The role of hydrogen in a future energy system with a high share of variable renewable energy sources (VRES) is regarded as crucial in order to balance fluctuations in electricity generation. These fluctuations can be compensated for by flexibility measures such as the expansion of transmission, flexible generation, larger back-up capacity and storage. Salt cavern storage is the most promising technology due to its large storage capacity, followed by pumped hydro storage. For the underground storage of chemical energy carriers such as hydrogen, salt caverns offer the most promising option owing to their low investment cost, high sealing potential and low cushion gas requirement. This paper provides a suitability assessment of European subsurface salt structures in terms of size, land eligibility and storage capacity. Two distinct cavern volumes of 500,000 m³ and 750,000 m³ are considered, with preference being given for salt caverns over bedded salt deposits and salt domes. The storage capacities of individual caverns are estimated on the basis of thermodynamic considerations based on site-specific data. The results are analyzed using three different scenarios: onshore and offshore salt caverns, only onshore salt caverns and only onshore caverns within 50 km of the shore. The overall technical storage potential across Europe is estimated at 84.8 PWh_H2, 27% of which constitutes only onshore locations. Furthermore, this capacity decreases to 7.3 PWh_H2 with a limitation of 50 km distance from shore. In all cases, Germany has the highest technical storage potential, with a value of 9.4 PWh_H2, located onshore only in salt domes in the north of the country. Moreover, Norway has 7.5 PWh_H2 of storage potential for offshore caverns, which are all located in the subsurface of the North Sea Basin.

ABSTRACT Ethiopia is a developing country, where majority of the population lives in rural areas without access to electricity. 83% of the total population of the country use traditional biomass energy as a basic source of energy. In contrast, the country is endowed with sufficient renewable energy resources which can be used as a standalone electric energy supply system for electrifying remote areas of the country. These resources are mainly micro hydropower and wind which can be used individually or the best combination of one another. The application of hybrid renewable energy system has become an important alternative solution for rural electrification program. The Modeling and control of a hybrid PV-Wind-Hydro DG system is also addressed. Dynamic models for the major system components, namely, wind energy conversion system, PV energy conversion system, hydro, inverter, and overall fuzzy logic controller units are developed. Then, a simulation model for the proposed hybrid power system has been developed using MATLAB /Simulink environment. This is done by creating subsystem sets of the major dynamic component models and then assembling into a single aggregate model. The overall power management strategy for coordinating and/or controlling the different energy sources is also presented in the thesis work. Generally there are 800 households with total electric demand of 71.6KW.To satisfy this demand 52%, 35% and 13% is to be contributed from wind/hydro/solar respectively. To use the power economically fuzzy logic controller is used. The controller monitors the demand and the available sources and then switches to the appropriate power supply according to the written rules. Simulations have been carried out to verify the system dynamic performance using a practical load profile and weather data. The result shows that the overall power management strategy is effective and the load demand is balanced. To complete this work, a grid extension from the closest substation has been compared with hybrid system. Cost of the grid extension is estimated based on the data obtained from EEP office. This is done in order to compare the cost of the designed hybrid power system against the cost of grid extension. The result shows that breakeven grid extension distance to be 23.9km which indicates that grid extension is preferable.

The dynamic behaviour of a machine tool (MT) directly influences the machining performances. The adoption of lightweight structures may reduce the effects of undesired vibrations and increasing the workpiece quality. This paper aims to present and compare a set of hybrid materials that may be excellent candidate to fabricate the MT moving parts. The selected materials have high dynamic characteristics and capacity to damp mechanical vibrations. In this way, starting by the kinematic model of a milling machine that highlights the main critical factors, this study paper evaluates a number of prototypes made of Al Foam sandwiches (AFS), Al Corrugated sandwiches (ACS) and materials reinforced by carbon fibres (CFRP). A set of prototypes has been fabricated, represented the Z-axis ram of a commercial milling machine. The static and dynamical properties have been evaluated by using both FE simulations and experimental tests. The obtained results show that the proposed structures may be a valid alternative to the conventional materials of MT moving parts, increasing machining performances. In particular, the AFS prototype highlighted a damping coefficient that is 20 times greater than a conventional ram (e.g. steel). The CFRP structure is able to satisfy the machining requirements with a reduced weight of 48.5%, while the ACS prototype showed a good trade-off between stiffness and damping.

Ti and its alloys are the most commonly used materials for biomedical applications. However, bacterial infection after implant placement is still one of the significant rising complications. Therefore, the application of the antimicrobial agents into implant surfaces to prevent implant-associated infection has attracted lots of attention. Scientific papers have shown that inorganic antibacterial metal element (e.g. Ag, Cu, Zn) can be introduced to implant surfaces with the addition of metal nanoparticles or metallic compounds into electrolyte via micro-arc oxidation (MAO) technology. In this review, the effects of the composition and concentration of electrolyte and process parameters (e.g. voltage, current density, oxidation time) on morphological characteristics (e.g. surface morphology, bonding strength), antibacterial ability and biocompatibility of MAO antimicrobial coating were discussed in detail. Anti-infection and osseo-integration can be simultaneously accomplished with the selection of the proper antibacterial elements and operating parameters. Besides, MAO assisted by magnetron sputtering (MS) to endow Ti-based implant materials with superior antibacterial ability and biocompatibility was also discussed. Finally, the development trend of MAO technology in the future was forecasted.

The consistently positive Australian economic environment and stable population increase have led to a higher demand for new houses in recent years. Prefabrication is a promising method to help alleviate the issues related to housing shortage and affordability due to reduced material wastage, construction delays due to weather conditions, unexpected costs, shortage in labour and onsite risks. With the advancements in automation and manufacturing methods such as Design for Manufacturing and Assembly (DfMA), the quality and precision of prefabricated materials is tightly controlled, and the fabrication and assembly period are reduced. However, the full potential of prefabricated construction is yet to be realised in part due to most of developments being focused on its superstructure. A review of the current available options suitable for houses is necessary to understand the present state of the residential footing industry, which will help evaluate the necessary innovations for the growth of the Australian construction industry considering the local reactive soil conditions. This paper presents a summary of existing footing systems and potential prefabricated footing solutions for low-rise residential structures with one storey to two storeys. This paper also reviews the benefits and challenges of designing, manufacturing, transporting, handling and installing of prefabricated footings on site, which have great influence on the acceptance of these innovative footing systems.

Lightweight composite sandwich structures are laminated composite structures that are composed of thin stiff face sheets bonded to a thicker lightweight core in between. These structures have high potential to be used in marine, aerospace, defense and civil engineering applications due to their high strength to weight ratios and energy absorption capacity.In this study, composite sandwich structures were developed with carbon fiber reinforced polymer composite face sheets and aluminum honeycomb core materials with various thicknesses. Carbon fiber/epoxy composite face sheets were fabricated with lamination of [0/90]_s carbon fabrics by vacuum infusion technique. Al honeycomb layers were sandwiched together with the face sheets using a thermosetting adhesive. Mechanical tests were carried out to determine the mechanical behavior of face sheets, Al cores and the composite structure. Effect of core thickness on the mechanical properties of the sandwich was investigated.

Aeromagnetic data coupled with Landsat ETM+ data and SRTM DEM have been processed in order to map regional hydrogeological structures in the basement complex region of Paiko, north-central Nigeria. Lineaments were extracted from derivative maps from aeromagnetic, Landsat ETM+ and SRTM DEM datasets. Ground geophysical investigation utilizing Radial Vertical Electrical Sounding (RVES) was established in nine transects comprising of four sounding stations which are oriented in three azimuths. Source Parameter Imaging (SPI) was employed to map the average depths structures from aeromagnetic dataset. Selected thematic layers which included lineaments density, lithologic, slope, drainage density and geomorphologic maps were integrated and modelled using ArcGIS to generate groundwater potential map of the area. Groundwater zones were classified into four categories: very good, good, moderate and poor according to their potential to yield sustainable water to drilled wells. Results from RVES survey reveal a close correlation to lineaments delineated from surface structural mapping and remotely sensed datasets. Hydrogeological significance of these orientations suggest that aeromagnetic data can be used to map relatively deep-seated fractures which are likely to be open groundwater conduits while remotely sensed lineaments and orientations delineated from the RVES survey may indicate areas of recharge. Regions with high lineament density have relatively better groundwater potential. This is attributable to areas having deep weathering profiles associated with intrusive bodies that have resulted in intense fracturing in the area. Drill depths in this area should target a minimum of 80 m to ensure sufficient and sustainable supplies to drilled wells. The outcome of this study should act as information framework that would guide the siting of productive water wells and while providing needed information for relevant agencies in need of data for the development of groundwater resources.

The ability to detect the presence as well as classify the activities of individuals behind visually obscuring structures is of significant benefit to police, security and emergency services in many situations. This paper presents the analysis from a series of experimental results generated using a through-the-wall (TTW) Frequency Modulated Continuous Wave (FMCW) C-Band radar system named Soprano. The objective of this analysis was to classify whether an individual was carrying an item in both hands or not using micro-Doppler information from a FMCW sensor. The radar was deployed at a standoff distance, of approximately 0.5 m, outside a residential building and used to detect multiple people walking within a room. Through the application of digital filtering, it was shown that significant suppression of the primary wall reflection is possible, significantly enhancing the target signal to clutter ratio. Singular Value Decomposition (SVD) signal processing techniques were then applied to the micro-Doppler signatures from different individuals. Features from the SVD information have been used to classify whether the person was carrying an item or walking free handed. Excellent performance of the classifier was achieved in this challenging scenario with accuracies up to 94%, suggesting that future through wall radar sensors may have the ability to reliably recognize many different types of activities in TTW scenarios using these techniques.

Because this issue journal is dedicated to Gelatin here we present a few applications of gelatin in the field of optics. It is understood that optics is the science that studies the production, propagation, interaction and detection of light. Regarding the detection there are some materials sensitive to light (photosensitive) that are used like photomultipliers, CCD’s, crystals, two dimension (2D) materials and more. Among the 2D materials the most popular through several centuries has been gelatin based photographic emulsion that records spatial distributions of light. More recently (1970) films made of Gelatin with Dichromate (DCG) and dyes have been used. We describe some characteristics and applications of these two photosensitive materials. Also we describe examples where gelatin is used as Relative Humidity (RH) sensor and in the fabrication of optical elements based on gelatin. This article is intended to researchers outside the optics community.

In this paper, we scrutinize the axiomatic system of effect algebras which is given by D. J. Foulis and M.K. Bennett in the paper Effect Algebras and Unsharp Quantum Logics. We prove that this axiomatic system consists of independent axioms. To do this, we construct some models to indicate the indepence of each axiom. Therefore none of these axioms can be reduced when constructing any effect algebra. As a result, any algebra is an effect algebra if and only if it verifies (E1)-(E4) axioms.

The Internet-of-Things (IoT) enables enterprises to obtain profits from data but triggers data protection questions and new types of cyber risk. Cyber risk regulations for the IoT however do not exist. The IoT risk is not included in the cyber security assessment standards, hence, often not visible to cyber security experts. This is concerning, because companies integrating IoT devices and services need to perform a self-assessment of its IoT cyber security posture. The outcome of such self-assessment needs to define a current and target state, prior to creating a transformation roadmap outlining tasks to achieve the stated target state. In this article, a comparative empirical analysis is performed of multiple cyber risk assessment approaches, to define a high-level potential target state for company integrating IoT devices and/or services. Defining a high-level potential target state represent is followed by a high-level transformation roadmap, describing how company can achieve their target state, based on their current state. The transformation roadmap is used to adapt IoT risk impact assessment with a Goal-Oriented Approach and the Internet of Things Micro Mart model.

We introduce optically clear and resilient free-form micro-optical of pure (non-photosensitized) organic-inorganic SZ2080 material made by femtosecond 3D laser lithography (3DLL). This is advantageous for rapid printing of 3D micro-/nanooptics, including their integration directly onto optical fibers. A systematic study on the fabrication peculiarities and quality of resultant structures is performed. Comparison of microlenses’ resiliency to CW and femtosecond pulsed exposure is determined. Experimental results prove that pure SZ2080 is ∼3 fold more resistant to high irradiance as compared with a standard photo-sensitized material and can sustain up to 1.91 GW/cm² intensity. 3DLL is a promising manufacturing approach for high-intensity micro-optics for emerging fields in astro-photonics and atto-second pulse generation. Additionally, pyrolysis is employed to shrink structures up to 40% by removing organic SZ2080 constituents. This opens a promising route towards downscaling photonic lattices and creation of mechanically robust glass-ceramic structures.

