In this paper, we will revisit the derivation of Heisenberg's uncertainty principle. We will see how the Heisenberg principle collapses at the Planck scale by introducing a minor modification. The beauty of our suggested modification is that it does not change the main equations in quantum mechanics; it only gives them a Planck scale limit where uncertainty collapses. We suspect that Einstein could have been right after all, when he stated, ``God does not throw dice." His now-famous saying was an expression of his skepticism towards the concept that quantum randomness could be the ruling force, even at the deepest levels of reality. Here we will explore the quantum realm with a fresh perspective, by re-deriving the Heisenberg principle in relation to the Planck scale. We will show how this idea also leads to an upper boundary on uncertainty, in addition to the lower boundary. These upper and lower boundaries are identical for the Planck mass particle; in fact, they are zero, and this highlights the truly unique nature of the Planck mass particle. Further, there may be a close connection between light and the Planck mass particle: In our model, the standard relativistic energy momentum relation also seems to apply to light, while in modern physics light generally stands outside the standard relativistic momentum energy relation. We will also suggest a new way to look at elementary particles, where mass and time are closely related, consistent with some of the recent work in experimental physics. Our model leads to a new time operator that does not appear to be in conflict with the Pauli objection. This indicates that both mass and momentum come in quanta, which are perfectly correlated to an internal Compton `clock' frequency in elementary particles.

According to known laws of physics, chronic positive mass balance is the actual etiology of obesity, not positive energy balance. The relevant physical law in terms of body mass regulation is the Law of Conservation of Mass, not the Law of Conservation of Energy. A recently proposed mass balance model (MBM) describes the temporal evolution of body weight and body composition under a wide variety of feeding experiments, and it seems to provide a highly accurate description of the very best experimental human feeding data. By shifting to a mass balance paradigm of obesity, a deeper understanding of this disease may follow in the near future. The purpose of this living review is to present the core issues of the upcoming paradigm shift as well as some practical applications related to the topic.

Fermenter is a vessel that maintains optimum environment for the development of significant microorganism used in large scale fermentation process and the commercial production of products like Alcoholic beverages, Enzymes, Antibiotics, Organic acids etc. The fermenter aims to produce biological product like vaccines and hormones, it is necessary to monitor and control the different parameters like external and internal mass transfer, heat transfer, fluid velocity, shear stress, agitation speed, aeration rate, cooling rate or heating intensity, and the feeding rate, nutrients, base or acid valve. Fermentation in the fermenter are accomplished in several configuration and these simple configurations are batch, fed-batch and continuous fermentation process. Fermentation process is carried out in small or large size fermenter depending on product quantity. The selection of the suitable process depends on the fermentation kinetics, type of microorganism used and process economic aspects. Improved modelling tools, reactor operation and reactor design in bioreactor is because of mass transfer behavior and it is important for reaction rate maximizing, throughput rates optimization and cost minimizing. The fermenter design, fermentation process, types of the fermenter that are used in industries and heat and mass transfer in fermenter is discussed.

Space-time evolution is briefly explained by using the 3-dimensional quantized space model (TQSM) based on the 4-dimensional (4-D) Euclidean space. The energy (mass), charges and absolute time are newly defined based on the 4-D Euclidean space. The photons and gravitons are understood as the 2-D space fluctuations along the space axes and 1-D time fluctuations along the time axis, respectively. This indicates that the electromagnetic (EM) and gravitational (G) waves can be unified into the so called gravityelectromagnetic (GEM) wave which has both space and time fluctuations. The photon with zero force fields is the 2EM wave because an EM wave corresponds to a charged fermion. The dark matter bosons, weak force bosons, strong force bosons are the 1-D time fluctuations which can be expressed by the G waves. This indicates that all five forces are unified by the GEM wave. It is called as the super unification theory in the present work. And the force carrying bosons and mesons are, for the first time, proposed as the possible candidates of the magnetic monopoles like the fermions and baryons are the electric monopoles. The signs of the magnetic charges quantized as q_m=cq are newly defined. The big bang is understood by the space-time evolution of the 4-D Euclidean space but not by the sudden 4-D Minkowski space-time creation. The big bang process created the matter universe with the positive energy and the partner anti-matter universe with the negative energy from the CPT symmetry.

The rapidly increasing adoption of high-resolution accurate-mass methods in analytical laboratories has fueled demand for instruments that combine high performance and reliability with small size and greater ease-of-use. This paper presents the major design principles that are driving the evolution of the hybrid quadrupole-Orbitrap instrument architecture to enable a greater range of applications and users. These principles may be summarized as follows: better usage of physical space and better access for service by means of size reduction of pumping and ion optics; expanded use of technologies from electronics in ion-optical design; flexibility in performance via modularity of design of the hardware and software components; and, harmonization of interfaces with other instruments to facilitate sharing and transferability of analytical workflows. The design of a novel family of hybrid mass spectrometers is described in detail, and performance evaluation is carried out on a wide variety of samples for its three representatives: the Orbitrap Exploris 120, Orbitrap Exploris 240 and Orbitrap Exploris 480 mass spectrometers.The new instrument family is shown to offer compelling potential not only for high-end proteomics and biopharmaceutical applications, but also for screening, trace, targeted and clinical analysis by liquid chromatography/mass spectrometry methods.

Three-dimensional quantized space model is newly introduced. Quantum mechanics and relativity theory are explained in terms of the warped three-dimensional quantized spaces with the quantum time width (Dt=t_q). The energy is newly defined as the 4-dimensional space-time volume of E = cDtDV in the present work. It is shown that the wave function of the quantum mechanics is closely related to the warped quantized space shape with the space time-volume. The quantum entanglement and quantum wave function collapse are explained additionally. The special relativity theory is separated into the energy transition associated with the space-time shape transition of the matter and the momentum transition associated with the space-time location transition. Then, the quantum mechanics and the general relativity theory are about the 4-dimensional space-time volume and the 4-dimensional space-time distance, respectively.

The origins of the stellar mass neutron black holes and supermassive dark matter black holes without the singularities are reported based on the 4-D Euclidean space. The neutron black holes with the mass of m_BH = 5 – 15 m_sun are made by the 6-quark merged states (N_6q) of two neutrons with the mass (m(N_6q) = 10 m(n)) of 9.4 GeV/c² that gives the black hole mass gap of m_BH = 3 – 5 m_sun. Also, the supermassive black holes with the mass of m_SMBH = 10⁶ – 10¹¹ msun are made by the merged 3-D states (J(B1B2B3)₃ particles) of the dark matters. The supermassive black hole at the center of the Milky way galaxy has the mass of mSMBH = 4.1 10⁶ m_sun that is consistent with m_SMBH = 2.08 - 6.23 10⁶ m_sun calculated from the 3-D states (J(B1B2B3)₃ particles) of the dark matters with the mass of m(J) = 1.95 10¹⁵ eV/c². In other words, this supports the existence of the B1, B2 and B3 dark matters with the proposed masses. The first dark matter black hole (primary black hole) was created at the big bang. This first dark matter black hole decayed to the supermassive dark matter black holes through the secondary dark matter black holes that are explained by the merged states of the J(B1B2B3)₃ particles. The universe evolution is closely connected to the decaying process of the dark matter black holes since the big bang. The dark matter cloud states are proposed at the intermediate mass black hole range of m_IMBH = 10² – 10⁵ msun. This can explain why the dark matter black holes are not observed at the intermediate mass black hole range of m_IMBH = 10² – 10⁵ m_sun.

Currently available data are consistent with increased severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) replication at temperatures encountered in the upper airways (25–33°C when breathing room temperature air, 25°C) compared to those in the lower airways (37°C). One factor that may contribute to more rapid viral growth in the upper airways is the exponential increase in SARS-CoV-2 stability that occurs with reductions in temperature, as measured in vitro. Because SARS-CoV-2 frequently initiates infection in the upper airways before spreading through the body, increased upper airway viral growth early in the disease course may result in more rapid progression of disease and potentially contribute to more severe outcomes. Similarly, higher SARS-CoV-2 viral titer in the upper airways likely supports more efficient transmission. Conversely, the possible significance of air temperature to upper airway viral growth suggests that prolonged delivery of heated air might represent a preventative measure and prophylactic treatment for coronavirus disease 2019.

