1.2, and 16 kHz pulse output at 532 nm was obtained by a Type I LiB₃O₅ (LBO) crystal in the critical phase matching (CPM) regime for second harmonic generation (SHG).

Negative corona discharges occur widely in high voltage transmission lines and charged aircraft, which can cause strong electromagnetic interference. Negative corona discharge is typically performed simultaneously at multiple discharge points. In this study, the current and its EM radiation characteristics of single-needle and multi-needle negative corona discharge in different conditions were tested. The current and electromagnetic radiation characteristics of the two discharge structures were compared. The dipole radiation model was established to analyze the EM radiation characteristics of the negative corona discharge.The results show that, It is only when the voltage reaches a certain threshold that the current and electromagnetic radiation fields of the multi-needle discharge structure will be superimposed and their amplitudes will increase significantly. The frequency of electromagnetic radiation signal does not change with the number of needles, cathode geometry and applied voltage, but only depends on ambient pressure. It provides a basis for detecting corona discharge sources under different conditions.

For the first time, We do fuzzification the concept of domination in crisp graph on a generalization of fuzzy graph by using membership values of vertices, α-strong edges and edges. In this paper, we introduce the first variation on the domination theme which we call vertex domination. We determine the vertex domination number γ_v for several classes of t-norm fuzzy graphs which include complete t-norm fuzzy graph, complete bipartite t-norm fuzzy graph, star t-norm fuzzy graph and empty t-norm fuzzy graph. The relationship between effective edges and α-strong edges is obtained. Finally, we discuss about vertex dominating set of a fuzzy tree with respect to a t-norm ⨂ by using the bridges and α-strong edges equivalence.

The US pacific northwest recorded its highest temperature in late June 2021. The three-day stretch of scorching heat had a devastating effect on not only the residents of the state, but also on the crops thus impacting the food supply-chain. It is forecasted that streaks of 100-degree temperatures will become common. Farmers will have to adapt to the changing landscape to preserve their crop yield and profitability. A research collaborative consisting of researchers and academicians in Eastern Washington led by a pioneering startup has setup a 16.9-acre Honeycrisp Apple Smart Orchard in Grandview, WA as a laboratory to study the environmental and plant growth factors in real-time using modern computational tools and techniques like IoT (Internet of Things), Edge and Cloud Computing, and Drone and LiDAR (Light Detection and Ranging) imaging. The computational analysis is used to develop guidelines for precision agriculture for orchard blocks to address plant growth issues scientifically and in a timely fashion. The analysis also helps in creating risk-mitigation strategies for severe weather events while helping prepare farmers to maximize crop yield and profitability per acre. I was fortunate to gain access to the terabytes of farm data related to the weather, soil, water, tree, and canopy health, to analyze and formulate recommendations for the farmers that can be adopted nationwide for different crops and weather conditions. This paper discusses the different streams of farm data that were analyzed (ex. soil moisture, soil water potential, and sap flow) and the development of the framework to use data to convert insights into actionable steps. For example, the use of sensors can inform a farmer that their level of soil water potential is below threshold in a specific patch of the orchard, prompting them to turn on irrigation for the patch instead of the whole orchard. I estimate that using an IoT-sensor-based decision framework discussed in this paper, growers can save up to 55% of their water costs for the season. Using these insights, farmers can better manage their irrigation resources and labor, thus maximizing their crop yield and profits.

Automated extraction of buildings from earth observation (EO) data is important for various applications, including updating of maps, risk assessment, urban planning, policy making. Combining data from different sensors such as high-resolution multispectral (HRI) and light detection and ranging (LiDAR) has shown great potential in building extraction. Deep learning (DL) is increasingly used in multimodal data fusion and urban object extraction. However, DL-based multimodal fusion networks may underperform due to insufficient learning of “joint features” from multiple sources and oversimplified approaches to fusing multimodal features. Recently, an hybrid attention-aware fusion network (HAFNet) has been proposed for building extraction from a dataset including co-located Very-High-Resolution (VHR) optical images and Light Detection And Ranging (LiDAR) joint data. The system reported good performances thanks to the adaptivity of the attention mechanism to the features of the information content of the three streams but suffered from model overparametrization, which inevitably leads to long training times and heavy computational load. In this paper the authors propose a restructuring of the scheme, which involved replacing VGG-16-like encoders with the recently proposed EfficientNet, whose advantages counteract exactly the issues found with the HAFNet scheme. The novel configuration was tested on multiple benchmark datasets, reporting great improvements in terms of processing times, and also in terms of accuracy. The new scheme, called HAFNetE (HAFNet with EfficientNet integration), appears indeed capable of achieving good results with less parameters, translating into better computational efficiency. Based on these findings, we can conclude that, given the current advancements in single-thread schemes, the classical multi-thread HAFNet scheme could be effectively transformed by the HAFNetE scheme by replacing VGG-16 with EfficientNet blocks on each single thread. The remarkable reduction achieved in computational requirements moves the system one step closer to on-board implementation in a possible, future “urban mapping” satellite constellation.