In this article, we first present and discuss eighteenth-century descriptions of minerals that contributed decisively to the development of crystallography. Remarkably, these old crystallographic descriptions included morphologies with symmetries incompatible with an internal periodic order of atoms, which, however, have been recognised to be characteristics of quasicrystals. Moreover, we also review a number of studies of minerals with aperiodic crystal structures, including recently reported natural quasicrystals of extra-terrestrial origin. Finally, we discuss the current investigations addressing the search for new quasicrystalline minerals in nature.

This article develops algorithms for the characterization and the visualization of micro-scale features by using a small number of sample points, and with a goal to mitigate for the measurement shortcomings which are often destructive or time consuming. We implement the algorithms to rapidly examine the microscopic features of a Microelectromechanical System (MEMS) surface. Such images are highly dense; therefore, traditional image processing techniques might be computationally expensive. The contribution of this research include first, we develop local and global algorithm based on modified Thin Plate Spline (TPS) model to reconstruct high resolution images of the micro-surface’s topography, and its derivatives by using low resolution images. Second, we obtain a bending energy algorithm from our modified TPS model, and use it to filter out image defects. Finally, we develop a computationally efficient Windowing technique, which combines TPS and Linear Sequential Estimation (LSE), to enhance the visualization of images. The Windowing technique allows rapid image reconstruction based on the reduction of inverse problem.

Parts of shotgun cartridges are a significant source of plastic litter in the marine environment. Empty cartridge shells may not be picked up by the hunter who fired them, and plastic wads that serve to separate the propellant from the shot load, are lost down-range when a shot is fired. Such litter items constitute a cosmetic and aesthetic problem on coastlines and may cause harm to marine animals and in the later stages of decomposition break down into harmful micro plastic particles. There exists no reliable estimate of the global exposure of marine ecosystems to this plastic source. However, in some countries it has been subject to closer examination, including for example, Denmark where the annual contribution of plastic wads into marine systems was estimated to 600,000 pieces (c2 tonnes), and the accumulated density of washed-up items (both wads and shells) was 3.7 items per 100 m coastline. Increasing awareness of this problem has caused scientists, hunters’ communities and governments to suggest altered practice including transition to the use of biodegradable cartridge components, first and foremost wads as this item is invariable lost during hunting. Several manufacturers provide shotgun cartridges containing biodegradable wads based on different types of materials, including fibers and various types of plastics, for example PVAL (poly(vinyl alcohol)) and PHA (polyhydroxyalkanoate). In this paper, we review the most recent literature on the amounts and related environmental hazards of plastic dispersed from hunting ammunition into marine ecosystems. We summarize the market availability of shotgun cartridges with biodegradable wads and discuss chemical, technical, economical and legal aspects of a transition to the use of such products.

In this study, the on-going research into the improvement of micro-gas turbine propulsion system performance and the suitability for application as propulsion systems for small tactical UAVs (<600 kg) is investigated. The study is focused around the concept of converting existing micro turbojet engines to turbofan with the use of a continuously variable gearbox, thus maintaining a single spool configuration and relative design simplicity. This is an effort to reduce the initial engine development cost, whilst improving propulsive performance. The BMT 120 KS micro turbojet engine is selected for performance evaluation of the conversion process using gas turbine performance software, GasTurb13. The preliminary design of a matched low-pressure compressor (LPC) for the proposed engine is then performed using meanline calculation methods. According to the analysis carried out, an improvement in the converted micro gas turbine engine performance in terms of thrust and specific fuel consumption is achieved. Furthermore, with the introduction of a CVT gearbox, fan speed operation may be adjusted independently of the core, allowing increased thrust generation or better fuel consumption. Therefore, enabling a wider gamut of operating conditions and enhances the performance and scope of tactical UAV.

A multiscale model that enables quantitative understanding and prediction of the size effect on scattering properties of micro- and nanostructures is crucial for the design of LED surface textures optimized for high light extraction efficiency (LEE). In this paper, a hybrid process for combining full-wave finite-difference time-domain simulation and a ray-tracing technique based on a bidirectional scattering distribution function model is proposed. We apply this method to study the influence of different pattern sizes of a patterned sapphire substrate on GaN-based LED light extraction from the microscale to the nanoscale. The results show that near-wavelength–scaled patterns with strong diffraction are not expected to enhance LEE. By contrast, microscaled patterns with optical diffusion behavior have the highest LEE at a specific aspect ratio, and subwavelength-scaled patterns that have antireflection properties show marked enhancement of LEE for a wide range of aspect ratios.

Due to the increase in the emission of greenhouse gases, the hydrologic cycle is being altered on the daily basis. This has affected the variations in relations of intensity, duration, and frequency of rainfall events. Intensity Duration Frequency (IDF) curves describe the relationship between rainfall intensity, rainfall duration and return period. IDF curves are one of the most often applied implements in water resource engineering, in areas such as for operating, planning and designing of water resource projects, or for numerous engineering projects aimed at controlling floods. In particular, IDF curves for precipitation answer problems of improper drainage systems or conditions and extreme characters of precipitation which are the main cause of floods in Nyabugogo catchment. This study aims to establish Rainfall IDF empirical equations, curves and hydrological discharge (predicted peak rate of runoff (Qlogy)) equations for eight Districts that will be used for designing an appropriate and sustainable hydraulic structures for controlling flood to reduce potential loss of human and aquatic life, degradation of water, air and soil quality and property damage and economic lessen caused by flood in Nyabugogo catchment. However Goodness of Fit tests revealed that Gumbel’s Extreme-Value Distribution method appears to have the most appropriate fit compared with Pearson type III distribution for validating the Intensity-Duration-Frequency curves and equations through the use of daily annual for each meteorological station. The findings of the study show that the intensity of rainfall increases with a decrease in rainfall duration. Additionally, a rainfall of every known duration will have a higher intensity if its return period is high, while the predicted peak rate of runoff (Qlogy) increases also with an increase in the intensity of rainfall.

The Internet-of-Things (IoT) triggers new types of cyber risks. Therefore, the integration of new IoT devices and services requires a self-assessment of IoT cyber security posture. By security posture this article refers to the cybersecurity strength of an organisation to predict, prevent and respond to cyberthreats. At present, there is a gap in the state-of-the-art, because there are no self-assessment methods for quantifying IoT cyber risk posture. To address this gap, an empirical analysis is performed of 12 cyber risk assessment approaches. The results and the main findings from the analysis is presented as the current and a target risk state for IoT systems, followed by conclusions and recommendations on a transformation roadmap, describing how IoT systems can achieve the target state with a new goal-oriented dependency model. By target state, we refer to the cyber security target that matches the generic security requirements of an organisation. The research paper studies and adapts four alternatives for IoT risk assessment and identifies the goal-oriented dependency modelling as a dominant approach among the risk assessment models studied. The new goal-oriented dependency model in this article enables the assessment of uncontrollable risk states in complex IoT systems and can be used for a quantitative self-assessment of IoT cyber risk posture.

The main objective of this communication is to describe the ‘Global Salt Cycle’. Giant salt accumulations are commonly found along continental margins of former rifts. The first stage in the accumulation process is saturation of newly formed oceanic crust with seawater. Final mobilisation and accumulation of the salts occurs during rifting, localised in the vicinity of relict subduction zones. Oceanic crust is created along the spreading ridges in the deep oceans of the Earth. It exchanges mass and energy with seawater in hydrothermal circulation cells that penetrate deep into the new and fractured crust. Water-rock interactions include the formation of hydrated and hydroxylated minerals, e.g., serpentinites and clay minerals. By incorporating hydroxyl groups and water in their crystal lattices, the salinity of remaining brines increases. Subduction of oceanic crust and serpentinised lithosphere transports water, hydrated minerals, and marine salts deep into the crust and mantle. Upon pressurisation and heating of the subducting slab, different parts of this water are expelled at different depths/temperatures. The resulting fluids will contain salts brought in with the slab, as well as new salts formed by water-rock interaction. The combination of elevated pressures and temperatures, water, salinity, and CO2, create permeability in the normally impermeable, peridotitic mantle, by altering the fluid-rock dihedral angles of mineral grains. This P/T-determined intergranular permeability allows ascent of saline fluids, under lithostatic pressure, within the mantle wedge, or the slab itself. The fluids produce a mechanically weakened and buoyant zone within the mantle wedge due to high pore pressure between mineral grains and reduced mantle density. During the lifetime of a subduction zone, a substantial accumulation of saline fluids within the mantle wedge and crust, is evident. Deep, fluid reservoirs accumulate between the subduction trench and the volcanic front. They may exist for hundreds of millions of years, even after the extinction of the subduction zone. Saline fluids may escape to the surface along deep faults, due to overfilling of available pores/fractures. Fluids within the mantle wedge may form rock melts or exist as supercritical, mineral rich fluids. The combination of reduced pressure due to rifting, and a saline and buoyant mantle, creates a mantle circulation that brings the accumulated, saline fluids, to crustal levels. Salts will therefore accumulate during initial stages of rifting as a result of massive fluid expulsion, phase change and boiling of mantle fluids. No extra energy is required to produce phase change and boiling. The result is formation of solid salts or dense brines/slurries invading fractured crustal rocks, or escaping to the surface/seabed. This process may take place both before and after the sea has invaded a continental rift.

Research shows that in earthquakes the ground response changes in areas where there are underground cavities. Due to the fact that subways and underground tunnels pass from beneath buildings in urban areas, these changes in ground response have a direct impact on the seismic behavior of structures. In this study, first by model validity and reliability of the results, steel structures modeling was conducted and steel structure behavior was evaluated due to Tunnel-Soil-Structure seismic interaction. Parameters studied are number of stories, soil type, tunnel depth, horizontal tunnel-structural distance and dynamic loading. Considering that one of the most important parameters of structural control is drift and story displacement, so this important factor will be considered. The results show that tunneling has a direct effect on the rate of structural displacement and increases the structural response. Also, the behavior of the structure is affected by the position of the structure at the ground level and the position of the tunnel and this should be considered during the design phase of the structures.

Stenting is an alternative to endarterectomy for the treatment of carotid artery stenosis. However, stenting is associated with a higher risk of procedural stroke secondary to distal thromboembolism. Hybrid stents with a micromesh layer have been proposed to address this complication. We developed a micropatterned thin film nitinol (M-TFN) covered stent designed to prevent thromboembolism during carotid intervention. This innovation may obviate the need or work synergistically with embolic protection devices. The proposed double layered stent is low-profile, thromboresistant, and covered with a M-TFN that can be fabricated with fenestrations of varying geometries and sizes. The M-TFN was created in multiple geometries, dimensions, and porosities by sputter deposition. The efficiency of various M-TFN to capture embolic particles was evaluated in different atherosclerotic carotid stenotic conditions through in vitro tests. The covered stent prevented emboli dislodgement in the range of 70-96% during 30min duration tests. In vitro vascular cell growth study results showed that endothelial cell elongation, alignment and growth behaviour silhouettes significantly enhance specifically on the diamond-shape M-TFN with the dimensions of 145µm×20µm and a porosity of 32%. Future studies will require in-vivo testing. Our results demonstrate that M-TFN has a promising potential for carotid artery stenting.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Since the 21st century, China's urbanization process has been rapid development, the concept and function of urban public space in the city has been gradually paid attention to. In order to guarantee life and water, most urban construction relies on rivers, and Bridges are the most important way to communicate between urban areas. The main functional part of the bridge is the span structure, that is, the bearing structure of the bridge, and the lower part of the "gray" space formed by the bridge structure. Considering the social level, with the economic growth and urbanization development, people have brought a better living environment and quality of life, and also improved the requirements for urban public environment. In the increasingly tense urban space, how to use and transform the space under the bridge is a problem that needs to be considered and solved. In view of this problem, in this study, we try to solve the micro-transformation of space under Bridges in cities through public art from the perspective of "regional culture" and "art for all". This paper analyzes the micro-transformation of space art under Bridges in two large cities of Shanghai and Foshan, namely, the space under Bridges under Songhong Road in Shanghai, the space under Bridges under Central Of Suzhou River and the space under Bridges under Pingsheng Bridge in Foshan. This paper discusses the cultural intervention of "regional culture" in the micro-transformation of the space under the bridge, and the influence and effect of "art for all" on the public art space under the bridge after the transformation to the community and the public.