Mereology stands for the philosophical concept of parthood and is based on a sound set of fundamental axioms and relations. One of these axioms relates to the existence of a universe as a thing having part all other things. The present article formulates this logical expression first as an algebraic inequality and eventually as an algebraic equation reading in words: The universe equals the sum of all things. “All things” here are quantified by a “number of things”. Eventually this algebraic equation is normalized leading to an expression The whole equals the sum of all fractions. This introduces “1” or “100%” as a quantitative – numerical - value describing the “whole”. The resulting “basic equation” can then be subjected to a number of algebraic operations. Especially squaring this equation leads to correlation terms between the things implying that the whole is more than just the sum of its parts. Multiplying the basic equation (or its square) by a scalar allows for the derivation of physics equations like the entropy equation, the ideal gas equation, an equation for the Lorentz-Factor, conservation laws for mass and energy, the energy-mass equivalence, the Boltzmann statistics, and the energy levels in a Hydrogen atom. It further allows deriving a “contrast equation” which may form the basis for the definition of a length and a time scale. Multiplying the basic equation with vectors, pseudovectors, pseudoscalars and eventually hypercomplex numbers opens up the realm of possibilities to generate many further equations.

The most important plastic resins used for wire coating are Polyvinyl Chloride (PVC), Nylon, Polysulfone and Low-high density polyethylene (LDPE / HDPE). In this article,the coating process is performed using elastic-viscous fluid as a coating material for wire coating in a pressure type coating die. The elastic-viscous fluid is electrically conducted in the presence of an applied magnetic field. The governing non-linear equations are modeled and then solved analytically by utilizing an Adomian decomposition method (ADM). The convergence of the series solution is established. The results are also verified by Optimal Homotopy Asymptotic Method (OHAM). The effect of different emerging parameters such as non-Newtonian parameters α and β, magnetic parameter M and the Brinkman number Br on solutions (velocity and temperature profiles) are discussed through several graphs. Additionally, the current result also compares with the published work already available in the literature.

Mass transfer restrictions of scaffolds are currently hindering the development of three-dimensional (3D), clinically viable, and tissue engineered constructs. For this situation, a 3D poly(lactide-co-glycolide)/hydroxyapatite porous scaffold, which was much favorable for transfer of nutrients to and waste products from the cells in the pores, was developed in this study. The 3D scaffold had an innovative structure, including macropores with diameters of 300−450 μm for cell ingrowth and microchannels with diameters of 2−4 μm for nutrition and waste exchange. The mechanical strength in wet state was strong enough to offer the structural support. The typical structure was more beneficial for the attachment, proliferation, and differentiation of rabbit bone marrow mesenchymal stem cells (rBMSCs). The alkaline phosphatase (ALP) activity and calcium (Ca) deposition were evaluated on the differentiation of rBMSCs, and the results indicated that the microchannel structure was very favorable for differentiating rBMSCs into maturing osteoblasts. For repairing rabbit radius defects in vivo, there was rapid healing in the defects treated with the 3D porous scaffold with microchannels, where the bridging by a large bony callus was observed at 12 weeks post-surgery. Based on the results, the 3D porous scaffold with microchannels was a promising candidate for bone defect repair.

Densely urbanized areas, with a low percentage of green vegetation, are highly exposed to Heat Waves (HW) which nowadays are increasing in terms of frequency and intensity also in the middle-latitude regions, due to ongoing Climate Change (CC). Their negative effects may combine with those of the UHI (Urban Heat Island), a local phenomenon where air temperatures in the compact built up cores of towns increase more than those in the surrounding rural areas, with significant impact on the quality of urban environment, on citizens health and energy consumption and transport, as it has occurred in the summer of 2003 on France and Italian central-northern areas. In this context this work aims at designing and developing a methodology based on aero-spatial remote sensing (EO) at medium-high resolution and most recent GIS techniques, for the extensive characterization of the urban fabric response to these climatic impacts related to the temperature within the general framework of supporting local and national strategies and policies of adaptation to CC. Due to its extension and variety of built-up typologies, the municipality of Rome was selected as test area for the methodology development and validation. First of all, we started by operating through photointerpretation of cartography at detailed scale (CTR 1: 5000) on a reference area consisting of a transect of about 5x20 km, extending from the downtown to the suburbs and including all the built-up classes of interest. The reference built-up vulnerability classes found inside the transect were then exploited as training areas to classify the entire territory of Rome municipality. To this end, the satellite EO HR (High Resolution) multispectral data, provided by the Landsat sensors were used within a on purpose developed "supervised" classification procedure, based on data mining and “object-classification” techniques. The classification results were then exploited for implementing a calibration method, based on a typical UHI temperature distribution, derived from MODIS satellite sensor LST (Land Surface Temperature) data of the summer 2003, to obtain an analytical expression of the vulnerability model, previously introduced on a semi-empirical basis.

Proteins possess complex three-dimensional structures, and these structures are stable only within specific ranges of temperature which mostly correspond to the temperature ranges of the host organisms. However, few exceptional proteins, called heat-stable proteins, are stable at temperatures that are substantially higher than those tolerated by the host organisms themselves. Most of the heat-stable proteins possess heat stability to perform their functions at high temperatures, but some of them are intrinsically heat-stable due to their structure. Heat-stable proteins are usually divided into three or four groups depending upon the intricacies of their structures and thermal behaviors. Their peculiar property, i.e. heat-stability, makes them very valuable in applications such as polymerase chain reaction, industrial processes requiring high temperature, and protein engineering. Heat-stability also makes it feasible to purify such proteins, from the rest of the heat-labile proteins, using a simple heat-treatment method. Moreover, heat treatment can be used as a combined cell-lysis and protein purification step which, as compared to conventional methods, can result in a higher yield of heat-stable proteins. Furthermore, some special heat-stable proteins, i.e. intrinsically disordered proteins (which include the proteins involved in important neurodegenerative diseases), need heat-treatment step, in some cases, as the only way for their successful purification and study. Hence, this paper provides a first-ever comprehensive review of all major aspects of heat-stable proteins, i.e., their structure, evolution, classification, significance, and heat-treatment mediated purification.

In urban area, one of the great problem is the rise of temperature, which leads to form the urban heat island effect. This paper refers to the trend of the urban surface temperature extracted from the Landsat images from which to consider changes in the formation of surface urban heat island for the north of Ho Chi Minh city in period 1995-2015. Research has identified land surface temperature from thermal infrared band, according to the ability of the surface emission based on characteristics of normalized difference vegetation index NDVI. The results showed that temperature fluctuated over the city with a growing trend and the gradual expansion of the area of the high-temperature zone towards the suburbs. Within 20 years, the trend of the formation of surface urban heat island with two typical locations showed a clear difference between the surface temperature of urban areas and rural areas with space expansion of heat island in 4 times in 2015 compared to 1995. An extreme heat island located in the inner city has an area of approximately 18% compared to the total area of the region. Since then, the solution to reduce the impact of urban heat island has been proposed, in order to protect the urban environment and the lives of residents in Ho Chi Minh City becoming better

This study presents an exact solution to the free vibration analysis of a uniform Timoshenko beam, with a harmonic vibration being assumed. The Timoshenko beam theory covers cases associated with small deflections based on shear deformation and rotary inertia considerations. In this paper, a moment-shear force-circular frequency-curvature relationship was presented. The complete study was based on this relationship and closed-form expressions of efforts and deformations were derived. The free vibration response of single-span systems and spring-mass systems was analyzed; closed-form formulations of matrices expressing the boundary conditions were presented and the natural frequencies were determined by solving the eigenvalue problem. Systems with intermediate mass, spring, or spring-mass system were also analyzed. Furthermore, first-order dynamic stiffness matrices in local coordinates were derived. Finally, a second-order analysis of beams resting on an elastic Winkler foundation was conducted. The results obtained in this paper were in good agreement with those of other studies.

Exposure to malachite green (MG) may pose great health risks to humans, thus it is of prime importance to develop fast and robust methods to quantitatively screen the presence malachite green in environment. Herein application of extractive electrospray ionization mass spectrometry (EESI-MS) has been extended to the trace detection of MG within lake water and aquiculture water, due to the intensive use of MG as biocide in fisheries. This method has the advantage of obviating offline liquid-liquid extraction or tedious matrix separation prior to the measurement of malachite green in native aqueous medium. The experimental results indicate that the extrapolated detection limit for MG was ~3.8 ug L-1 (S/N=3) in lake water samples and ~ 0.5 ug L-1 in ultrapure water under optimized experimental conditions. The signal intensity of MG showed good linearity over the concentration range of 10–5000 ug L-1. Measurement of practical water samples fortified with MG at 0.01 and 0.1 mg L-1 gave a good validation of the established calibration curve. The average recoveries of malachite green in lake water and Carassius carassius fish farm effluent water were 114.9% (6.6% RSD) and 85.4% (9.2% RSD), respectively. Overall, the established EESI-MS/MS method has been demonstrated suitable for sensitive and rapid (<2 min per sample) quantitative detection of malachite green in various aqueous media, indicating its potential for online real-time monitoring of real life samples.