Full waveform (FW) LiDAR holds great potential for retrieving vegetation structure parameters at a high level of detail, but this prospect is constrained by practical factors such as lack of available handy processing tools and technical intricacy of waveform processing. This study introduces a new product, named the Hyper Point Cloud (HPC) derived from FW LiDAR data, and explore its potential applications such as tree crown delineation using the HPC-based intensity and percentile height (PH) surfaces, which show a promising solution to the constraints of using FW LiDAR data. Results of the HPC present a new direction to handle FW LiDAR data and offer prospects for studying the mid-story and understory of vegetation with high point density (~ 182 points/m2). The intensity-derived digital surface model (DSM) generated from the HPC shows that the ground region has larger maximum intensity (MAXI) and mean intensity (MI) than the vegetation region while having smaller total intensity (TI) and number of intensities (NI) at the given grid cell. Our analysis of intensity distribution contours at individual tree level exhibit similar patterns, indicating that the MAXI and MI are decreasing from the tree crown center to tree boundary while a rising trend is observed for TI and NI. These intensity variable contours provide a theoretical justification for using HPC-based intensity surfaces to segment tree crowns and exploit their potential for extracting tree attributes. The HPC-based intensity surfaces and the HPC-based PH Canopy Height Models (CHM) demonstrate promising tree segmentation results comparable to the LiDAR derived CHM for estimating tree attributes such as tree locations, crown widths and tree heights. We envision that products such as the HPC and the HPC-based intensity and height surfaces introduced in this study can open new perspectives to use FW LiDAR data and alleviate the technical barrier of exploring FW LiDAR data for detailed vegetation structure characterization.

Exploring the effect of the sample size on the estimation accuracy of airborne LiDAR forest attributes in a large-scale area can help in optimizing the technical application scheme of operational ALS-based large-scale forest stand inventories. In our study, sample datasets composed of different sample plots were constructed by repeated sampling from 1003 sample plots in a subtropical study area covering 2376 × 103 km2. Sixteen multiplicative power models were built in each forest type consisting of four forest attributes. Through these models, the variations of standard deviation (SD) and coefficient of variation (CV) of R2 and rRMSE of forest attribute estimation models for different quantity levels of sample plots were also analyzed. The results showed that, first, when the sample size increased from 30 to the top limit, the SD of the forest attributes and LiDAR variables showed a decreasing trend. Second, as the sample size increased, the rRMSE of the 16 forest attribute estimation models gradually decreased, while the R2 gradually increased. Third, when the sample size was small, both the SD of R2 and rRMSE of the models were large, and the SD of R2 and rRMSE gradually decreased as the sample size increased. In 50 models conducted for each attribute at the same sample size, for the mean standard deviations of forest attributes, the ten best performing models were lower than those of the total 50 models, and the worst ten models were the opposite. When the sample size increased, the accuracy of each forest attribute estimation model for each forest type gradually improved. The variation of forest attributes and the LiDAR variable of the construction model are critical factors that affect the model’s accuracy. To efficiently apply airborne LiDAR in order to survey large-scale subtropical forest resources, the sample size of the Chinese fir forest, pine forest, eucalyptus forest, and broad-leaved forest should be 110, 80, 85, and 70, respectively.