Modern day construction is widely influenced using concrete-steel composite columns. A lot of research on concrete-steel composite columns is being carried out around the world. The rapid growth in concrete-steel composite construction has widely decreased the use of conventional reinforced cement concrete construction (R.C.C), and the steel construction practices. The concrete-steel composite construction has obtained an extensive receiving around the globe. As Pakistan is a developing country, so, it is relatively a new concept for its construction industry when compared with the developed countries around the globe. Although, the R.C.C construction is suitable and economical for construction of framing systems of low-rise buildings, however, the increased dead load, span restrictions, less stiffness and risky formwork makes it uneconomical and unviable when it comes across the construction of intermediate to high-rise buildings. This research is an effort to learn the cost effectiveness, increased or decreased stiffness, and change on the functionality of the composite construction for intermediate to high-rise buildings constructed in Pakistan. A Base + Ground + 11 storey commercial building is selected for this study. A comparison is made between conventional R.C.C columns structure and concrete-encased composite columns structure. The equivalent static nonlinear analysis is performed using ETABS 2017 software. Although, for Base + Ground + 11 storey building, the construction cost of concrete-encased composite structure is 7.7% more than the conventional R.C.C columns structure, but the concrete-encased composite structure will have 13.013% more constructed floor area. This increased floor area helps to settle the cost difference between the two structures.

Continuous in-home monitoring of older adults living alone aims to improve their quality of life and independence, by detecting early signs of illness and functional decline or emergency conditions. To meet requirements for technology acceptance by seniors (unobtrusiveness, non-intrusiveness, privacy-preservation), this study presents and discusses a new smart sensor system for the detection of abnormalities during daily activities, based on ultra-wideband radar providing rich, not privacy-sensitive, information useful for sensing both cardiorespiratory and body movements, regardless of ambient lighting conditions and physical obstructions (through-wall sensing). The radar sensing is a very promising technology, enabling the measurement of vital signs and body movements at a distance, and thus meeting both requirements of unobtrusiveness and accuracy. In particular, impulse-radio ultra-wideband radar has attracted considerable attention in recent years thanks to many properties that make it useful for assisted living purposes. The proposed sensing system, evaluated in meaningful assisted living scenarios by involving 30 participants, exhibited the ability to detect vital signs, to discriminate among dangerous situations and activities of daily living, and to accommodate individual physical characteristics and habits. The reported results show that vital signs can be detected also while carrying out daily activities or after a fall event (post-fall phase), with accuracy varying according to the level of movements, reaching up to 95% and 91% in detecting respiration and heart rates, respectively. Similarly, good results were achieved in fall detection by using the micro-motion signature and unsupervised learning, with sensitivity and specificity greater than 97% and 90%, respectively.

A critical discussion on the computation of the dispersion diagram in periodic one-dimensional guiding structures is carried out. In particular, an analysis is presented of the pros and cons of combined methods that make use of full-wave simulations done with commercial software packages with further analytical post-processing based on simplifications brought by an equivalent circuit model of the structure. Some of the most common methods reported in the literature are reviewed and their advantanges and limitations highlighted. Our discussion is complemented with several selected numerical examples in order to discuss the most relevant aspects that a potential user of these methods should be aware of. Special attention is paid to the relevant role played by the high-order coupling between the two halves of a symmetric unit cell of the periodic structure.

The Grand Ethiopian Renaissance Dam (GERD), formerly known as the Millennium Dam, is currently under construction and has been filling at a fast rate without sufficient known analysis on possible impacts on the body of the structure. The filling of GERD not only has an impact on the Blue Nile Basin hydrology, water storages and flow but also pose massive risks in case of collapse. Rosaries Dam located in Sudan at only 116 km downstream of GERD, along with the 20 million Sudanese benefiting from that dam, would be seriously threatened in case of the collapse of GERD. In this study, through the analysis of Sentinal-1 satellite imagery we show concerning deformation patterns associated with different sections of the GERD’s Main Dam (structure RCC Dam type) and the Saddle Dam (Embankment Dam type). We processed 109 descending mode scenes from Sentinel-1 SAR imagery, from December 2016 to July 2021, using the Differential Synthetic Aperture Radar Interferometry technique to demonstrate the deformation trends of both - the GERD’s Main and Saddle Dams. The time-series generated from the analysis clearly indicates different displacement trends at various sections of the GERD as well as the Saddle Dam. Results of the multi temporal data analysis on and around the project area show inconsistent subsidence at the extremities of the GERD Main Dam, especially the west side of the dam where we recorded varying displacements in the range of 10 mm to 90 mm at the crest of the dam. We conducted the current analysis after masking the images with a coherence value of 0.9 and hence, the subsequent results are extremely reliable and accurate. Further decomposition of the subsiding rate has revealed higher vertical displacement over the west side of the GERD’s Main Dam as compared to the east side. The local geological structures consisting of weak zones under the GERD’s accompanying Saddle Dam adds further instability to its structure. We identified seven critical nodes on the Saddle Dam that match the tectonic faults lying underneath it, and which display a varying degree of vertical displacements. In fact, the nodes located next to each other displayed varying displacement trends: one or more nodes displayed subsidence since 2017 while the other node in the same section displayed uplift. The geological weak zones underneath and the weight of the Saddle Dam itself may somewhat explain this inconsistency and the non-uniform vertical displacements. For the most affected cells, we observed a total displacement value of ~90 mm during the whole study period (~20 mm/year) for the Main Dam while the value of the total displacement for the Saddle dam is ~380 mm during the same period (~85 mm/year). Analysis through CoastSat tool also suggested a non-uniformity in trends of surface water-edge at the two extremities of the Main Dam.

Various natural disasters such as floods, fires, earthquakes, etc. have affected human life. Detection and classification of large and small earthquakes caused by natural or abnormal events have been always important to Earth scientist. One of the most important research challenges in this field is the lack of an effective method for identifying and categorizing various types of seismic events at less important and important levels. Based on latest achievements of Data Mining international institutions such as Rexer-KDnugget-Gartner and also newest authentic articles, SVM, KNN, C4.5, MLP are from most important and popular and leading classifiers in data world.Therefor in present study, a boost learning system consisting support vector machine algorithms with linear regression, MLP Neural Network ، C4.5 decision tree and KNN near neighborhood have been utilized in a combined form to detect and categorize micro seismic events. In general, the steps involved in the proposed method are: 1) performing artificial seismic tests, 2) data gathering and analysis, 3) conducting preprocessing and separating training and testing samples, 4) generating relevant models with training samples and detecting and categorizing test samples and 5) extracting a cluster with the maximum candidate using boost learning. After simulations, it was observed that the accuracy of proposed boost method to the best answer was about 6.1% higher compare to other methods and the error rate was 0.082% of recalling. Accuracy of detection and classification to the best answer were also improved compare to other methods up to 2.31% and 6.34%, respectively.

A finite-difference approach with non-uniform meshes was presented for simulating magnetotelluric responses in 2D structures. We presented the formulation of this scheme and gave some sights into its successful implementation, and compared finite-difference solution with known numerical results and simple analytical solutions. First, a homogeneous half-space model was tested and the finite-difference approach can provide very good accuracy for 2D magnetotelluric modeling. Then we compared to the analytical solutions for the two-layered model, the relative errors of the apparent resistivity and the impedance phase were both increased when the frequency was increased. In the end, we compare our finite-difference simulation results with COMMEMI 2D-0 model with the finite-element solutions. Both results are in close agreement to each other. These comparisons confirm the validity and reliability of our finite-difference algorithm.

Social recommendation is almost as the integration of the business platform and social platform, and gradually become a top in recommendation system. Social recommendation algorithm solves the problem of cold start and data sparseness for traditional commodity, while the internal structure of the relationship graph in social relations has not been fully excavated. This paper proposes two models of Micro Relation Transfer Model and Macro Relation Transfer Model of social relations, and applies the social relations transfer models into the social recommendation system. A relationship graph is built from the relationship between customers on the Internet. Micro Relation Transfer Model establishes the transfer activation function by calculating the relationship between the two customers using the similarity of interests set. Micro Relation Transfer Model spreads the relationship of friends by calculating the proportion of common neighbors held by the customer's social relations. In order to effectively control the transmission range and effect of social relations graph, we introduce pruning algorithm based on Monte Carlo Decision Tree convergence algorithm. The experimental results show that SRRTC algorithm enhances the success rate and stability significantly.

Nine variants of regular lattice structures with different relative densities have been designed and successfully manufactured. The produced structures have been subjected to geometrical quality control, and the manufacturability of the implemented selective laser melting SLM technique has been assessed. It was found that the dimensions of the produced lattice struts differ from those of the designed struts. These deviations depend on the direction of geometrical evaluation. Additionally, the microstructures and phase compositions of the obtained structures were characterized and compared with those of conventionally produced 316L stainless steel. The microstructure analysis and X-Ray Diffraction XRD patterns revealed a single austenite phase in the SLM samples. Both a certain broadening and a displacement of the austenite peaks were observed due to residual stresses and a crystallographic texture induced by the SLM process. Furthermore, the mechanical behavior of the lattice structure material has been defined. It was demonstrated that under both quasi-static and dynamic testing, lattice structures with high relative densities are stretch-dominated, whereas those with low relative densities are bending-dominated. Moreover, the linear relationship between the energy absorption and relative density under dynamic loading conditions has been defined

The effects of the surface waves generated by the wind have a significant effect on the currents. A wave current coupled model plays an important role in the design of offshore structures. The interaction between fluids such as incompressible ocean waves and current and offshore structures is significant with many real-time applications in offshore engineering. These coupled models can be applied to Offshore Floating Production Operating and offloading (FPSO), Wind or current turbines and offshore pipelines. The complex issues related to the design are analyzed by using Computational Fluid Dynamics, which requires an investigation of the multiphase flow between wave and current and the structure which is considered restrictive due to the computational cost. If viscous effects are neglected then the single-phase flow models have been recommended, where wave-current interaction have been modelled successfully. Models have been developed where velocities and pressure are computed and the results can be verified with the experimental results available in the literature. In this study the existing numerical methods, mesh types are discussed along with their coupling methods. Here single-phase and multiphase models with small and medium movement are reviewed and their applications are highlighted.

In laser joining of copper (Cu) and aluminum (Al) sheets, the Al sheet is widely chosen as the top surface for laser irradiation because of increased absorption of laser beam and lower melting temperature of Al in contrast to Cu. This research focus on welding from Cu side to Al sheet. The main objective of irradiating the laser beam from the copper side (Cu on top) is to exploit higher solubility of Al in Cu. A significantly lower laser power can be used with 515 nm laser in comparison to 1030 nm. In addition to low laser power, a stable welding is obtained with 515 nm. Because of this advantage, 515 nm is selected for the current research. By fusion of Cu and Al the two sheet metals are welded, with presence of beneficial Cu solid solution phase and Al+Al2Cu in the joint with the brittle phases intermixed between the ductile phase. Therefore the mixed composition strengthens the joint. However excessive mixing leads to formation of more detrimental phases and less ductile phases. Therefore optimum mixing must be maintained. Energy dispersive X-ray spectroscopy (EDS) analysis indicate that large amount of beneficial Cu solid solution and Al rich phases is formed in the strong joint. From the tensile shear test for a strong joint, fracture is obtained on the heat-affected zone (HAZ) of Al. Therefore the key for welding from copper side is to have optimum melt with beneficial phases like Cu and Al+ Al2Cu and the detrimental phases intermixed between the ductile phases

Metal and alloy toughening was the core and long-term research direction in materials filed. As grain size had bimodal distribution, micro/nano-structured alloys presented excellent comprehensive mechanical properties, and this had become one of the research hotspots and developing trends in the field of nanotechnology. In-situ tensile test was a direct and effective method to study the deformation mechanism of materials, which revealed the multiple mechanisms responding to feature grain sizes and provided reliable experimental means and research technique. Research on development of in-situ technique and its applications in mechanical properties was reviewed in this paper according to the recent advances on the modern mechanical properties for high strength and high plasticity alloy at home and abroad. The disadvantages of the present study of preparation methods and investigation techniques for high-performance alloy had been concluded. Finally, the development prospects of high strength and high plasticity alloy materials were analyzed.