Cell-penetrating peptides (CPPs), a group of small peptides capable of promoting the transport of molecular cargo across the plasma membrane, have become important tools in promoting the cellular uptake of exogenously delivered macromolecules. GV1001, a peptide derived from a reverse-transcriptase subunit of telomerase (hTERT) and developed as a vaccine against various cancers, reportedly has unexpected CPP properties. Unlike typical CPPs, such as the HIV-1 TAT peptide, GV1001 enabled the cytosolic delivery of macromolecules such as proteins, DNA and siRNA via extracellular heat shock protein 90 (eHSP90) and 70 (eHSP70) complexes. The eHSP-GV1001 interaction may have biological effects in addition to its cytosolic delivery function. GV1001 was originally designed as a MHC class II-binding cancer epitope, but its CPP properties may contribute to its strong anti-cancer immune response relative to other telomerase peptide-based vaccines. Cell signaling via eHSP-GV1001 binding may lead to unexpected biological effects, such as direct anticancer or antiviral effects. In this review, we focus on the CPP effects of GV1001 bound to eHSP90 and ehsp70.

Industries, which are mainly responsible for high energy consumptions, need to invest in research projects in order to develop new managing systems for rational energy use and to tackle the devastating effects of climate change caused by human behavior. The study reported in this paper concerns the forging industry, where the production processes generally start with the heating of the steel in furnaces and continue with other processes, such as heat treatments and mechanical machining. One of the most critical operations, in terms of energy loss, is the opening of the furnace doors for the insertion and extraction operations. During this time, the temperature of the furnaces decreases by hundreds of degrees in a few minutes. Because the dispersed heat needs to be supplied again through the combustion of fuel, increasing the consumption of energy and the pollutant emissions, the evaluation of the amount of the lost energy is crucial for the development of operating or mechanical systems able to contain this dispersion. To perform this study, CFD simulation software was used. Results show that at the door opening, because of temperature and pressure differences between the furnace and the ambient, turbulences are generated. Results also show that the amount of energy lost for an opening of 10 minutes for radiation, convection and conduction is equal to 5606 MJ where convection is the main contributor with 5020 MJ. The model created, after being validated, has been applied to perform other simulations in order to improve the energy performance of the furnace. Results show that a reduction of the opening time of the door allows energy savings and limits pollutant emissions.

The oscillating heat pipe (OHP) is a new member in the family of heat pipes, and it has great potential applications in energy conservation. However, the fluid flow and heat transfer in the OHP as well as the fundamental effects of inner diameter on them have not been fully understood, which are essential to the design and optimization of the OHP in real applications. Therefore, by combining the high-speed visualization method and infrared thermal imaging technique, the fluid flow and thermal performance in the OHPs with inner diameters of 1, 2 and 3 mm are presented and analyzed. The results indicate that three fluid flow motions, including small oscillation, bulk oscillation and circulation, coexist or, respectively, exist alone with the increasing heating load under different inner diameters, with three flow patterns occurring in the OHPs, viz. bubbly flow, slug flow and annular flow. These fluid flow motions are closely correlated with the heat and mass transfer performance in the OHPs, which can be reflected by the characteristics of infrared thermal images of condensers. The decrease in the inner diameter increases the frictional flow resistance and capillary instability while restricting the nucleate boiling in OHPs, which leads to a smaller proportion of bubbly flow, a larger proportion of short slug flow, a poorer thermal performance, and easier dry-out of working fluid. In addition, when compared with the 2 mm OHP, the increasing role of gravity induces the thermosyphon effect and weakens the 'bubble pumping' action, which results in a little smaller and bigger thermal resistances of 3 mm OHP under small and bulk oscillation of working fluid, respectively.

Water resources provided by alpine glaciers are an important pillar for people living in the arid regions in the west of China. In this study, the HBV (Hydrologiska Byrans Vattenavdelning) light model was applied to simulate glacier mass balance and runoff in the Koxkar River Basin (KRB) on the south slope of Mt. Tumur, western Tianshan Mts.. Daily temperature and precipitation were calculated by multiple linear regressions and gradient-inverse distance weighting, respectively, based on in-situ observed data by automatic weather stations (AWSs) in the basin (2007–2009) and at four meteorological stations neighbering the basin (1959–2009). Observed daily air temperature and precipitation were taken as input data for the HBV model, which was calibrated using runoff in 2007/08 and 2009/10, and validated in 2008/09 and 2010/11. Generally, the model could simulate runoff very well. The annual glacier mass balance and runoff were calculated using the HBV model driven by interpolated meteorological data for the period of 1959–2009. The simulated glacier mass balance were reasonable when compared with those observed values at nearby glaciers, indicating a decrease trend of mass balance in the basin with an average value of –370.4 mm a^-1 since 1959. The annual runoff showed a slight increase trend (5.51 mm a^-1). Futher analysis indicated that the runoff is more sensitive to temperature than precipitation amuont in the Koxkar river basin.

In the present paper, laminar forced convection nanofluid flows in a uniformly heated horizontal tube were revisited by direct numerical simulations. Single and two-phase models were employed with constant and temperature-dependent properties. Comparisons with experimental data showed that the mixture model performs better than the single-phase model in the all cases studied. Temperature-dependent fluid properties also resulted in a better prediction of the thermal field. A particular attention was paid to the grid arrangement. The two-phase model was used then confidently to investigate the influence of the nanoparticle size on the heat and fluid flow with a particular emphasis on the sedimentation process. Four nanoparticle diameters were considered: 10, 42, 100 and 200 nm for both copper-water and alumina/water nanofluids. For the largest diameter dnp = 200 nm, the Cu nanoparticles were more sedimented by around 80 %, while the Al₂O₃ nanoparticles sedimented only by 2.5 %. Besides, it was found that increasing the Reynolds number improved the heat transfer rate, while it decreased the friction factor allowing the nanoparticles to stay more dispersed in the base fluid. The effect of nanoparticle type on the heat transfer coefficient was also investigated for six different water-based nanofluids. Results showed that the Cu-water nanofluid achieved the highest heat transfer coefficient, followed by C, Al₂O₃, CuO, TiO₂, and SiO₂, respectively. All results were presented and discussed for four different values of the concentration in nanoparticles, namely φ = 0, 0.6, 1 and 1.6%. Empirical correlations for the friction coefficient and the average Nusselt number were also provided summarizing all the presented results.

According to observations leptons are always produced in pairs. Both particles can be electrically charged, or just one, in which case the charged particle is accompanied by a particle specific neutrino. The period doubling process in nonlinear dynamical systems creates stable pair structures from the Planck units. The electron-positron pair is one of the stable structures, and the rest mass, electric charge and magnetic moment can be accurately calculated by the period doubling process. That the pair structure is stable means, that e.g., an electron and a positron are always born together. In the muon decay one of the pair is charged, while the other remains chargeless because there is only one charge available. It is suggested in this article that neutrino is the chargeless part of the lepton pair.

This study presents the comparison of heat transfer capacity and pressure drop characteristics between a basic fin-tube heat exchanger and a modified heat exchanger with the structural change of branch tubes and coiled turbulators. All experiments were carried out using an air-enthalpy type calorimeter based on the method described in ASHRAE standards, under heat exchanger experimental conditions. 14 different kinds of heat exchangers were used for the experiment. Cooling and heating capacities of the turbulator heat exchanger were excellent, compared to the basic one. As the insertion ratio of the coiled turbulator and the number of row increased, the heat transfer performance increased. However, the capacity per unit area was more effective in 4 rows than 6 rows, and the cooling performance of the 6 row turbulator heat exchanger (100% turbulator insert ratio) was down to about 6% than that of 4 row one. As the water flow rate and the turbulator insertion ratio increased, the pressure drop of the water side increased. This trend was more pronounced in 6 rows. In the cooling condition, the pressure drop on the air side was slightly increased due to the generation of condensed water, but was insignificant under the heating condition. The power consumption of the pump was more affected by the water flow rate than the coiled turbulator. The equivalent hydraulic diameter of a tube by the turbulator was reduced and then the heat transfer performance was improved. Thus, the tube diameter was smaller, the heat flux was better.

Modelling water vapour flow, heat transfer and porosity in porous adsorbent is somewhat challenging simulation problem. Primary macroscopic water vapour flow models, such as Darcy's law, fail to predict the pressure drop entirely correctly for the reason that many of flow parameters not considered because of the simplifications that remain made for the multi-scale structure of the porous adsorbents. For one to develop a good physical understanding of such water vapour flows and the accuracy of existing 3D simulation models, there is a need for some accurate 3D geometry to be studied. This present work describes two-phase water vapour flow and adsorption/ desorption performed on porous adsorbent by a Dynamic vapour sorption (DVS). The CFD simulation results are associated with experiments results. It is decided that for such complex porous adsorbent CFD simulation problems the use of COMSOL Multiphysics and SolidWorks flow simulation will be utilised.