New setting is introduced to study the global powerful alliance. Global powerful alliance is about a set of vertices which are applied into the setting of neutrosophic graphs. Neighborhood has the key role to define this notion. Also, neighborhood is defined based on strong edges. Strong edge gets a framework as neighborhood and after that, too close vertices have key role to define global powerful alliance based on strong edges. The structure of set is studied and general results are obtained. Also, some classes of neutrosophic graphs excluding empty, path, star, and wheel and containing complete, cycle and r-regular-strong are investigated in the terms of set, minimal set, number, and neutrosophic number. Neutrosophic number is used in this way. It’s applied to use the type of neutrosophic number in the way that, three values of a vertex are used and they’ve same share to construct this number. It’s called “modified neutrosophic number”. Summation of three values of vertex makes one number and applying it to a set makes neutrosophic number of set. This approach facilitates identifying minimal set and optimal set which forms minimal-global-powerful-alliance number and minimal-global-powerful-alliance-neutrosophic number. Two different types of sets namely global-powerful alliance and minimal-global-powerful alliance are defined. Global-powerful alliance identifies the sets in general vision but minimal-global-powerful alliance takes focus on the sets which deleting a vertex is impossible. Minimal-global-powerful-alliance number is about minimum cardinality amid the cardinalities of all minimal-global-powerful alliances in a given neutrosophic graph. New notions are applied in the settings both individual and family. Family of neutrosophic graphs has an open avenue, in the way that, the family only contains same classes of neutrosophic graphs. The results are about minimal-global-powerful alliance, minimal-global-powerful-alliance number and its corresponded sets, minimal-global-powerful-alliance-neutrosophic number and its corresponded sets, and characterizing all minimal-global-powerful alliances, minimal-t-powerful alliance, minimal-t-powerful-alliance number and its corresponded sets, minimal-t-powerful-alliance-neutrosophic number and its corresponded sets, and characterizing all minimal-t-powerful alliances. The connections amid t-powerful-alliances are obtained. The number of connected components has some relations with this new concept and it gets some results. Some classes of neutrosophic graphs behave differently when the parity of vertices are different and in this case, cycle, and complete illustrate these behaviors. Two applications concerning complete model as individual and family, under the titles of time table and scheduling conclude the results and they give more clarifications and closing remarks. In this study, there’s an open way to extend these results into the family of these classes of neutrosophic graphs. The family of neutrosophic graphs aren’t study deeply and with more results but it seems that analogous results are determined. Slight progress is obtained in the family of these models but there are open avenues to study family of other models as same models and different models. There’s a question. How can be related to each other, two sets partitioning the vertex set of a graph? The ideas of neighborhood and neighbors based on strong edges illustrate open way to get results. A set is global powerful alliance when two sets partitioning vertex set have uniform structure. All members of set have more amount of neighbors in the set than out of set and reversely for non-members of set with less members in the way that the set is simultaneously t-offensive and(t-2)-defensive. A set is global if t=0. It leads us to the notion of global powerful alliance. Different edges make different neighborhoods but it’s used one style edge titled strong edge. These notions are applied into neutrosophic graphs as individuals and family of them. Independent set as an alliance is a special set which has no neighbor inside and it implies some drawbacks for these notions. Finding special sets which are well-known, is an open way to purse this study. Special set which its members have only one neighbor inside, characterize the connected components where the cardinality of its complement is the number of connected components. Some problems are proposed to pursue this study. Basic familiarities with graph theory and neutrosophic graph theory are proposed for this article.

Incident solar radiation (insolation) passing through the forest canopy to the ground surface is either absorbed or scattered. This phenomenon, known as radiation attenuation, is measured using the extinction coefficient (K). The amount of radiation at the ground surface of a given site is effectively controlled by the canopy’s surface and structure, determining its suitability for plant species.Menhinick’s and Simpson biodiversity indexes were selected as spatially explicit response variables for the regression equation using canopy structure metrics as predictors. Independent variables include modeled area solar radiation, LiDAR derived canopy height, effective leaf area index data derived from multi-spectral imagery, and canopy strata metrics derived from LiDAR point-cloud data. The results support the hypothesis that, 1.) canopy surface and strata variability may be associated with understory species diversity due to habitat partitioning and radiation attenuation, and that, 2.) such a model can predict both this relationship and biodiversity clustering.The study data yielded significant correlations between predictor and response variables and was used to produce a multiple-linear model comprising canopy relief, texture of heights, and vegetation density to predict understory plant diversity. When analyzed for spatial autocorrelation, the predicted biodiversity data exhibited non-random spatial continuity.

Super Typhoon Saola came very close to Hong Kong on 1 and 2 September 2023, necessitating the issuance of No. 10 hurricane signal, the highest tropical cyclone warning signal, in Hong Kong. While there were widespread damages in Hong Kong, no people were killed in the event with effective early warning. It is rare that a super typhoon came very close to Hong Kong and this paper is the first part in the series of the documentation of Saola to summarize the interesting observations of Saola near Hong Kong for future reference by weather forecasters, including sur-face observations, upper air observations, microburst alert from weather radars, and turbulence intensity based on spectral width measurement of radars.