The oil and gas sector has recognised structural integrity assessment of ageing platform for prospective life extension as a rising concern, particularly in encountering the randomness of the harsh ocean environments. This condition leads to uncertainty in wave-in-deck load estimates and a high load level being imposed on offshore structures. This emphasises the necessity of enhanced reliability, as failure might result in inaccessibility because of the uncertainties related to long-distance services, such as accuracy of predictions of loads and responses. Even though the established guidelines present a fundamental assessment, additionally, comprehensive rules are required. This paper performed a reliability analysis incorporating practical approaches that can more accurately represent time-dependent structural deterioration. The following two procedures have been adopted by a majority of significant oil and gas operators to monitor the safety and integrity of these structures: a) Ultimate Strength Assessment (USA) method and b) Reliability Design Assessment (ReDA) method. A comparison of these two reliability approaches was performed on selected ageing jacket structures in the region of the Malaysian sea. The comparative findings, namely, reserve strength ratio (RSR) at various years of the return period (RP) and ratio value for risk of failure regarding the probability of failure (POF), provided a check and balance in strengthening confidence in the results. The findings showed that the structural components might safely survive either using the USA and ReDA method in such conditions, as the reliability indexes were determined to be satisfactory compared to allowable values from ISO 19902 design specifications. Therefore, these evaluations were determined to control the risk level of the structure during the remaining of its lifetime and undertake cost-effective inspections or mitigation strategies when necessary.

This study investigated the roles of transactions cost in MSMEs access to finance. This was done by investigating the impact of transactions cost on access to credit from both MSMEs and financial institutions (commercial banks and microfinance banks). From the MSMEs’ side, borrowing experience, decision lag, firm size and borrowers’ distance to the loan office were investigated. On the financial institution’s side, the costs of information gathering, loan administration, monitoring and loan enforcement were investigated. We used the questionnaire survey method, in-depth interviews and case studies, as well as the annual financial statements of the banks. We identified interest rate and collateral value as constraints to access to finance for MSMEs. We also found financial institutions’ attitude to MSMEs access to credit was not friendly. Financial institutions need to do more to bring down transaction cost of lending. This hopefully can be achieved by investing more in agent banking which would lower operating costs, as well as spreading risk, and ultimately increase credit intermediation to small businesses.

Greenwater (splashing of water on the deck) loading is a classical problem faced by the designer of ship-shaped vessels, which becomes even worst when the vessel operates at harsh weather conditions for an extended period. Installation of breakwaters on the deck can play a crucial role in minimizing this impact. However, research on the design and optimization of the breakwater is still at its infancy, and this study aims at shedding further light on this area by proposing and analyzing the effectiveness of three breakwater designs on a fixed box-shaped vessel. Commercial CFD software is used for this investigation. However, the design model (without breakwater) was validated at first against experimental results of green water splashing, before performing the actual simulations with proposed breakwater design. A vertical plate is used as the deck structure, and greenwater pressure at several locations on that plate is measured to compare the effectiveness of various breakwater designs. Overall, breakwaters with openings (perforations, grillages etc.) found to be more effective in minimizing the pressure generated by the greenwater. Nevertheless, there are significant rooms for improvement on breakwater designs, and some topics for further research are also suggested in this regard.

A copula is a useful tool for constructing bivariate and/or multivariate distributions. In this article, we consider a new modified class of (Farlie-Gumbel-Morgenstern) FGM bivariate copula for constructing several dierent bivariate Kumaraswamy type copulas and discuss their structural properties, including dependence structures. It is established that construction of bivariate distributions by this method allows for greater flexibility in the values of Spearman's correlation coefficient rho,  and Kendall's tau . For illustrative purposes, one representative data set is utilized to exhibit the applicability of these proposed bivariate copula models.

In this work modeling and analysis of an integrated opto-fluidic sensor, with a focus on achievement of single mode optical confinement and continuous flow of micro particles in the microfluidic channel for Lab-on-a Chip (LOC) sensing application is presented. This sensor consists of integrated optical waveguides, microfluidic channel among other integrated optical components. A continuous flow of micro particles in a narrow fluidic channel is achieved by maintaining the two sealed chambers at different temperatures and by maintaining a constant pressure of 1Pa at the centroid of narrow fluidic channel geometry. The analysis of silicon on insulator (SOI) integrated optical waveguide at an infrared wavelength of 1550nm for single mode sensing operation is presented. The optical loss is found to be 0.0005719dB/cm with an effective index of 2.2963. The model presented in this work can be effectively used to detect the nature of micro particles and continuous monitoring of pathological parameters for sensing applications.

Abstract: Microstructural and mechanical properties of the eutectic Sn58Bi and micro-alloyed Sn57.6Bi0.4Ag solder alloys were compared. With the addition of Ag micro-alloy, the tensile strength was improved and this is attributed to a combination of microstructure refinement and an Ag3Sn precipitation hardening mechanism. However, ductility is slightly deteriorated due to the brittle nature of the Ag3Sn intermetallic compounds (IMCs). Additionally, a board level reliability study of Ag micro-alloyed Sn58Bi solder joints produced utilising a surface-mount technology (SMT) process, were assessed under accelerated temperature cycling (ATC) conditions. Results reveal that micro-alloyed Sn57.6Bi0.4Ag has a higher characteristic lifetime with a narrower failure distribution. This enhanced reliability corresponds with improved bulk mechanical properties. It is postulated that Ag3Sn IMCs are located at the Sn-Bi phase boundaries and suppress the solder microstructure from coarsening during the temperature cycling, hereby extending the time to failure.

A novel hybrid cobalt phosphite, (H2DAB)[Co(H2PO3)4]·2H2O, has been synthesized by using slow evaporation method, in the presence of cobalt nitrate, phosphorous acid and 1,4- dia-minobutane (DAB= 1,4- diaminobutane) as a structure-directing agent. Single crystal X-ray diffraction analysis showed that the compound crystallizes in the P-1(n.2) triclinic space group, with the following unit cell parameters (Å, °) a = 5.4814 (3), b = 7.5515 (4), c = 10.8548 (6), α = 88.001 (4), β = 88.707 (5), γ = 85.126 (5), and V= 447.33 (4) Å3. The crystal structure was built up from cor-ner-sharing [CoO6] octahedra, forming chains parallel to [001], which are interconnected by H2PO3 pseudo-tetrahedral units. The deprotonated cations, residing between the parallel chains, interacted with the inorganic moiety via hydrogen bonds leading thus to the formation of the 3D crystal structure. The Fourier transform infrared spectrum showed characteristic bands corresponding to the phosphite group and the organic amine. The thermal behavior of the compound consisted mainly of the loss of its organic moiety and the water molecules. The biological tests exhibited significant activity against Candida albicans and Escherichia coli strains in all used concentrations, while less inhibitory activity was pronounced against Staphylococcus epidermidis and Saccharomyces cerevisiae, and in the case of multi-cellular organisms, no activity against the nematode model Steinernema feltiae was detected.

Direct sizing criteria represent useful tools in the design of dissipative bracing systems for the advanced seismic protection of existing frame structures, especially when incorporated dampers feature a markedly non-linear behaviour. An energy-based procedure is proposed herein to this aim, focusing attention on systems including fluid viscous devices. The procedure starts by assuming prefixed reduction factors of the most critical response parameters in current conditions, which are evaluated by means of a conventional elastic finite element analysis. Simple formulas relating the reduction factors to the equivalent viscous damping ratio of the dissipaters, ξ_eq, are proposed. These formulas allow calculating the ξ_eq values that guarantee the achievement of target factors. Finally, the energy dissipation capacity of the devices is deduced from ξ_eq, finalizing their sizing process. A detailed description of the procedure is presented in the article, by distinguishing the cases where the prevailing structural deficiencies are represented by poor strength of the constituting members, from the cases having excessive horizontal displacements. A demonstrative application to the retrofit design of a reinforced concrete gym building is then offered to explicate the steps of the sizing criterion in practice, as well as to evaluate the enhancement of seismic response capacities generated by the installation of the dissipative system.

Extracellular vesicles (EVs) represent a heterogeneous population of small vesicles, consisting of a phospholipidic bilayer surrounding a soluble interior cargo. Almost all cell types release EVs, thus they are naturally present in all body fluids. Among the several potential applications, EVs could be used as drug delivery vehicles in disease treatment, in immune therapy because of their immunomodulatory properties and in regenerative medicine. In addition to general markers, EVs are characterized by the presence of specific biomarkers (proteins, miRNAs) that allow the identification of their cell- or tissue-origin. For these features, they represent a potential powerful diagnostic tool to monitor state and progression of specific diseases. As regards, a large body of studies supports the idea that endothelial derived (EMPs) together with platelet-derived microparticles (PMPs) are deeply involved in the pathogenesis of diseases characterized by micro- and macrovascular damages, including diabetes. Existing literature suggests that the detection of circulating EMPs and PMPs and their specific miRNA profile may represent a very useful non-invasive signature to achieve informations about the onset of peculiar disease manifestations. In this Review, we discuss the possible utility of EVs in the early diagnosis of diabetes-associated microvascular complications, specifically related to kidney.

Establishment of diagnostic methods with low detection limits plays a critical role in the maintenance of early diagnosis, prevention of serious neurological complications, and control of the spread of ZIKA. In this study, we established the micro-droplet digital polymerase chain reaction (ddPCR) and real-time fluorescent quantification PCR (qPCR) protocols for the detection of Zika virus based on the NS5 gene. For the Zika standard plasmid, the standard curve of R² was 0.999, and the amplification efficiency was 92.203%, as determined by qPCR. Both ddPCR and qPCR were positive for cell culture of Zika nucleic acid.The minimum detection limit of ddPCR is 1–2 times lower than qPCR. Moreover, all tests of Dengue virus (1–4 serotypes) were negative in cell culture. Overall, these results suggested than ddPCR may have a lower limit of detection than qPCR.

Natural events such as floods, fires, tsunamis, earthquakes and others have nowadays caused serious damage to human beings and nature. The precise detection of these natural events and especially the earthquake has nowadays become the focus of many computer and geoscientific researchers. Computer science and machine learning algorithms have revolutionized early detection and prediction of these events. Hence, a fuzzy method has been initially used in this article to enhance the authenticity of data based on application of effective variables and then combination of neural network algorithms of the MLP perceptron and radial network of RBF in form of a collective learning system in order to more accurately identify seismic events on a small scale. It was observed after simulating the proposed method that the proposed method has significantly improved based on actual error and root-mean-square error (RMSE) criteria compared to basic methods.

This paper presents a novel micro-segmented genetic algorithm (μsGA) to identify the best solution for the locomotion of a quadruped robot designed on a rectangular ABS plastic platform. We compare our algorithm with three similar algorithms found in the specialized literature: a standard genetic algorithm (GA), a micro-genetic algorithm (μGA), and a micro artificial immune system (μAIS). The quadruped robot prototype guarantees the same conditions for each test. The platform was developed using 3D printing for the structure and can accommodate the mechanisms, sensors, servomechanisms as actuators. It also has an internal battery and a multicore embedded system (mES) to process and control the robot locomotion. This research proposes a μsGA that segments the individual into specific bytes. μGA techniques are applied to each segment to reduce the processing time; the same benefits as the GA are obtained, while the use of a computer and the high computational resources characteristic of the GA are avoided. This is the reason why some research in robot locomotion is limited to simulation. The results show that the performance of μsGA is better than the three other algorithms (GA, μGA and AIS). The processing time was reduced using a mES architecture that enables parallel processing, meaning that the requirements for resources and memory were reduced. This research solves the problem of continuous locomotion of a quadruped robot, and gives a feasible solution with real performance parameters using a μsGA bio-micro algorithm and a mES architecture.