In this work, we experimentally investigate mass and heat transport phenomena in a modular device while converting a solution salinity difference into a temperature difference. Operations occur under fixed total ambient pressure and without mechanical moving parts, thus realizing a fully static conversion. Provided that a constant salinity gradient can be imposed, the proposed device is able to generate a steady cooling capacity. Here, we purposely operate with environmentally benign and easily accessible sodium chloride water solutions only. A numerical model is finally elaborated, validated and used to explore a wider range of possible device configurations and operating conditions.

We aimed to explore university students’ perceptions and experiences of SARS-CoV-2 mass asymptomatic testing, social distancing and self-isolation during the COVID-19 pandemic. This qualitative study comprised of four rapid online focus groups conducted at a higher education institution in England during high alert (tier 2) national COVID-19 restrictions. Data were analysed thematically. Participants were purposively sampled university students (n = 25) representing a range of gender, age, living circumstances (on/off campus) and SARS-CoV-2 testing/self-isolation experiences. Six themes with 16 sub-themes emerged from the analysis of the qualitative data: ‘Term-time Experiences’, ‘Risk Perception and Worry’, ‘Engagement in Protective Behaviours’, ‘Openness to Testing’, ‘Barriers to Testing’ and ‘General Wellbeing’. Students described feeling safe on campus, believed most of their peers are adherent to protective behaviours and were positive towards asymptomatic testing in university settings. University communications about COVID-19 testing and social behaviours need to be timely and presented in a more inclusive way to reach groups of students who currently feel marginalised. Barriers to engagement with SARS-CoV-2 testing, social distancing and self-isolation were primarily associated with fear of the mental health impacts of self-isolation, including worry about how they will cope, high anxiety, low mood, guilt relating to impact on others and loneliness. Loneliness in students could be mitigated through increased intra-university communications and a focus on establishment of low COVID-risk social activities to help students build and enhance their social support networks. These findings are particularly pertinent in the context of mass asymptomatic testing programmes being implemented in educational settings and high numbers of students being required to self-isolate. Universities need to determine the support needs of students during self-isolation and prepare for the long-term impacts of the pandemic on student mental health and welfare support services.

This paper presents an optimized energy management strategy for Li-ion power batteries used on electric vehicles (EVs) at low temperatures. Under low-temperature environments, EVs suffer a sharp driving range loss resulted from the energy and power capability reduction of the battery. Simultaneously, because of Li plating, battery degradation becomes an increasing concern as temperature drops. All these factors could greatly increase the total vehicle operation cost. Prior to battery charging and vehicle operating, preheating battery to a battery-friendly temperature is an approach to promote energy utilization and reduce total cost. Based on the proposed LiFePO4 battery model, the total vehicle operation cost under certain driving cycles is quantified in the present paper. Then given a certain ambient temperature, a target temperature of preheating is optimized under the principle of minimizing total cost. As for the preheating method, a liquid heating system is also implemented on an electric bus. Simulation results show that the preheating process becomes increasingly necessary with a decreasing ambient temperature; however, the preheating demand declines as driving range grows. Vehicle tests verify that the preheating management strategy proposed in this paper is able to save total vehicle operation cost.

Metabolomics analysis generates vast arrays of data, necessitating comprehensive workflows involving expertise in analytics, biochemistry and bioinformatics, in order to provide coherent and high-quality data that enables discovery of robust and biologically significant metabolic findings. In this protocol article, we introduce NoTaMe, an analytical workflow for non-targeted metabolic profiling approaches utilizing liquid chromatography–mass spectrometry analysis. We provide an overview of lab protocols and statistical methods that we commonly practice for the analysis of nutritional metabolomics data. The paper is divided into three main sections: the first and second sections introducing the background and the study designs available for metabolomics research, and the third section describing in detail the steps of the main methods and protocols used to produce, preprocess and statistically analyze metabolomics data, and finally to identify and interpret the compounds that have emerged as interesting.

The textbook analysis of vacuum energy density (VED) in flat spacetime follows from Pauli’s lectures of 1951, in which quantum vacuum is modeled as a reservoir of free harmonic oscillators. In his lectures, Pauli shows that deriving a nearly vanishing VED is contingent upon fulfilling three corollary conditions called polynomial-in-mass-constraints. The goal of this work is to evaluate Pauli’s constraints against the Standard Model parameters and the Higgs mechanism of spontaneous symmetry breaking.

Technology is in the way to reach in its climax but the basic understanding of science in many phenomena is still awaited even though the nature witnesses it. Scientific research reveals strong analogy between photon and electron. When an atom deals neutral state, it levitates electron of outer ring from the back surface while placing the bit-energy at front surface. Gravitation behavior of that electron starts at the centre of relaxation point by including the force of side pole where the pulling force of nearby unfilled state of that atom from the front surface results into depict forcing energy shape like Gaussian distribution symbol with both ends turned called unit photon. The inertia is being involved at each stage of changing direction of that electron by introducing the disappearances of forces of two poles against the appearances of forces of two opposite poles during rest to motion and motion to rest in the first half-cycle. The same is the case in the second half-cycle of that electron during rest to motion and motion to rest but it is under different introduction of the disappearances of forces against appearances of forces. However, at stage of levitating or gravitating period of electron, only one force is being involved at one time where the opposite force is disappeared. The uninterrupted confined inter-state electron-dynamics of atom under the availability of several bits of bit-energy results into generate forcing energy shape like a wave. Two bits of bit-energy where shape of bit for first half-cycle is like integral symbol and second half-cycle is like opposite integral symbol which are being placed along the configuring trajectory of inter-state electron-dynamics during forward-direction cycle and two bits of bit-energy shape in opposite order are being placed along the trajectory of inter-state electron-dynamics during back-direction cycle. Generating forcing energy of unit photon in each cycle is pushing to the rear side by remaining connected till the electron is not restoring the state of rest. Silicon atom is considered as a model system under neutral state. Uninterrupted confined inter-state electron-dynamics result into generate forcing energy that can travel immeasurable length and unavailability of necessitating bit-energy at any interrupted stage result into generate an overt photon. Inter-state electron-dynamics for at least two cycles generate an overt photon –a photon length twice to unit photon. Under certain interaction of unit photon, it divides equally into two bits of bit-energy instead of dividing into tits and bits of heat. The mechanism of generating photon characteristic current by the electron of neutral state atom validates that atoms are four-dimensional discs at centre of dealing no force. An isolated electron is being grounded under directed forcing energy to impinge a neutral state atom where the gained instantaneous velocity under merged energy resulting into distort atom at that point. Matter changes the role of energy and force under various sorts of interactions. Here, heat energy and photon energy explore matter at atomic and electron levels, thus, devise basis of science to describe.

A structure-based view on mesons is given, based upon the concept of an archetype quark, described as a pointlike source producing an energy flux, the spatial description of which is derived from Dirac’s second dipole moment. This enables to conceive the archetype meson (pion) as a structure that behaves as a one-body anharmonic quantum mechanical oscillator. All mesons appear being excitations of the archetype, thereby allowing a calculation of the mass spectrum without the use of empirical parameters for the masses of the quark flavors. This includes a physically comprehensible analysis of the spin-spin interaction between quarks. It also provides a solution for the eta-etaprime puzzle. Next to this, it is shown that quite some particles that are presently regarded as elementary, have a common root and can be traced back to a few archetypes only.

The urbanization effects on land surface phenology (LSP) have been investigated by many studies, but few studies focused on the temporal variations of urbanization effects on LSP. In this study, we used the MODIS EVI, MODIS LST data and China’s Land Use/Cover Datasets (CLUDs) to investigate the temporal variations of urban heat island intensity and urbanization effects on LSP in Northeast China during 2001–2015. Land surface temperature (LST) and phenology differences between urban and rural areas represented the urban heat island intensity and urbanization effects on LSP, respectively. Mann-kendall nonparametric test and Sen's slope were used to evaluating the trends of urbanization effects on LSP and urban heat island intensity. The results indicated that the average land surface phenology (LSP) during 2001–2015 was characterized by high spatial heterogeneity. The start of the growing season (SOS) in old urban area had become earlier and earlier than rural area and the differences of SOS between urbanized area and the rural area changed greatly during 2001–2015 (−0.79 days/year, p < 0.01). Meanwhile, the length of the growing season (LOS) in urban and adjacent areas had become increasingly longer than rural area especially in urbanized area (0.92 days/year, p < 0.01), but the differences of the end of the growing season (EOS) between urban and adjacent areas did not change significantly. Next, the UHII increased in spring and autumn during the whole study period. Moreover, the correlation analysis indicated that the increasing urban heat island intensity in spring contributed greatly to the increases of urbanization effects on SOS, but the increasing urban heat island intensity in autumn did not lead to the increases of urbanization effects on EOS in Northeast China.