Object segmentation is still considered a challenging problem in autonomous driving, particularly in consideration of real world conditions. Following this line of research, this paper approaches the problem of object segmentation using LiDAR-camera fusion and semi-supervised learning implemented in a fully-convolutional neural network. Our method is tested on real-world data acquired using our custom vehicle iseAuto shuttle. The data include all-weather scenarios, featuring night and rainy weather. In this work, it is shown that LiDAR-camera fusion with only a few annotated scenarios and semi-supervised learning, it is possible to achieve robust performance on real-world data in a multi-class object segmentation problem. The performance of our algorithm is measured in terms of intersection over union, precision, recall and area-under-the-curve average precision. Our network achieves 82% IoU in vehicle detection in day fair scenarios and 64% IoU in vehicle segmentation in night rain scenarios.

With our long experience in the field of unification of gravity and quantum mechanics, we understood that, when mass of any elementary is extremely small/negligible compared to macroscopic bodies, highly curved microscopic space-time can be addressed with large gravitational constants and magnitude of elementary gravitational constant seems to increase with decreasing mass and increasing interaction range. In our earlier publications, we proposed that, 1) There exist three atomic gravitational constants associated with electroweak, strong and electromagnetic interactions; 2) There exists a strong interaction elementary charge in such a way that, it's squared ratio with normal elementary charge is close to inverse of the strong coupling constant; and 3) Considering a fermion-boson mass ratio of 2.27, quarks can be split into quark fermions and quark bosons. Further, we noticed that, electroweak field seems to be operated by a primordial massive fermion of rest energy 584.725 GeV and hadron masses seem to be generated by a new hadronic fermion of rest energy 103.4 GeV. In this context, starting from lepton rest masses to stellar masses, we have developed many interesting and workable relations. With further study, a workable model of final unification can be developed.

This article presents results of the polarization laser studies of the optical and microphysical characteristics of the high-level clouds (HLC). The high-altitude matrix polarization lidar (HAMPL; Tomsk, Russia) is described. HAMPL measures vertical profiles of all elements of the backscattering phase matrix (BSPM) of the HLC. Based on the joint analysis of lidar and radiosonde observations it is shown that the spatial structure of the HLC containing oriented ice crystals is inhomogeneous in the horizontal wind direction. It includes local areas with oriented particles; the sizes of such areas are estimated together with the most probable meteorological conditions of their formation. The shortcomings of the radiosonde observations performed closest to the location of the HAMPL are described. The applicability of the ERA5 reanalysis data of the European Centre for Medium-Range Weather Forecasts for use as an alternative source of information on the vertical profiles of meteorological quantities for the interpretation of HLC lidar sensing data in Western Siberia was checked.

We examine data assimilation coupling between meteorology and chemistry in the stratosphere from both weak and strong coupling strategies. The study was performed with the Canadian operational weather prediction Global Environmental Multiscale (GEM) model coupled online with the photochemical stratospheric chemistry developed at the Belgian Institute for Space Aeronomy, described in Part I. Here, the Canadian Meteorological Centre’s operational variational assimilation system was extended to include errors of chemical variables and cross-covariances between meteorological and chemical variables in a 3D-Var configuration, and we added the adjoint of tracer advection in the 4D-Var configuration. Our results show that the assimilation of limb sounding observations from the MIPAS instrument on board Envisat can be used to anchor the AMSU-A radiance bias correction scheme. Also, the added value of limb sounding temperature observations on meteorology and transport is shown to be significant. Weak coupling data assimilation with ozone-radiation interaction is shown to give comparable on meteorology whether a simplified linearized or comprehensive ozone chemistry scheme is used. Strong coupling data assimilation, using static error cross-covariances between ozone and temperature in a 3D-Var context, produced inconclusive results with the approximations we used. We have also conducted the assimilation of long-lived species observations using 4D-Var to infer winds. Our results showed the added value of assimilating several long-lived species, and an improvement in the zonal wind in the Tropics within the troposphere and lower stratosphere. 4D-Var assimilation also induced a correction of zonal wind in the surf zone and a temperature bias in the lower tropical stratosphere

The strong coupling between individual quantum emitters and resonant optical micro/nanocavities is beneficial to understand light and matter interactions. Here we propose a plasmonic nanoantenna placed on a metal film to achieve an ultra-high electric field enhancement in the nanogap and ultra-small optical mode volume. The strong coupling between a single quantum dot and the designed structure is investigated in detail by both numerical simulations and theoretical calculations. When a single QD is inserted into the nanogap of the silver nanoantenna, scattering spectra show remarkably large spectral splitting and typical anti-crossing behavior of the vacuum Rabi splitting, which can be realized in the scattering spectra by varying the nanoantenna thickness. Our work shows a possible way to enhance light-matter interaction at a single quantum emitter limit, which can be useful for future quantum and nanophotonic applications.