In the paper, the effect of voltage increasing (from 500 VDC up to 650 VDC) on the structure and chemical composition of porous coating on titanium made by Plasma Electrolytic Oxidation, is presented. In the present paper, phosphates based coatings enriched with calcium, magnesium, zinc and copper in electrolyte based on 1 L of 85% concentrated H3PO4 with additions of Ca(NO3)2·4H2O, and Mg(NO3)2∙6H2O, and Zn(NO3)2∙6H2O, and Cu(NO3)2∙3H2O, are described. The morphology, chemical and phase composition, are evaluated using SEM, EDS, XRD, XPS, GDOES. Based on all the analyses, it was found out that the PEO coatings are porous and enriched with calcium, magnesium, zinc and copper. They consist mainly of the amorphous phase, which is more visible for higher voltages, and it is correlated with the increasing of the total PEO coating thickness (the higher the voltage, the thicker the PEO coating). However, for 650 VDC an amorphous phase and titanium substrate was also recorded with a signal from Ti2P2O7 crystalline, that was not observed for lower voltages. It was also found out that all the obtained coatings may be divided in three sub-layers, i.e. porous, semiporous, and transition one.

A problem with synthetic aperture radar (SAR) is that, due to the poor penetrating action of electromagnetic waves inside solid bodies, the capability to observe inside distributed targets is precluded. Under these conditions, imaging action is provided only on the surface of distributed targets. The present work describes an imaging method based on the analysis of micro-movements on the Khnum-Khufu Pyramid, which are usually generated by background seismic waves. The results obtained prove to be very promising, as high-resolution full 3D tomographic imaging of the pyramid's interior and subsurface was achieved. Khnum-Khufu becomes transparent like a crystal when observed in the micro-movement domain. Based on this novelty, we have completely reconstructed internal objects, observing and measuring structures that have never been discovered before. The experimental results are estimated by processing series of SAR images from the second-generation Italian COSMO-SkyMed satellite system, demonstrating the effectiveness of the proposed method.

We consider a multitude of topics in mathematics where unification constructions play an important role: the Yang–Baxter equation and its modified version, Euler’s formula for dual numbers, means and their inequalities, topics in differential geometry, etc. It is interesting to observe that the idea of unification (unity and union) is also present in poetry. Moreover, Euler’s identity is a source of inspiration for the post-modern poets.

Cross-border e-commerce is an opportunity for micro, small and medium sized enterprise (MSMEs) in developing countries. Based on a resource-based approach, this research studied how to support resource lacking enterprises with export marketing strategy. It dealt with actual business cases of Mongolian entrepreneurs trying to export Mongolian products to Korean market. Multiple source data including interviews, internal documents, and group discussions, were matched with theories to come up with strategies and validated by supporting organizations in Mongolia and Korea. The research suggests that MSMEs should rely on third party digital platforms rather than setting up their own. For product strtategy of the marketing mix, sellecting competitive product categories and supporting them adjusting to foreign markets and quality assurance is needed. For price strategy, loccally high priced products should use a price penetration strategy with a lower price compared to competing foreign products. For place strategy, supporting organizations should partner with exporters for collective delivery. For promotion strategy, they need to support the capacity of MSMEs enabling them to use digital marketing tools effectivly. These strategies were validated and adopted by supporting organizations in Monglia and Korea.

In recent years, Web APIs have become a de facto standard for exchanging machine-readable data on the Web. Despite this success though, they often fail in making resource descriptions interoperable due to the fact that they rely on proprietary vocabularies that lack formal semantics. The Linked Data principles similarly seek the massive publication of data on the Web, yet with the specific goal of ensuring semantic interoperability. Given their complementary goals, it is commonly admitted that cross-fertilization could stem from the automatic combination of Linked Data and Web APIs. Towards this goal, in this paper we leverage the micro-service architectural principles to define a SPARQL Micro-Service architecture, aimed at querying Web APIs using SPARQL. A SPARQL micro-service is a lightweight SPARQL endpoint that provides access to a small, resource-centric, virtual graph. In this context, we argue that full SPARQL Query expressiveness can be supported efficiently without jeopardizing servers availability. Furthermore, we demonstrate how this architecture can be used to dynamically assign dereferenceable URIs to Web API resources that do not have URIs beforehand, thus literally ``bringing'' Web APIs into the Web of Data. We believe that the emergence of an ecosystem of SPARQL micro-services published by independent providers would enable Linked Data-based applications to easily glean pieces of data from a wealth of distributed, scalable and reliable services. We describe a working prototype implementation and we finally illustrate the use of SPARQL micro-services in the context of two real-life use cases related to the biodiversity domain, developed in collaboration with the French National Museum of Natural History.

The paper investigates the possible use of a low strength domestic sand (D) (up to today useless – not considered as proppant source) of small particle sizes, instead to that of high strength imported commercial sand (C), as a prospective micro-proppant for low permeability reservoirs in Poland. There is need to develop national unconventional gas resources like tight gas, shale gas and coalbed methane. An important energy source of value and readily available in Poland is coal. The basins of this resource are large and bears low permeability coalbed methane reservoirs which needs to be developed to contribute to the energy security, economy and environmental needs of the country. These reservoirs need technological assistance such as hydraulic fracturing which makes use of proppants for development. Most of the commonly used proppants over the years for fracturing have been large grain size commercial proppants of high strength material content bought abroad. Investigated finer proppants are known to have the ability to penetrate narrow fracture networks to ensure effective high reservoir volume and conductivity for production. Results from presented laboratory research shows the D - proppant, which is cheaper and readily available, has the 3K class with low settling rates as a potential micro-proppant for effective transportation, enhancement of conductivity and production rate in the narrow fractures of low permeability reservoirs. Future using of domestic proppant will decrease stimulation cost and will have positive impact on the environment due to omitting long distance transportation from abroad.

Temporary pavilions play an important role as experimental fields for architects, designers and engineers, apart from providing exhibition spaces. Novel structural and formal solutions applied in pavilions also can give them unusual appearance that attracts eyesight of spectators. In this article authors explore the possibility of combination of structural novelty, visual attractiveness and low-cost by a design and construction of a temporary pavilion. For that purpose, an innovative structural system and design approach was applied, i.e. membrane structure designed in Rhino and Grasshopper environments with the use of Kiwi!3D IsoGeometric analysis tool. The designed pavilion, named Obverse/Reverse, was built in Opole, Poland, for the occasion of World Architecture Day in July 2019. Design and construction was performed by the authors in cooperation with students’ organisation Humanisation of Urban Environment from the Faculty of Architecture Wroclaw University of Science and Technology. The Rresultant pavilion proved the possibility of obtaining a low-budgets but visually attractive architectural solution with the adaption of parametrical design tools and some scientific background with innovative structural systems.

Artificial intelligence, a key technological tool in the era of the 4th Industrial Revolution, is being actively applied to education beyond industry, economy, and culture. In the future society, understanding and using artificial intelligence technology will be considered an essential skill for everyone, and the professionalism of AI education for pre-service teachers nurturing future talents is also important. This study verifies the effectiveness of pre-service teachers after undergoing a 15-week extension program consisting of AI Literacy Education (10 weeks), AI-Linked Subjet Education (3 weeks), and Micro-teaching (2 weeks) which was designed to enhance the AI ​​education professionalism of pre-service teachers. The AI Literacy Education section consisted of understanding AI, AI ethics, and basic programming, and the education was conducted through both experience and practice. After that, the pre-service teachers analyzed the curriculum of the 5th and 6th grades of an elementary school, and developed a subject-related education program using AI tools in three stages. Using the developed program, micro-teaching classes were conducted twice. The study results are as follows. First, there was a change in the positive perception of AI (p<.05). Second, the understanding of AI educational technology tools was improved and the recognition of the usefulness of developing a curriculum-related program was expanded. Third, the importance of teacher competency development was learned through the micro-teaching, and the students' understanding of the learning process was expanded.

Micro-technology has played a substantial role in bioscience, biomedical and biotechnological research due to its core advantages in modern science and engineering. It has created unique development in various sectors of bio-research and upsurges the efficacy of research at the molecular level in recent years. Microfluidic technology makes it possible to manipulate sample volumes at the micro- and nano-level (called nanofluidics) with terrific control outside in vivo cellular microenvironment, enabling the reduction of discrepancies between in vivo and in vitro environments as well as reducing reaction time and cost. In this review, we discuss various effective integrations of microfluidic technologies into biotechnology and its paradigmatic significance in bio-research, supporting mechanical and chemical in vitro cellular micro-environment. Specific innovations relating to the application of microfluidics to advance microbial life, solitary and co-cultures along with a multiple-type cell culturing, cellular communications, cellular interactions and population dynamics are discussed.

Ultrafast laser 3D lithography based on non-linear light-matter interactions, widely known as multi-photon lithography (MPL), offers unrivaled precision rapid prototyping and flexible additive manufacturing options. 3D printing equipment based on MPL are already commercially available, yet there is still no comprehensive understanding of factors determining spatial resolution, accuracy, fabrication throughput, repeatability, and standardized metrology methods for the accurate characterization of the produced 3D objects and their functionalities. The photoexcitation mechanisms, spatial-control or photo-modified volumes, and the variety of processable materials are topics actively investigated. The complexity of the research field is underlined by limited understanding and fragmented knowledge of light-excitation and material response. Research to date has only provided case-specific findings on photoexcitation, chemical modification, and material characterization of the experimental data. In this review, we aim to provide a consistent and comprehensive summary of the existing literature on photopolymerization mechanisms under highly confined spatial and temporal conditions, where, besides the excitation and cross-linking, parameters such as diffusion, temperature accumulation, and the finite amount of monomer molecules start to become of critical importance. Key parameters such as, photoexcitation, polymerization kinetics, and the properties of the additively manufactured materials at the nanoscale in 3D are examined, whereas, the perspectives for future research and as well as emerging applications are outlined.

Extracellular vesicles (EV) such as exosomes, are newly recognized fundamental, natural and physiologic particles of life that seemingly are involved all biologic processes and clinical diseases. Due to their universal involvements, understanding the nature and the potential therapeutic uses of these nano-vesicles requires innovative experimental approaches, in virtually every field. Of the EV group, exosome nano-vesicles and larger companion extracellular micro vesicles (MV) can mediate completely new phenomena dependent on intercellular transfer of proteins and selected RNAs; particularly miRNAs, between donor and targeted cells to elicit epigenetic alterations inducing functional cellular changes. These recipient acceptor cells are nearby (paracrine transfers) or far away after distribution via the circulation (endocrine transfers). The major properties of such vesicles seem to have been conserved over eons, suggesting that they may have ancient evolutionary origins arising perhaps even before cells in the primordial soup from which life evolved. Their potential ancient evolutionary attributes may be responsible for the ability of some modern day exosomes to withstand unusually harsh conditions; perhaps due to unusual membrane lipid compositions. This is exemplified by maternal milk exosome survival of the neonatal acid/enzyme rich stomach. It is postulated that this also applies to their durable presence in phagolysosomes; suggesting unique intracellular release of contents. A major issue discussed is the generally poorly realized superiority of these naturally evolved nano vesicles to therapies compared human engineered artificial nanoparticles; say for treatment of cancers.

Novel bio-inspired materials have gained recently great attention, especially in medical applications. Applying sophisticated design and engineering methods, various polymer-polymer hybrid systems with outstanding performance have been developed in last decades. Hybrid systems composed of bioelastomers and hydrogels are very attractive due to their high biocompatibility and elastic nature for advanced biomaterials used in various medical applications such as drug delivery systems and scaffolds for tissue engineering. Herein, we describe the advances in current state-of-the-art design, properties and applications of polymer-polymer hybrid systems in medical applications. Bio-inspired functionalities, including bioadhesiveness, injectability, antibacterial properties and degradability applicable to advanced drug delivery systems and medical devices will be discussed in a context of future efforts towards development of bioinspired materials.