The present work aims to demonstrate that colloidal dispersions of magnetic iron oxide nanoparticles stabilized with dextran macromolecules placed in an alternating magnetic field can not only produce heat, but also that these particles could be used in vivo for local and non-invasive deposition of a thermal dose sufficient to trigger thermo-induced gene expression. Iron oxide nanoparticles were first characterized in vitro on a bio-inspired setup, and then they were assayed in vivo using a transgenic mouse strain expressing the luciferase reporter gene under transcriptional control of a thermosensitive promoter. Iron oxide nanoparticles dispersions were applied topically on the mouse skin or injected sub-cutaneously with Matrigel™ to generate so called pseudo tumors. Temperature was monitored continuously with a feedback loop to control the power of the magnetic field generator and to avoid overheating. Thermo-induced luciferase expression was followed by bioluminescence imaging 6 hours after heating. We showed that dextran-coated magnetic iron oxide nanoparticles dispersions were able to induce in vivo mild hyperthermia compatible with thermo-induced gene expression in surrounding tissues and without impairing cell viability. These data open new therapeutic perspectives for using mild magnetic hyperthermia as non-invasive modulation of tumor microenvironment by local thermo-induced gene expression or drug release.

While the majority of previous studies assessing pain-related variables in psychopaths used electric shocks, little is known about the effectiveness of alternative pain-inducing methods to increase emotional responses such as fear and anxiety. A small sample of healthy undergraduate men (N = 15) was recruited to assess the effectiveness of a heat stimulus to induce pain in an immediate versus delayed punishment paradigm. Although pain catastrophizing, anxiety, and threat of pain did not increase throughout the experiment, participants experienced a significant increase of fear of pain and pain intensity, indicating that the heat stimulus was effective in inducing pain. Furthermore, subjects were slower in initiating the pain stimulus during the first five trials, but no time difference was found during the 15 remaining trials. No correlation was found between psychopathic traits and pain-related variables, with the exception of inconsistent results within the Fearless Dominance factor. Findings are discussed in terms of improvement for a larger scale study involving psychopathic individuals.

The building envelope has the most significant contribution in the reduction of the building energy consumption. Application of new, alternative and improved materials and systems has an important impact on the buildings performances. This paper is focused on the thermal transmittance, as an indicator of the thermal conductance of the construction element. It includes comparisons of the U-values, calculated by software, with those measured in situ on three representative façade walls. The walls have been constructed with the new wall system Fragmat NZ-1, a new product in Macedonian buildings. This research provides basic information on the thermal transmittance of the system. The results of the analysis show that the in situ measuring is a useful tool in validation of the precision of analytically calculated values, since it was difficult to obtain precise results from the analytical calculations only, especially when the layers are with non-uniform thickness.

The purpose of this study is to check out the involvement of entropy in Mpemba effect. Provided that preheating of the water the cooling duration is reduced, we theoretically show that water gains more entropy when warmed and re-cooled to the original temperature.

Lactoperoxidase (LP), which is a high-value minor whey protein, has recently drawn extensive attention from research scientists and industry due to its multi-function and potential therapeutic applications. In this study, the separation and optimization of two similar-sized proteins, LP and lactoferrin (LF) were investigated using strong cation exchange column chromatography. Optimization was started with central composite design based experiments to characterize the importance of different decision variables. The three variables used in the optimization were flow rate, length of gradient and final salt concentration in the linear elution gradient step. The obtained empiric functional model represented the effect of the significant factors on the yield as the objective function. Afterwards, the calibrated mechanistic model was employed to predict accurate optimal set of variables. The optimal operating points were found and the results were compared with validation experiments. Predictions respecting yield confirmed a very good agreement with experimental results while keeping purity, a product quality characteristic, equal or above to a predefined value.

Background: Pittosporum tobira (Thunb.) Aiton is an aromatic medicinal plant widely cultivated in the world. However, the essential oils (EOs) from P. tobira flowers for anti-cancer potential is still not systematically studied. The present aim to elucidate the phytochemical composition of the EOs and to explore mechanism of anticancer action. Methods: The EOs were extracted and analyzed by headspace solid-phase microextraction (HS-SPME) with gas chromatography-mass spectrometry (GC-MS). Volatile components were identified according to Kovats retention index (KI) and NIST database. The anti-neoplasm mechanisms of the EOs was comprehensively investigated in lung carcinoma A549 and H460 cells. Results: A total of 47 secondary metabolites representing 94.18% of the EOs were successfully identified: monoterpenes and sesquiterpenes were the dominant terpenoids. The EOs exhibited antiproliferative activity on A549 and H460 lung carcinoma cells. Hoechst 33324 fluorescent staining indicated the typical characteristics of apoptosis and induced cycle phase arrest. AnnexinV/PI staining revealed that the number of apoptotic cells was increased. Furthermore, the EOs also induced the caspase-mediated mitochondrial apoptosis pathway. Conclusions: Findings suggest that the full-scale chemical composition and first characterization of anticancer activities of the EOs, it could be used for integrative natural anti-cancer agents in health care should be pay more attention.

We propose a new theory beyond the standard model of elementary-particle physics. Employing the concept of a quantized spacetime, our theory demonstrates that the zero-point energy of the vacuum alone is sufficient to create all the fields, including gravity, the static electromagnetic field, and the weak and strong interactions. No serious undetermined parameters are assumed. Furthermore, the relations between the forces at the quantum-mechanics level is made clear. Using these relations, we quantize Einstein’s gravitational equation and explain the Dark Energy in our universe. Beginning with the zero-point energy of the vacuum, and after quantizing Newtonian gravity, we combine the energies of a static electromagnetic field and gravity in a quantum spacetime. Applying these results to the Einstein gravity equation, we substitute the energy density derived from the zero-point energy in addition to redefining differentials in a quantized spacetime. We thus derive the quantized Einstein gravitational equation without assuming the existence of macroscopic masses. This also explains the existence of the Dark Energy in the universe. For the weak interaction, by considering plane-wave electron and the zero-point energy, we obtain a wavefunction that represents a β collapse. In this process, from a different point of view than Weinberg-Salam theory, we derive the masses of the W and Z bosons and the neutrino, and we calculate the radius of the neutron. For the strong interaction, we previously reported an analytical theory for calculating the mass of a proton by considering a specific linear attractive potential obtained from the zero-point energy, which agrees well with the measurements. In the present study, we calculate the strong interaction between two nucleons, i.e., the mass of the pi-meson. The resulting calculated quantities agree with the measurements, which verifies our proposed theory.

Obesity is treatment-resistant, and is linked with a number of serious, chronic diseases. Adult obesity rates in the United States have tripled since the early 1960s. Recent reviews show that an increased ratio of omega-6 to omega-3 fatty acids contributes to obesity rates by increasing levels of the endocannabinoid signals AEA and 2-AG, overstimulating CB₁R and leading to increased caloric intake, reduced metabolic rates, and weight gain. Cannabis, or THC, also stimulates CB₁R and increases caloric intake during acute exposures. The present meta-analysis reveals significantly reduced body mass index and rates of obesity in Cannabis users, in conjunction with increased caloric intake. We provide for the first time a causative explanation for this paradox, in which rapid and long-lasting downregulation of CB₁R following acute Cannabis consumption reduces energy intake and storage and increases metabolic rates, thus reversing the impact on body mass index of elevated dietary omega-6/omega-3 ratios.