The size of TiO2 (either nanometric or micrometric) can significantly affect both its photocatalytic and photoelectrochemical properties, thus altering the photooxidation of organic pollutants in air or water. The purpose of this work is to give an account of the photoelectrochemical and photocatalytic features of some nano- and micro-sized TiO2 commercial powders towards a model reaction, the photooxidation of acetone. Cyclic voltammograms (CV) of TiO2 particulated electrodes under UV illumination experiments were carried out in either saturated O2 or N2 solutions for a direct correlation with the photocatalytic process. In addition, the effect of different reaction conditions on the photocatalytic efficiency under UV light in both aqueous and gaseous phases was also investigated. CV curves with the addition of acetone under UV light showed a negative shift of the photocurrent onset, confirming the efficient transfer of photoproduced reactive oxygen species (ROSs), e.g., hydroxyl radicals, or holes to acetone molecules. The photocatalytic experiments showed that the two nano-sized samples exhibit the best photocatalytic performance. The different photoactivity of the micro-sized samples is probably attributed to their morphological differences, affecting both the amount and distribution of free ROSs involved in the photooxidation reaction.

This work proposes a systematic topology optimization approach to simultaneously design the morphing functionality and actuation in three-dimensional wing structures. The actuation is assumed to be a linear strain-based expansion in the actuation material and a three-phase material model is employed to represent structural and actuating materials, and void. To ensure both structural stiffness with respect to aerodynamic loading and morphing capabilities, the optimization problem is formulated to minimize structural compliance while morphing functionality is enforced by constraining a morphing error between actual and target wing shape. Moreover, a feature mapping approach is utilized to constrain and simplify actuator geometries. A trailing edge wing section is designed to validate the proposed optimization approach. Numerical results demonstrate that three-dimensional optimized wing sections utilize a more advanced structural layout to enhance structural performance while keeping morphing functionality than two-dimensional wing ribs. The work presents the first step towards systematic design of three-dimensional morphing wing sections.

Since their discovery in 1993, numerous microRNAs (miRNAs) have been identified in humans and other eukaryotic organisms, and their role as key regulators of gene expression is still being elucidated. It is now known that miRNAs not only play a central role in the processes that ensure normal development and physiology, but they are often dysregulated in various diseases. In this review, we present an overview of the role of miRNAs in normal renal development and physiology, in maladaptive renal repair after injury, and in the pathogenesis of renal parenchymal diseases. In addition, we describe methods used for their detection and their potential as therapeutic targets. Continued research on renal miRNAs will undoubtedly improve our understanding of diseases affecting the kidneys and may also lead to new therapeutic agents.

This research paper is part of the wider project concerning the very first detailed mapping of the overall Taiwanese hydro-power plants that took place from 2013 up to 2015 and it is currently in evaluation and finalization stage. The case of Shanping hydro-power plant has been carefully studied, photographed, documented and mapped in situ. It was one of the isolated hydro-power plant projects originally built to supply the remote area with the specific designation. Shanping hydro-power plant, as well as the other units from the early hydro-power generation era in Taiwan, are considered to be the technological heritage of civil and mechanical engineering that reflects later in all the further projects up to nowadays modern Taiwanese hydro-power plants. Unfortunately, most of the hydro-power houses from the older periods were severely damaged or destroyed by natural causes which were also the case of Shanping unit. The research is trying to reconstruct the original location of the powerhouse and its supporting structures based on available historical documents, previous studies, comparative methodology, and the current on-site observation.

The role of energy and entropy in decomposition of turbulent velocity flow-fields is to be shown in the paper. The decomposition methods based on energy concept are taken into account, namely the Proper Orthogonal Decomposition (POD) and its extension Bi-Orthogonal Decomposition (BOD). Entropy motivated view on the decomposed modes could offer new possibilities in the modes physical interpretation and in Reduced Order Modelling (ROM) strategy efficiency evaluation.

A conventional electrical grid mostly depends on the electrical power generated from fossil fuels. However, the pollutants from fossil fuels are the key factors for adverse climate change. Most of the developed countries of the world have already recognized the fact that the energy mix requires to be diversified by incorporating renewable energy. This is especially relevant for many of the member countries of the Organization of Islamic Cooperation (OIC), consisting of 57 countries, whose abundance of fossil fuel reserve indicates that much of their electric power is still generated from fossil fuels. In order to integrate renewable energy sources into the hybrid energy mix, an existing conventional grid needs to undergo drastic changes. Alongside this, the population boom in the OIC member countries has caused higher demand for a steady supply of electricity that the conventional grids have long been struggling to cope with. With a view to solving this multifaceted problem, incorporation of the smart power management schemes is indispensable using a smart electrical grid, where information and communications technology is integrated into its major building blocks. This allows advanced applications of a grid, such as the formation of micro-grids, demand-side management, energy storage, high-tech power electronic converters, etc. As the smart grids are being adopted by many developed countries, it is high time for the OIC member countries to pay due attention to this development, if they have not already done so. This paper explains, with special focus on the OIC member countries, the various smart power management technologies, their operations and applications, and the benefits and challenges. Then it goes on to carry out the Strength-Weakness-Opportunity-Threat with Analytical-Heuristic-Procedure (SWOT-AHP) analysis to evaluate its feasibility of incorporation and the underlying strategies appropriate for its implementation. Furthermore, a Hybrid Multi-Criteria-Decision-Making (MCDM) analysis is performed to evaluate the sequence of the emphasis that should be given on each of the technologies from those available for the smart power management initiative. Finally, the study reinforces the stance by drawing parallels from the UN Sustainable Development Goals (SDG) and highlights the importance of the smart grid in line with the global vision of SDG. This paper aims at assisting the decision-makers in implementing smart power management schemes in the OIC member countries, in particular, and other countries of the world, in general.

Manipulation of micro- and nano-sized objects with optical tweezers is a well established, albeit still evolving technique. While many objects can be trapped directly with focused laser beam(s), for some applications indirect manipulation with tweezers-operated tools is preferred. We introduce a simple, versatile micro-tool operated with holographic optical tweezers. The 40 µm long dumbbell-shaped tool, fabricated with two-photon laser 3D photolithography has two beads for efficient optical trapping and a probing spike on one end. We demonstrate fluids viscosity measurements and vibration detection as examples of possible applications.

In this work it is acknowledged that important attempts to devise an emergent quantum (gravity) theory require space-time to be discretized at the Planck scale. It is therefore conjectured that reality is identical to a sub-quantum dynamics of ontological micro-constituents that are connected by a single interaction law. To arrive at a complex system-based toy-model identification of these micro-constituents, two strategies are combined. First, by seeing gravity as an entropic phenomenon and generalizing the dimensional reduction of the associated holographic principle, the universal constants of free space are related to assumed attributes of the micro-constituents. Second, as the effective field dynamics of the micro-constituents must eventually obey Einstein’s field equations, a sub-quantum interaction law is derived from a solution of these equations. A Planck-scale origin for thermodynamic black hole characteristics and novel views on entropic gravity theory result from this approach, which eventually provides a different view on quantum gravity and its unification with the fundamental forces.

The tissue micro environment or milieu consists of a highly dynamic population of cellular and non-cellular components which constitute a complex regulatory network aimed at maintaining the organ homeostasis. In the modern medicine the discovery of miRNAs is undoubtedly a promising field of research and they are essential in orchestrating immune system logic and their release in the gut micro milieu can directly affect bacterial gene expression. Here, we briefly review the role of microRNAs, focuses on their role on immune system components in physiological and pathophysiological gut micro milieu.

Flooding and overflows are recurring problems in several Brazilian cities, which usually undergo disorderly development. Their causes vary from increased impervious surface areas, deficiency/inefficiency of drainage structures and their maintenance, siltation of rivers, channel obstructions, and climatic factors. This situation is aggravated in the major cities. The Anhangabau watershed lies in the central portion of the city of Sao Paulo – Brazil and covers a drainage area of 5.4 km². The region is highly urbanized and crossed by a major north-south road connection. During heavy rain events, portions of this interconnection passage become compromised, disrupting the flow of vehicles, creating a chaotic situation for the population, as well as losses to the national economy. Observed rainfall records and an existing IDF (intensity duration frequency) curve for the region are used to obtain design storms. To account for climate change, a well know procedure, the equidistance quantile matching method for updating IDF curves under climate change, was applied to the existing historical data. Several different global climate models (GCM) and one regional model were applied to obtain and update rainfall design storm. The GCMs and future scenarios used were from the IPCC Assessment Report 5 (AR5) and two future projections: RCP (representative concentration pathway) 4.5 and 8.5. Alternatives previously proposed to solve to flooding issue are briefly reviewed. On one of the latest studies [1], a few modern concepts of water resources management are presented, and the linear retention measure was found to offer higher potential to mitigate the flooding problem in the lower valley of the watershed. Therefore, this alternative was used to evaluate different design storms scenarios combined with return periods of 25 and 100-years as well as the updated IDF under climate change for RCP 4.5 and RCP 8.5. To model the complex network, representing both road and drainage systems and their interconnections, PCSWMM/SWMM software was applied. Results are presented as flooding maps and show the impacts of the proposed linear retention measure based on the existing IDF curves and the updated IDF curves under climate change for two different drainage system conditions, current and improved with the use of linear retention reservoirs. Results show that the prosed changes on the drainage system help reduce the risk and damage to flooding. The climate change scenarios, however, impose a significant threat and need immediate attention from city planners and stakeholders.

GaN-based micro-size light-emitting diodes (µLEDs) have a number of appealing and distinctive benefits for display, visible-light communication (VLC), and other novel applications. The smaller size of LEDs affords them the benefits of enhanced current expansion, less self-heating effects, and higher current density bearing capacity. Low external quantum efficiency (EQE) resulting from non-radiative recombination and quantum confined stark effect (QCSE) is the serious barrier for applications of µLEDs. In this work, the reasons for the poor EQE of µLEDs are reviewed, as well as the optimization techniques for improving the EQE of µLEDs.

This research aims to study the ultimate limit state (ULS) behaviour of stiffened panel under longitudinal compression by non-linear finite element method (NLFEM). There are different types of stiffeners being used in shipbuilding i.e. T-bar, flat-bar and angle-bar. However, this research focuses on the ultimate compressive strength behaviour of flat-bar stiffened panel. A total of 420 of reliable scenarios of flat-bar stiffened panel are selected for numerical simulation by ANSYS NLFEM. The ultimate strength behaviours obtained were used as data for the development of closed form shape empirical formulation. Recently, Kim et al. [1] proposed for advanced empirical formulation for T-bar stiffened panel and the applicability of the proposed formulation to flat-bar stiffened panel will be confirmed by this study. The accuracy of the empirical formulation obtained for flat-bar stiffened panel has been validated by FE simulation results of statistical analysis (R2 = 0.9435). The outcome obtained will be useful for ship structural designers in predicting the ultimate strength performance of flat-bar type stiffened panel under longitudinal compression.

We introduce the Concept-Model-Graph-View Cycle (CMGVC). The CMGVC facilitates coherent architecture analysis, reasoning, insight, and decision-making based on conceptual models that are transformed into a generic, robust graph data structure (GDS). The GDS is then transformed into multiple views of the model, which inform stakeholders in various ways. This GDS-based approach decouples the view from the model and constitutes a powerful enhancement of model-based systems engineering (MBSE). The CMGVC applies the rigorous foundations of Category Theory, a mathematical framework of representations and transformations. We show that modeling languages are categories, drawing an analogy to programming languages. The CMGVC architecture is superior to direct transformations and language-coupled common representations. We demonstrate the CMGVC to transform a conceptual system architecture model built with the Object Process Modeling Language (OPM) into dual graphs and a stakeholder-informing matrix that stimulates system architecture insight.

The Neotropical region is one of the most diverse regions of the globe in terms of macro-organismic species. Regarding the microbial world, however, little is known about the diversity and biogeography patterns of micro-organisms in the Neotropics. In this context, the study of several microbial taxonomic groups is still missing and/or incomplete, such as the protists. Our goal here was to summarize the available information of Neotropical protists, focusing on molecular data from environmental continental samples, to explore what these data evidence on their ecology and biogeography. For this, we reviewed the findings from all articles that focused on or included the terrestrial protists using metabarcoding approach and identified the gaps and future perspectives in this research field. We found that Neotropical protists diversity patterns seem to be, at least in part, congruent with that of macro-organisms and, different than plants and bacteria, just weakly explained by environmental variables. We argue that studies with standardized protocols including different biomes are necessary to fully characterize the ecology and biogeography on Neotropical protists. Furthermore, dismember evolutionary lineages and functional guilds of protists are important to better understand the relationship between diversity, dispersal abilities and functionality of particular taxa of protists in their habitats.