We apply principles of Gibbs phase plane chemistry to and across the entire ocean-atmospheric interface. Surface tension increments support a two dimensional, tangential pressure well known to determine rates of bulk gas, bubble, salt, spray and momentum transfer plus both sensible and latent heat fluxes. Hence it is worth asking whether tension mapping follows from current understanding of two dimensional composition. A history is provided dating back centuries and demonstrating that detrital organic macromolecules are central; subtle surfactant functional variation creates a microforcing field which dissipates turbulent energy at the sub-meter scale. Since we have just distributed major biopolymeric classes emitted as primary organic aerosol, further climate links can be established by considering full planar thermochemistry. Organic microlayer behaviors are reviewed with attention to confined, analog phase transitions among two dimensional “solid, liquid, (and) gaseous” states serving as elasticity indicators. We also discuss surfactant properties of general marine dissolved organic carbon, demonstrating that only proteins and lipids are capable of occupying significant local micro-area. The literature often suggests albumin and stearic acid as best proxies, and so we distribute their concentrations through multilevel global ecodynamic simulations. Consensus distributions are obtained in order to control adsorptive equilibria. Working from conservation of planar free energy, a parametric equation of state is devised relating excess coverage to the surface pressure-modulus. Constant settings for the proxy pair are drawn from laboratory study, and they successfully reproduce frequencies for surfactant solid-to-gas occurrence in ambient compression experiments. Functionally resolved organic measurements are rare and so we group them into super-ecological province tables showing that our bulk concentration estimates are reasonable. Outputs are then fed into a coverage-tension-elasticity code. Resulting contours traverse the critical range for piston velocity, bubble-spray and damping effects on either a regional or seasonal basis. There is also a possibility for widespread microlayer crystallization in polar seas. The concepts are a direct extension of our organic aerosol work, and the two approaches could be inserted into Earth System Models in tandem. Uncertainties in the logic are enumerated and include kinetic and thermochemical factors at multiple scales. But the problems are reducible through molecular modeling coupled to renewed laboratory and field study. Connections to marine colloids-gels, microlayer iron chelation, and linings of the ice channel network are discussed additionally.

Despite the increasing number of individuals affected by Alzheimer’s disease (AD) every year, no effective therapy has been developed to treat this neurodegenerative disease yet. The current methods for AD diagnosis are effective for clinical confirmation of the disease only when symptoms become apparent, years after molecular damage started within the patients’ brains. As higher expression of a conformationally altered p53 has been correlated with AD, we developed a mass spectrometry-based method for highly sensitive, specific, and reproducible quantification of a p53 conformational variant in plasma samples of patients with known clinical outcome. In particular, we tested the prognostic performance of an AD-specific 2D3A8-immunoselected p53 peptide (AZ 284™) in different sets of individuals progressing from both cognitively unimpaired (CU) and mild cognitive impairment (MCI) patients progressing to AD dementia. Our data showed that quantitative analysis of AZ 284™ is a reliable tool for predicting AD progression up to 6 years prior to dementia onset with AUC >90%. Taken together, these results support the implementation of p53 conformational variant quantification as an affordable and powerful diagnostic tool for early, non-invasive AD diagnosis.

Following the 2001 end to negotiations on a legally binding protocol, Biological and Toxin Weapons Convention (BWC) states parties (SPs) developed entrenched positions about the necessity of a verification regime, hindering progress on treaty aims. This study aimed to facilitate dialogue on verification-related issues outside the context of those positions, using the term "assurance" to represent the degree of certainty that SPs are meeting their treaty obligations. From August 2020-July 2021, 36 interviews were conducted—16 SPs' delegations and 20 subject matter experts, representing 20 countries—and interview content was analyzed utilizing a mixed methods approach, including quantitative metrics on qualitative interview content. Interviewees' views on verification, compliance, and related concepts varied widely. Efforts by SPs to achieve common understanding on these topics could facilitate concrete progress in these important areas. While no single mechanism is sufficient to achieve verification or assess compliance, packages of mechanisms could increase assurance. There was general support for implementing assurance mechanisms, even in the absence of a comprehensive, legally binding protocol or verification regime, even among SPs for which that is the primary goal. Avenues to increase assurance among BWC stakeholders merit further discussion in the Intersessional Programme following the 9^th BWC Review Conference.

In this work, we investigated the effects of heat treatment on the microstructure, hydrogen storage characteristics and corrosion rate of a Ti₃₄V₄₀Cr₂₄Fe₂ alloy. The arc melted alloy was divided into three samples, two of which were separately quartz-sealed under vacuum and heated to 1000 °C for 1 h; one of these samples was quenched and the other furnace cooled to ambient temperature. The crystal structures of the samples were studied via X-ray diffractometry and scanning electron microscopy. Absorption/desorption characteristics were investigated using a Sievert apparatus. Potentiostat corrosion tests on the alloys were performed using an AutoLab^® corrosion test apparatus and electrochemical cell. All samples exhibited a mixture of body-center-cubic (BCC) and Laves phase structures. The corrosion rate, maximum absorption, and useful capacities increased after both heat treatments. The annealed sample had the highest absorption and reversible capacity. The plateau pressure of the as-cast alloy increased after quenching. The corrosion rate increased from 0.0004 mm/y in as-cast sample to 0.0009 mm/y after annealing and 0.0017 mm/y after quenching, due to a decrease in the Cr-content of the C14 phase.

This paper evaluates the potential of solar concentration technologies—compound parabolic collector (CPC), linear Fresnel collector (LFC) and parabolic trough collector (PTC)—as an alternative to conventional sources of energy for industrial processes in Latin America, where high levels of solar radiation and isolated areas without energy supply exist. The analysis is addressed from energy, economic and environmental perspective. A specific application for Argentina in which fourteen locations are analyzed is considered. Results show that solar concentration technologies can be an economically and environmentally viable alternative. Levelized cost of energy (LCOE) ranges between 2.5 and 16.9 c€/kWh/m² and greenhouse gas (GHG) emissions avoided range between 33 and 348 kgCO₂/(m²·year). CPC technology stands out as the most recommendable technology when the working fluid temperature ranges from 373K to 423K. As the working fluid temperature increases the differences between the LCOE values of the CPC and LFC technologies decrease. When 523K is reached LFC technology is the one which presents the lowest LCOE values for all analyzed sites, while the LCOE values of PTC technology are close to CPC technology values. Results show that solar concentration technologies have reached economic and environmental competitiveness levels under certain scenarios, mainly linked to solar resource available, thermal level requirements and solar technology cost.

The present investigation has been conducted on one hundred tissue fragments of breast cancer, collected and immediately cryopreserved following the surgical resection. The fragments were selected from patients with invasive ductal carcinoma of the breast, the most common and potentially aggressive type of mammary cancer, with the objective to increase the knowledge of breast cancer molecular markers, useful for diagnostic and prognostic categorization of patients, in assessing post-surgical therapeutic regimes. The proteomic screening, by 2D-IPG and mass spectrometry, allowed us to identify two main classes of protein clusters: proteins expressed ubiquitously at high levels in all patients, and proteins expressed sporadically among the same patients. Within the group of ubiquitous proteins, glycolytic enzymes and proteins with anti-apoptotic activity were predominant. Among the sporadic ones, proteins involved in cell motility, molecular chaperones and proteins involved in the detoxification appeared prevalent. The data of the present study indicates that the primary tumor growth is generally supported by two concurrent pathways: the inhibition of apoptosis and the stimulation of cellular proliferation. The second phase of the evolution of the tumor can be prematurely scheduled by the occasional presence of proteins involved in cell motility and in the defenses of the oxidative stress. To our knowledge this report on large-scales proteomics of breast cancer is currently a unique approach in the literature that offers the opportunity to evaluate the presence and recurrence of proteins to be used as prognostic indicators and susceptibility to metastasis in patients operated on for invasive ductal carcinoma of the breast.

This paper addresses the modeling of the iron ore direct reduction process, a process likely to reduce CO₂ emissions from the steel industry. The shaft furnace is divided into three sections (reduction, transition, and cooling), and the model is two-dimensional (cylindrical geometry for the upper sections and conical geometry for the lower one), to correctly describe the lateral gas feed and cooling gas outlet. This model relies on a detailed description of the main physical–chemical and thermal phenomena, using a multi-scale approach. The moving bed is assumed to be comprised of pellets of grains and crystallites. We also take into account eight heterogeneous and two homogeneous chemical reactions. The local mass, energy, and momentum balances are numerically solved, using the finite volume method. This model was successfully validated by simulating the shaft furnaces of two direct reduction plants of different capacities. The calculated results reveal the detailed interior behavior of the shaft furnace operation. Eight different zones can be distinguished, according to their predominant thermal and reaction characteristics. An important finding is the presence of a central zone of lesser temperature and conversion.

The study conducted in this paper is focused on a predominantly residential area of the City of Ljubljana – Koseze, which is characterized by generally favorable (bio)climatic conditions. Nonetheless, thermal satellite imaging showed that residential neighborhoods within the Koseze district display unexpected variations in summer temperatures. This observation called into question the benefits of existing bioclimatic features and indicated the need to investigate and compare two neighborhoods with similar urban parameters, with the aim to identify morphological differential characteristics impacting urban heat island (UHI) intensity. By applying the study methodology based on a literature review, surveys of key precedents, detailed mapping in two Koseze locations, in situ measurements, observations and recordings, thermal imaging and the analyses of statistical data, as well as by defining the four main categories of morphological urban parameters – structure, cover, fabric and metabolism, it was concluded that both neighborhoods have common morphological elements mitigating the UHI effect. Additionally, it was found that the neighborhood with higher UHI intensity has several less favorable features, such as busier roads, larger surface of parking corridors, and the existence of underground parking space. The traffic as an element of urban morphology hence represents the main cause of differences among UHI levels in the two Koseze neighborhoods.