The three-point bending behavior of a single Au nanowire deformed with an atomic force microscope was monitored by coherent X-ray diffraction using a sub-micrometer sized hard X-ray beam. While three-dimensional reciprocal-space maps were recorded before and after deformation by standard rocking curves, they were measured by scanning the energy of the incident X-ray beam during deformation at different loading stages. The mechanical behavior of the nanowire is visualized in reciprocal space and a complex deformation mechanism is described. In addition to the expected bending of the nanowire, torsion is detected. Bending and torsion angles are quantified from the high resolution diffraction data.

This research aims to estimate the micro-motion (m-m) of ships. The problem of motion and m-m detection of targets is usually solved using synthetic aperture radar (SAR) along-track interferometry (ATI) which is observed employing two radars spatially distanced by a baseline extended in the azimuth direction. This paper is proposing a new approach where the m-m estimation of ships, occupying thousands of pixels, is measured processing the information given by sub-pixel tracking generated during the coregistration process of several re-synthesized time-domain and overlapped sub-apertures. The SAR products are generated splitting the raw data, according to a small-temporal baseline strategy, observed by one single wide-band staring spotlight (ST) SAR image. The predominant vibrational modes of different ships are estimated and results are promising to extend this application in performing surveillance also of land-based industries activities. Experiments are performed processing one ST SAR image observed by the COSMO-SkyMed satellite system.

Ultra Low Temperature Process (ULTP) involve the material cooling in temperatures close to the liquid nitrogen (-196 °C), which is different from the cold-treatment (CT) made in temperatures close to -80 °C. ULTP treatments could raise the tool steel wear resistance through microstructural change that occurs on the material, enhancing, that way, the tools and dies lifetime. To investigate the impact on the wear resistance of tool steel AISI D2, micro abrasive wear tests were carried out and an analysis based on the Archard’s law was considered, evaluating specimen mass loss by laser interferometry. Micro hardness tests, X-ray diffractometry, scanning and optical microscopy and quantitative evaluation of carbides with image analysis were carried out aiming material characterization. Micro-scale abrasion tests shown a wear coefficient k about 1.73E-7 e 2.61E-7 mm3/N.mm to the specimens that received the ULTP phase and 3.12E-7 mm3/N.mm to the conventional thermal treatment, representing a wear resistance increase of 16.3 – 44.5% to cryogenically treated specimens. The results demonstrated a micro hardness improvement, ranging from 0.9 - 4.7% for the cryogenically treated specimens, when compared to the bulk material. This effect is related, mainly, to the retained austenite transformation in martensite and to the increase in the amount of fine secondary carbides dispersed in the martensitic matrixes of cryogenically treated specimens with ULTP. The best wear resistance improvements, on micro-scale, were achieved when the ULTP step is performed immediately after tempering.

The article deals with auxetic structures made on the basis of suitably connected rigid rotating squares (from Grima and Evans), with axes of rotation on the squares’ surface. The geometric model and the resulting relationships that allow for the determination of Poisson’s ratio are considered in detail. It is demonstrated that changing the rotation axis position does not affect the negative Poisson’s ratio, equal to -1. The models built confirm the initial considerations and can offer new application possibilities.

Dampers provide safety by control of unwanted motion, due to conversion of mechanical work into another form of energy (e.g., heat). State of the art materials are elastomers including thermoplastic-elastomers. For polymer-appropriate replacement of multi-component shock absorbers comprising mounts, rods, hydraulic fluids, pneumatic devices, or electro-magnetic devices, among others, deep insights of the dynamic thermo-mechanical characteristics of damper materials have to be gained. The ultimate objective is to reduce complexity by utilizing inherent material damping rather than structural (multi-component) damping properties. The objective of this work was to compare the damping behavior of different elastomeric materials including thermoplastic poly(urethane) (TPU), and silicone rubber blends (mixtures of different poly(dimethylsiloxane) (PDMS)). Therefore, the materials were hyper- and viscoelastic characterized, a finite element calculation of a ball-drop test was performed, and for validation the rebound resilience was measured experimentally. In an attempt, the coil-over shock absorber of a model car was replaced by a damper made of the examined and modeled materials. The results revealed that the material parameter determination methodology is reliable, and the data applied for simulation lead to realistic predictions. Interestingly, the rebound resilience of the mixture of soft and hard PDMS (50:50)w% is the highest and the lowest values were measured for TPU.

While laminar flow heat transfer and mixing in microfluidic geometries has been investigated experimentally, as has the effect of geometry-induced turbulence in microfluidic flow (it is well documented that turbulence increases convective heat transfer in macrofluidic flow), little literature exists investigating the effect of electrokinetically-induced turbulence on heat transfer at the micro scale. Using recently observed experimental data, this work employed computational fluid dynamics coupled with electromagnetic simulations to determine if electrokinetically-forced, low-Reynolds number turbulence could be observed in a rectangular microchannel with using Newtonian fluids. Analysis of the results was done via comparison to the experimental criteria defined for turbulent flow. This work shows that, even with a simplified simulation setup, computational fluid dynamics (CFD) software can produce results comparable to experimental observations of low-Reynolds turbulence in microchannels using Newtonian fluids. In addition to comparing simulated velocities and turbulent energies to experimental data this work also presents initial data on the effects of electrokinetic forcing on microfluidic flow based on entropy generation rates.

Around 14% of the global population does not have access to electricity. About 95% of those are living in rural Sub-Saharan Africa. Often in these regions, diesel generators are the only source of electricity. The operating cost of these diesel generators is high. However, solar and wind energy are available in most of African countries. This study presents the analysis of designing an off-grid hybrid system with a wind turbine, PV, diesel generator, and battery to power a hospital, school, and 200 household village in four locations across Somalia. The research investigated the availability of wind-solar resources in selected locations. Designing of the system and economic-technical calculations were performed using HOMER. The selection of the optimum design was based on the Cost of Electricity and Net Present Cost. The results show that for Kabaal and Ceel Buur, a WT-PV-DG-Battery is the optimal system as the wind resource in these regions is high. For Saakov and Baki, a PV-DG-Battery system proves to be optimum as the wind resource is limited here. The study also evaluated the control strategy and proved that combined dispatch was the most cost-effective for these locations. The study concluded that hybrid systems are more economical than diesel systems.

Organ-on-a-Chip (OoC) systems bring together cell biology, engineering, and material science for creating systems that recapitulate the in vivo microenvironment of tissues and organs. The versatility of OoC systems enables in vitro models for studying physiological processes, drug development, and testing in both academia and industry. This paper evaluates current platforms from the end-user perspective, elaborating on usability, complexity, and robustness. We surveyed 165 peers in over 30 countries and grouped the responses according to preliminary knowledge and the source of the OoC systems that are used. The survey clearly shows that current commercial OoC platforms provide a substantial level of robustness and usability - which is also indicated by an increasing adaptation of the pharmaceutical industry but a lack of complexity can challenge their use as a predictive platform. Self-made systems on the other hand are less robust and standardized but provide the opportunity to develop customized and more complex models which are often needed for human disease modeling. This review serves as a guide for researchers in the OoC field and encourages the development of next-generation OoCs.

As long as the non-contact digital printing is not a common standard in the corrugated packaging industry, corrugated board crushing is a real issue that affects the load capacity of the boxes. Crushing mainly occurs during the converting of corrugated board (e.g. analog flexographic printing or laminating) and is a process that cannot be avoided. However, as show in this study, it can be controlled. In this work, extended laboratory tests were carried out on the crushing of double-walled corrugated board. The influence of fully controlled crushing (with a precision: ±10 μm) in the range from 10 to 70 % on different laboratory measurements was checked. Most of the typical mechanical tests were performed e.g. edge crush test, four-point bending test, shear stiffness test, torsional stiffness test, etc. on reference and crushed specimens. The residual thickness reduction of the crushed samples was also controlled. All empirical observations and performed measurements were the basis for building an analytical model of crushed corrugated board. The proven and verified model was then used to study the crushing effect of the selected corrugated board on the efficiency of simple packages with various dimensions.

Microgrids can be used for securing power supply during network outages. Underground cabling of distribution networks is another effective, but conventional and expensive alternative to enhance reliability of power supply. This paper presents firstly an analysis method for the determination of microgrid power supply adequacy during islanded operation, and secondly, a comparison method for overall cost calculation of microgrids vs. underground cabling. The microgrid power adequacy during a rather long network outage is required in order to indicate high level of reliability of supply. The overall cost calculations consider the economic benefits and costs incurred combined for both the distribution network company and the consumer. Whereas the microgrid setup determines the islanded operation power adequacy and thus the reliability of supply, the economic feasibility results from the normal operations and services. The methods are illustrated by two typical, and even critical, case studies in rural distribution networks: an electric-heated detached house and a dairy farm. These case studies show that even in case of a single consumer, a microgrid option could be more economical than network renovation by underground cabling of a branch in order to increase reliability.

A photovoltaic-thermal (PVT) collector is a solar-based micro-cogeneration system which generates simultaneously heat and power for buildings. The novelty of this paper is to conduct energy and exergy analysis on PVT collector performance under two different European climate conditions. The performance of the PVT collector is compared to a PV panel. Finally, the PVT design is optimized in terms of thermal and electrical exergy efficiencies. The optimized PVT designs are compared to the PV panel performance as well. The main focus is to find out if the PVT is still competitive with the PV panel electrical output, after maximizing its thermal exergy efficiency. The PVT collector is modelled into Matlab/Simulink to evaluate its performance under varying weather conditions. The PV panel is modelled with the CARNOT toolbox library. The optimization is conducted using Matlab gamultiobj-function based on Non-Dominated Sorting Genetic Algorithm-II (NSGA-II). The results indicated 7.7% higher annual energy production in Strasbourg. However, the exergy analysis revealed a better quality of thermal energy in Tampere with 72.9% higher thermal exergy production. The electrical output of the PVT is higher than from the PV during the summer months. The thermal exergy- driven PVT design is still competitive compared to the PV panel electrical output.

Optical fiber sensors have become a widely-used tool to perform life-long monitoring of large structures. Different set-ups of sensors can be used to obtain information at different scopes. In this paper, the application of a portable Brillouin optical time domain analysis sensor applied to reinforced concrete beams is presented. The sensor is made up of a single-mode optical fiber applied to the structure that enables the measurement of tensile and compressive axial strain along the beams. The fiber is embedded into a concrete casting and fixed along the reinforcement bars so that a complete correlation can be obtained regarding strain and displacements in linear and non-linear flexural response. The use of four sensing fibers positioned along the beam's length at different vertical positions makes it possible to read the strain variation within the cross-section. In accordance with Bernoulli’s hypothesis, this allows curvature diagrams to be obtained across the structure. The measured curvature is used to set up the moment–curvature relationship, which highlights the possibility of the sensor monitoring structures continuously in space and time.

Layered two-dimensional (2D) graphene oxide (GO) films are integrated with micro-ring resonators (MRRs) to experimentally demonstrate enhanced nonlinear optics in the form of four-wave mixing (FWM). Both uniformly coated and patterned GO films are integrated on CMOS-compatible doped silica MRRs using a large-area, transfer-free, layer-by-layer GO coating method together with photolithography and lift-off processes, yielding precise control of the film thickness, placement, and coating length. The high Kerr nonlinearity and low loss of the GO films combined with the strong light-matter interaction within the MRRs results in a significant improvement in the FWM efficiency in the hybrid MRRs. Detailed FWM measurements are performed at different pump powers and resonant wavelengths for the uniformly coated MRRs with 1−5 layers of GO as well as the patterned devices with 10−50 layers of GO. The experimental results show good agreement with theory, achieving up to ~7.6-dB enhancement in the FWM conversion efficiency (CE) for an MRR uniformly coated with 1 layer of GO and ~10.3-dB for a patterned device with 50 layers of GO. By fitting the measured CE as a function of pump power for devices with different numbers of GO layers, we also extract the dependence of GO’s third-order nonlinearity on layer number and pump power, revealing interesting physical insights about the evolution of the layered GO films from 2D monolayers to quasi bulk-like behavior. These results confirm the high nonlinear optical performance of integrated photonic resonators incorporated with 2D layered GO films.