Among all the processing technologies of heat-treatable aluminum alloys like 2219 aluminum alloy, using friction stir welding (FSW) as the joining technology and using electromagnetic forming (EMF) for plastic forming technology both have obvious advantages and successful applications. Therefore, there is a broad prospect for the compound technologies which can be used on the 2219 aluminum alloy to manufacture the large-scale thin-wall parts in the astronautic industry. The microstructure and mechanical properties of 2219 aluminum alloy under the process compounded of FSW, heat treatment, and EMF were investigated by means of tensile test, optical microscope (OM), and scanning electron microscope (SEM). The results show that the reduction of strength, which was caused during the FSW process, can be recovered effectively by the post-welding heat treatment composed of solid solution and aging, while the ductility was still reduced after heat treatment. Under the compound technology of FSW, heat treatment, and EMF, the forming limit of 2219 aluminum alloy decreased distinctly due to the poor ductility of the welding joint. A ribbon-pattern, which was formed due to the banded structure caused by FSW process, was found on the fracture surface of welded 2219 aluminum alloy after EMF treatment. During the EMF process, because of the effects of induced eddy current, a unique structure, which was manifested as a molted-surface appearance under the SEM observation, was formed as the material fractured.

It is shown that the 5D geodetic equations and 5D Ricci identities give us a way to create a new viewpoint on some problems of Modern Physics, Astrophysics, and Cosmology. Specifically, the application of the 5D geodetic equations in (4+1) and (3+1+1) splintered forms obtained with the help of the monad and dyad methods made it possible to introduce a new, effective generalized concept of the rest mass of the elementary particle. The latter leads one to novel connections between the General Relativity and quantum field theories, as well as all of that, including the (4+1) splitting of the 5D Ricci identities, brings about a better understanding of the magnetic monopole problem and the vital difference in the origins of the Maxwell equations and gives rise to surprising connections between them. The obtained results also provide new insight into the mechanism of the 4D Universe’s expansion and its following acceleration.

As paradigm of complex behavior, Self-organized Criticality (SOC) reflects the ability of nonequilibrium dynamical systems to self-adjust into metastable states that are scale independent. The goal of this report is to tentatively show that the hierarchy of Standard Model masses and mixing angles follows from the universal scaling attributes of SOC.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

In this study, we describe quark confinement in terms of linear interaction potentials and solve the problem of the net spin of a proton. The three quarks in a proton are assumed to revolve around a common center, and their masses are determined assuming they are Dirac particles. On the basis of these assumptions, the magnetic moment of a proton can be derived. Moreover, the rotation of the quarks is considered, in which an electrical current induces a magnetic field. Thus, the scalar product of the magnetic moment and field describes the linear interaction potential between the quarks, and the mass of the proton can be obtained. The proton mass predicted by this physical model is consistent with experimental values, and no numerical or fitting calculations are required. Furthermore, using the newly derived spins and angular momentum of the three quarks, we derived the net spin of a proton. Additionally, we predicted the mass of a pi-meson from the same model, which agrees with the experimental values.

The air side thermal hydraulic performance of multi-louvered aluminium fin heat exchangers is investigated. A detailed study was performed to analyse the thermal performance of air over a wide range of Reynolds number i.e. from 30 to 250. Air-side heat transfer coefficient and air pressure drop were calculated and validated over the mentioned band of Reynolds numbers. Critical Reynolds number was determined numerically and the variation in flow physics along with the thermal and hydraulic performance of microchannel heat exchanger associated with R_cri has been reported. Moreover, a parametric study of the multi-louvered aluminium fin heat exchangers was also performed for 36 heat exchanger configurations with the louver angles (19-31°), fin pitches (1.0, 1.2, 1.4 mm) and flow depths (16, 20, 24 mm); and the geometric configuration exhibiting the highest thermal performance was reported. The air-side heat transfer coefficient and pressure drop results for different geometrical configurations were presented in terms of Colburn j factor and Fanning friction factor f, as a function of Reynolds number based on louver pitch.

NASA mission systems proposals are often compared using an equivalent system mass (ESM) framework wherein all elements of technology to deliver an effect- its components, operations and logistics of delivery- are converted to effective masses since this has a known cost scale in space operations. To date, ESM methods and the tools for system comparison have not considered complexities wherein systems that serve a mission span multiple transit and operations stages, such as would be required to support a crewed mission to Mars, and thus do not account for the different mass equivalency factors operational during each period and the inter-dependencies of the costs across the mission. Further, ESM does not account well for the differential reliabilities of the underlying technologies. Less reliability should incur an equivalent mass cost for technologies that might otherwise provide a mass advantage. We introduce an extensions to ESM to address these limitations and show that it provides a direct method for analyzing, optimizing and comparing different mission systems. We demonstrate our extended ESM (xESM) calculation with crop production technologies -- an aspect of the developing offworld biomanufacturing suite -- since it represents a case with strong coupling among stages of the mission and a relatively high-risk profile.

Assuming a geometrically closed universe, we predict a value for the cosmic curvature, , a value within current observational bounds. We also propose a thermodynamic heat engine model for the universe, which bypasses the need for an inflaton field. Our model is based on a Carnot Cycle where we have isothermal expansion, followed by adiabatic expansion, followed by isothermal contraction, followed by adiabatic contraction, bringing us back to our original starting point. For the working substance, we focus specifically on the CMB radiation filling the collective voids in the universe. Using this construct, we identify cosmic inflation as the isothermal expansion phase, which lasts just under, . The collective CMB volume we see today only increases by a factor of 5.65 times during this process, and homogeneity and perturbations in the CMB are explained. The singularity problem is avoided and we have a clear mechanism for the work done by the cosmos in causing expansion, and later contraction. For scaling laws with respect to the density parameters in Friedmann’s equations, we will assume a susceptibility model for space, where, , the smeared cosmic susceptibility, decreases with increasing cosmic scale parameter, . Within this framework, we can predict a maximum Hubble volume with minimum CMB temperature for the voids before contraction begins, as well as a minimum volume with maximum CMB temperature when expansion starts. The thermodynamic heat cycle deviates from efficiency in converting heat energy into mechanical energy (expansion) by a minuscule amount, namely, . The significance of this number is not known.

In this paper we show that the Schwarzschild radius can be extracted easily from any gravitationally-linked phenomena without having knowledge of the Newton gravitational constant or the mass size of the gravitational object. Further, the Schwarzschild radius can be used to predict any gravity phenomena accurately, again without knowledge of the Newton gravitational constant and also without knowledge of the size of the mass, although this may seem surprising at first. Hidden within the Schwarzschild radius are the mass of the gravitational object, the Planck mass (their relative mass), and the Planck length. We do not claim to have all the answers, but this seems to indicate that gravity is quantized, even at a cosmological scale, and this quantization is directly linked to the Planck units. This also supports our view that the Newton gravitational constant is a universal composite constant of the form $G=\frac{l_p^2{c}^3}{\hslash }$ , rather than relying on the Planck units as a function of G. This does not mean that Newton’s gravitational constant is not a universal constant, but that it is instead a composite universal constant that depends on the Planck length, the speed of light, and the Planck constant. Further, $\frac{G\times 1\hspace{0.17em}\mathrm{weight}\hspace{0.17em}\mathrm{unit}}{c^2}=\frac{G}{c^2}$ is the Schwarzschild radius off one weight unit. So G is only needed when we want to use gravity to find the weight of an object, such as weighing the Earth. This is, to our knowledge, the first paper that shows how a long series of major gravity predictions and measurements can be completed without any knowledge of the mass size of the object, or Newton’s gravitational constant. As a minimum we think it provides an interesting new angle for evaluating existing gravity theories, and it may even give us a small hint on how to combine quantum gravity with Newton and Einstein gravity.

Transposable elements (TEs) are highly abundant in plant genomes. Environmental stress is one of the critical stimuli that activate TEs. We analyzed a heat-activated retrotransposon named ONSEN in cruciferous vegetables. The multiple copies of ONSEN-like elements (OLEs) were found in all the cruciferous vegetables that were analyzed. The copy number of OLE was abundant in Brassica oleracea, which includes cabbage, cauliflower, broccoli, Brussels sprout, and kale. Phylogenic analysis demonstrated that some OLEs transposed after the allopolyploidization of parental Brassica species. Furthermore, we found that the increasing number of OLEs in B. oleracea appeared to be induced transpositional silencing by epigenetic regulation, including DNA methylation. The results of this study would be relevant to the understanding of evolutionary adaptations to thermal environmental stress in different species.