Direct laser writing based on non-linear 3D nanolithography (also known as 3D laser lithography, 3DLL) is a powerful technology to manufacture polymeric micro-optical components. However, practical applications of these elements are limited due to the lack of knowledge of their optical resilience and durability. In this work, we employ 3DLL for the fabrication of bulk (i.e. fully filled) and woodpile structures out of different photopolymers. We then characterize them using S-on-1 laser induced damage threshold (LIDT) measurements. In this way, quantitative data of LIDT values can be collected. Furthermore, this method permits to gather damage morphologies. The results presented in this work demonstrate that LIDT values depend on the material and the geometry of the structure. Bulk non-photosensitized hybrid organic-inorganic photopolymer SZ2080 structures are found to be the most resilient with a damage threshold being of 169±15 mJ/cm².

This work presents the results of the experimental and theoretical study of the static pull-in of tilting actuation executed by a hybrid levitation micro-actuator (HLMA) based on the combination of inductive levitation and electrostatic actuation. A semi-analytical model to study such the pull-in phenomenon is developed, for the first time, as a result of using the qualitative technique based on the Lagrangian approach to analyze inductive contactless suspensions presented in work and a recent progress in the calculation of mutual inductance and force between two circular filaments. The obtained non-linear model, accounting for two degrees of freedom of the actuator, allows us to predict accurately the static pull-in displacement and voltage. The results of modelling were verified experimentally and agree well with measurements.

Individual plant cells are the building blocks for all plantae and artificially constructed plant biomaterials, like biocomposites. Secondary cell walls (SCWs) are a key component for mediating mechanical strength and stiffness in both living vascular plants and biocomposite materials. In this paper, we study the structure and biomechanics of cultured plant cells during the cellular developmental stages associated with SCW formation. We use a model culture system that induces transdifferentiation of Arabidopsis thaliana cells to xylem vessel elements, upon treatment with dexamethasone (DEX). We group the transdifferentiation process into three distinct stages, based on morphological observations of the cell walls. The first stage includes cells with only a primary cell wall (PCW), the second covers cells that have formed a SCW, and the third stage includes cells with a ruptured tonoplast and partially or fully degraded PCW. We adopt a multi-scale approach to study the mechanical properties of cells in these three stages. We perform large-scale indentations with a micro-compression system and nanoscale indentations through atomic force microscopy (AFM), in three different osmotic conditions. We introduce a spring-based model to deconvolve the competing stiffness contributions from turgor pressure, PCW, SCW and cytoplasm in the stiffness of differentiating cells. Prior to triggering differentiation, cells in hypotonic pressure conditions are significantly stiffer than cells in isotonic or hypertonic conditions, highlighting the dominant role of turgor pressure. Plasmolyzed cells with a SCW reach similar levels of stiffness as cells with maximum turgor pressure. The stiffness of the PCW in all of these conditions is lower than the stiffness of the fully-formed SCW. Our results provide the first experimental characterization of the mechanics of SCW formation at single cell level.

Understanding the flow in urban environments is an increasingly relevant problem due to its significant impact on air quality and thermal effects in cities worldwide. In this review we provide an overview of efforts based on experiments and simulations to gain insight into this complex physical phenomenon. We highlight the relevance of coherent structures in urban flows, which are responsible for the pollutant-dispersion and thermal fields in the city. We also suggest a more widespread use of data-driven methods to characterize flow structures as a way to further understand the dynamics of urban flows, with the aim of tackling the important sustainability challenges associated to them.

Changes in the amount and the distribution of mean and turbulent quantities in the free shear layer wake of a 2D NACA 0012 airfoil and AR 4 NACA 0012 wing with passive segmented rigid trailing edge (TE) extensions was investigated at the University of Dayton Low Speed Wind Tunnel (UD-LSWT). The TE extensions were intentionally placed at zero degrees with respect to the chord line to study the effects of segmented extensions without changing the effective angle of attack. Force based experiments was used to determine the total lift coefficient variation of hte wing with seven segmented trailing edge extensions distributed across the span. The segmented trailing edge extensions had negligible effect of lift coefficient but showed measurable decrement in sectional and total drag coefficient. Investigation of turbulent quantities (obtained through Particle Image Velocimetry (PIV)) such as Reynolds stress, streamwise and transverse RMS in the wake, reveal a significant decrease in magnitude when compared to the baseline. The decrease in the magnitude of turbulent parameters was supported by the changes in coherent structures obtained through two-point correlations. Apart from the reduction in drag, the lower turbulent wake generated by the extensions has implications in reducing structural vibrations and acoustic tones.

The apparent metal-insulator transition (MIT) in two-dimension (2D) was discovered by Kravchenko et al. [1] more than two decades ago in strongly interacting 2D electrons residing in a Si-metal-oxide-semiconductor field-effect transistor (Si-MOSFET). Its origin remains unresolved. Recently, low magnetic field reentrant insulating phases (RIPs), which dwell between the zero-field (B=0) metallic state and the integer quantum Hall (QH) states where the Landau-level filling factor υ > 1, have been observed in strongly correlated 2D GaAs hole systems with large interaction parameter rs (~20-40) and high purity. A new complex phase diagram was proposed, which includes zero field MIT, low magnetic field RIPs, integer QH states, fractional QH states, high field RIPs and insulating phases (HFIPs) with υ < 1 in which the insulating phases are explained by the formation of Wigner crystal. Furthermore, evidences of new intermediate phases were reported. All contribute to the further understandings of the puzzle. This review article serves the purpose of summarizing those recent experimental findings and theoretical endeavors, to foster future research efforts.

Micro channel tube (MCT) is widely employed in industry due to its excellent efficiency in heat transfer. An MCT is commonly produced through extrusion within a porthole die, where severe plastic deformation is inevitably involved. Moreover, the plastic deformation, which dramatically affects the final property of the MCT, varies significantly from location to location. In order to understand the development of the microstructure and its effect on the final property of the MCT, the viscoplastic self-consistent (VPSC) model, together with the finite element analysis and the flow line model, is employed in the current study. The flow line model is used to reproduce the local velocity gradient within the complex porthole die, while VPSC model is employed to predict the evolution of the microstructure accordingly. In addition, electron backscatter diffraction (EBSD) measurement and mechanical tests are used to characterize the evolution of the microstructure and the property of the MCT. The simulation results agree well with the corresponding experimental ones. The influence of the material’s flow line on the evolution of the orientation and morphology of the grains, and the property of the produced MCT are discussed in detail.

This paper presents a demonstration of the feasibility of fabricating micro-cantilever harvesters with extended stress distribution and enhanced bandwidth by exploiting an M-shaped two-degrees-of-freedom design. The measured mechanical response of the fabricated device displays the predicted dual resonance peak behavior with the fundamental peak at the intended frequency. This design has the features of high energy conversion efficiency in a miniaturized environment where the available vibrational energy varies in frequency. It makes such a design suitable for future large volume production of integrated self powered sensors nodes for the Internet-of-Things.

Poly(vinylidene fluoride) nanocomposites processed with different morphologies, such as porous and non-porous films and fibres, have been prepared with silica nanoparticles (SiNPs) of varying diameter (17, 100, 160 and 300 nm) which in turn have encapsulated perylenediimide (PDI), a fluorescent molecule. Structural, morphological, optical, thermal, and mechanical properties of the nanocomposites, with SiNP filler concentration up to 16 wt% were evaluated. Further, cytotoxicity and cell proliferation studies were performed. All SiNPs are negatively charged independently of the pH and more stable from pH 5 upwards. The SiNPs introduction within the polymer matrix increases the contact angle independently of the nanoparticle diameters and the smallest ones (17 nm) improve the PVDF Young modulus from 0.94 ± 0.04 GPa for the pristine polymer film to 1.05 ± 0.06 GPa. Varying filler diameter, physico-chemical, thermal and mechanical properties of the polymer matrix were not significantly affected. Finally, the SiNPs inclusion does not induce cytotoxicity in murine myoblasts (C2C12) after 72 h of contact and proliferation studies reveal that the prepared composites represent a suitable platform for tissue engineering applications, as they allow to combine the biocompatibility and piezoelectricity of the polymer with the possible functionalization and drug encapsulation and release of the SiNP.

Within the task of replacing bronze journal bearings with aluminum the processes taking part on friction surface of high-alloyed aluminum alloys working with steel are investigated. The surface and subsurface layer of experimental aluminum bearings were studied before and after tribological tests by scanning electron microscopy including energy-dispersive analysis. Both structural and composition changes in surface layer are shown. It has been revealed that secondary structures are formed on the surface during friction process and include all the chemical elements of the tribosystem which is a consequence of its self-organization. The interaction behavior of some chemical elements of tribological system is discussed.

Micro Injection molding combined with the use of removable inserts is one of the most promising manufacturing process for microfluidic devices, such as Lab-on-a-chip, that have the potential to revolutionize the healthcare and diagnosis system. In this work we have designed, fabricated and tested a compact and disposable plastic optical stretcher. To produce the mould inserts, two micro manufacturing technologies have been used. Micro Electro Discharge machining was used to reproduce the inverse of the capillary tube connection characterized by high aspect ratio. Thanks to the high accuracy of femtosecond laser machining, instead, we manufactured insert with perfectly aligned microfluidic channels and fiber slots, facilitating the final composition of the optical manipulation device. The optical stretcher operation is tested using microbeads and red blood cells solutions. The prototype presented in this work demonstrates the feasibility of this approach that should guarantee a real mass production of ready-to-use- Lab-on-a-chip.

The Wolfram (W), Silicium (Si) and Molybdenum (Mo) doped Co-Cr biomedical alloy were fabricated by additive manufacturing method, which is part of powder metadology. The mixture of Wolfram (W), Silicium (Si), Chrome (Cr) and Cobalt (Co) alloy is known good wear and corrosion resistance among of biomedical applications. By addition of Molybdenum (Mo) into the structure of alloy, the structure become more stbale also increase the corrosion and wear resistance. In addition, the effects of secondary annealing process on the alloy were investigated. The microstructure of the produced alloy was analyzed by X-ray diffraction method XRD, Energy Dispersive X-Ray Analysis EDX and scanning electron microscope SEM. Moreover, Electrochemical corrosion test, micro hardness and density measurements were performed to investigate the mechanical properties of the alloy. As a result of the analyzes, the effects of Molydenum (Mo) doped and secondary annealing on the microstructure and mechanical properties of bioalloying were determined.

Minerals play many important functions in plant and animal metabolism. Therefore, we investigated the concentration of Se and other minerals and their relationships in soils and fodder plants in Kosovo. Seventy-three samples of each soil and fodder plants (grass, maize, and wheat) from 30 farms were collected. Both soil and plant samples, after processing and digestion, were analyzed for mineral concentration by ICP-MS. Mineral concentrations in soil and fodder crops, and the best predicting/explanatory models for micro minerals concentration, achieved by stepwise linear regression, are presented. Results showed very low concentration of Se in most of the soil and all fodder samples. In addition, the concentration of Co, Zn and Fe was not sufficient to satisfy requirements for all categories of farm animals. Plant Se concentration showed a positive relationship with Se concentration in soils. Plant Zn, Mo, Mn, Fe and Pb, in general, showed no significant relationship with their concentration in soil, while plant Co and Cd showed positive relationship only in maize, and Cu in wheat grain. Among the soil properties, pH had the highest effect on the concentrations of Co, Mo, Mn, Cd and Pb in fodder crops.

Both sand and fly ash were found to be promising for phosphorus removal in bioretention systems. However, nutrient removal in bioretention systems with sand, soil and fly ash was still uncertain due to a lack of data about the influence of layer structure and submerged zone. In this study, a mixture with sand, soil and fly ash (1:1:1) was selected as the base in bioretention systems with different packed layer structures and heights of submerged zone. The comparison of multi-layered structure with mixed structure implied that the used bioretention system with multi-layered structure was superior to that with mixed structure for nitrogen and phosphorus removal. The investigation of the influence of submerged zones on nutrient removal indicated that the submerged zone could significantly improve nitrate removal efficiency with 67.52%-86.32%, while sharply reduce the removal of ammonia nitrogen (from 95.15% to 51.81%) and TP (from 88.66% to 44.50%). Overall evaluation of the effect of packed layer structures and submerged zones suggested that the bioretention system with multi-layered structure at the height of submerged zone at 20-40cm was the most satisfactory, due to its microbial environment.