Starting from the SU(2) group of weak interactions in the presence of Electric Charge Swap (ECS) symmetry, we show that ordinary and non-regular (ECS) leptons are related by the ECS rotational group SO(3). We find that many Standard Model (SM) algebras depend on the sin of the angle θs of the ECS rotational group SO (3). We call these ECSM algebras. Furthermore, the break of the gauge symmetry of the SM groupoid gives the massive ECS particle. We find that the ECS particle masses are related with the SM particle masses by sinθs . We also investigate the finite subgroups of the ECS Möbius transformations. We find that sinθs could be derived from the ECS dihedral group DF, which refers to the symmetry of the fermionic polygon (F-gon). The average value of the anchor of the SM algebroid depends on the fermionic Catalan numbers (CF). Finally, we find that the ECS physics at loop level differs the SM physics. The ECSM mass is suppressed by the CF numbers. For 24 fermions, the calculated one-loop radiative correction to the bare Higgs mass µ is 125GeV—a value very close to the experimental one.

In this paper, an improved system to efficiently utilize the low-temperature waste heat (WHUS) from the flue gas of coal-fired power plants is proposed based on heat cascade. The essence of the proposed system is that the waste heat of exhausted flue gas is not only used to preheat air for assisting coal combustion as usual but also to heat up feedwater and the low-pressure steam extraction. Preheated by both the exhaust flue gas in the boiler island and the low-pressure steam extraction in the turbine island, thereby part of the flue gas heat in the air preheater can be saved and introduced to heat the feedwater and the high-temperature condensed water. Consequently, part of the high-pressure steam is saved for further expansion in the steam turbine, which obtains additional net power output. Based on the design data of a typical 1000 MW ultra-supercritical coal-fired power plant in China, in-depth analysis of the energy-saving characteristics of the optimized WHUS and the conventional WHUS is conducted. When the optimized WHUS is adopted in a typical 1000 MW unit, net power output increases by 19.51 MW, exergy efficiency improves to 45.46%, and net annual revenue reaches 4.741 million USD. In terms of the conventional WHUS, these aforementioned performance parameters are only 5.83 MW, 44.80% and 1.244 million USD, respectively. The research of this paper can provide a feasible energy-saving option for coal-fired power plants.

The objective of this study was to investigate the relationship between coffee consumption and obesity in Korean women. We included 5,995 women who participated in a health screening examination at the Korean National Cancer Center between 2007 and 2016. Daily coffee consumption was evaluated using the food frequency questionnaire. Obesity was assessed by body mass index (BMI), and abdominal obesity was assessed by waist circumference (WC). A multiple logistic regression model was used to calculate the odds ratio (OR) of obesity according to coffee consumption. After multivariate adjustment, high coffee consumption was positively associated with obesity measured by BMI (≥ 3 cups vs. no drinks, OR = 2.52; 95% confidence interval (CI) = 1.91-3.34; P for the trend < 0.001) and abdominal obesity measured by WC (≥ 3 cups vs. no drinks, OR = 2.11; 95% CI = 1.59-2.79; P for the trend < 0.001). The positive association between daily coffee consumption and obesity prevalence was not altered by menopause. The amount of coffee consumed per day by Korean women was positively correlated with the prevalence of obesity, but the mechanism underlying this phenomenon remains to be elucidated.

The importance of predicting the exposure to environmental hazards is highlighted by issues like global climate change, public health problems caused by environment stresses, and property damages and depreciations. Several approaches have been used to assess potential exposure and achieve optimal results under various conditions, for example, for different scales, groups of people, or certain points in time. Micro-simulation tools are becoming increasingly important in human exposure assessment, where each person is simulated individually and continuously. This paper describes an agent-based model (ABM) framework that can dynamically simulate human exposure levels, along with their daily activities, in urban areas that are characterized by environmental stresses such as air pollution and heat stress. Within the framework, decision making processes can be included for each individual based on rule-based behavior to achieve goals under changing environmental conditions. The ideas described in this paper are implemented in a free and open source NetLogo platform. A simplified modeling scenario of the ABM framework in Hamburg, Germany, further demonstrates its utility in various urban environments and individual activity patterns, and portability to other models, programs and frameworks. The prototype model can potentially be extended to support environmental incidence management by exploring the daily routines of different groups of citizens and compare the effectiveness of different strategies. Further research is needed to fully develop an operational version of the model.

Assuming a two component, positive and negative mass, superfluid/supersolid for space (the Winterberg model), we model the Higgs field as a condensate made up of a positive and a negative mass, planckion pair. The connection is shown to be consistent (compatible) with the underlying field equations for each field, and the continuity equation is satisfied for both species of planckions, as well as for the Higgs field. An inherent length scale for space (the vacuum) emerges, which we estimate from previous work to be of the order of,

In this paper only one basic assumption has been made: if we try to describe black holes, their behavior should be understood in the same language as the one we use for particles; black holes should be treated just like atoms. They must be quantum forms of matter, moving in accordance with Schrödinger equations just like everything else. In particular, Rosen’s quantization approach to the gravitational collapse is applied in the simple case of a pressureless “star of dust” by finding the gravitational potential, the Schrödinger equation and the solution for the collapse’s energy levels. By applying the constraints for a Schwarzschild black hole (BH) and by using the concept of BH effective state, previously introduced by one of the authors (CC), the BH quantum gravitational potential, Schrödinger equation and the BH energy spectrum are found. Remarkably, such an energy spectrum is in agreement (in its absolute value) with the one which was conjectured by Bekenstein in 1974 and consistent with other ones in the literature. This approach also permits to find an interesting quantum representation of the Schwarzschild BH ground state at the Planck scale. Moreover, two fundamental issues about black hole quantum physics are addressed by this model: the area quantization and the singularity resolution. As regards the former, a result similar to the one obtained by Bekenstein, but with a different coefficient, has been found. About the latter, it is shown that the traditional classical singularity in the core of the Schwarzschild BH is replaced, in a full quantum treatment, by a two-particle system where the two components strongly interact with each other via a quantum gravitational potential. The two-particle system seems to be non-singular from the quantum point of view and is analogous to the hydrogen atom because it consists of a “nucleus” and an “electron”.

The present work describes the optimization and validation of a highly selective and sensitive analytical method using solid phase extraction and liquid chromatography tandem mass spectrometry (SPE LC-MS/MS) for the determination of some frequently prescribed pharmaceuticals in urban wastewater received and treated by Sharjah sewage treatment plant (STP). The extraction efficiency of different SPE cartridges was tested and the simultaneous extraction of pharmaceuticals was successfully accomplished using hydrophilic-lipophilic-balanced reversed phase Waters^® Oasis HLB cartridge (200 mg/ 6 mL) at pH 3. The analytes were separated on an Aquity BEH C₁₈ column (1.7 µm, 2.1 mm x 150 mm) using gradient elution and the mass spectrometric analysis were performed in multiple reactions monitoring (MRM) selecting two precursor ions to produce ion transition for each pharmaceutical using positive electrospray ionization (+ESI) mode. The correlation coefficient values in the linear calibration plot for each target compound exceeded 0.99 and the recovery percentages of the investigated pharmaceuticals were more than 84%. Limit of detection (LOD) varied between 0.1-1.5 ng/L and limit of quantification (LOQ) was 0.3-5 ng/L for all analytes. The precision of the method was calculated as the relative standard deviation (RSD%) of replicate measurements and was found to be in the ranges of 2.2% to 7.7% and 2.2% to 8.6% for inter and intra-day analysis, respectively. All of the obtained validation parameters satisfied the requirements and guidelines of analytical method validation.

As the energy efficiency demands for future buildings become increasingly stringent, preliminary assessments of energy consumption are mandatory. These are possible only through numerical simulations, whose reliability crucially depends on boundary conditions. We therefore investigate their role in numerical estimates for the usage of geothermal energy, performing annual simulations of transient heat transfer for a building employing a geothermal heat pump plant and energy piles. Starting from actual measurements, we solve the heat equations in 2D and 3D using COMSOL Multiphysics and IDA-ICE, and discover a negligible impact of the multiregional ground surface boundary conditions. Moreover, we verify that the thermal mass of the soil medium induces a small vertical temperature gradient on the piles surface. We also find a roughly constant temperature on each horizontal cross-section, with nearly identical values if the average temperature is integrated over the full plane or evaluated at one single point. Calculating the yearly heating need for an entire building we then show that the chosen upper boundary condition affects the energy balance dramatically. Using directly the pipes’ outlet temperature induces a 54% overestimation of the heat flux, while the exact ground surface temperature above the piles reduces the error to 0.03%.

Since the first generation of 7xxx superhard aluminum alloy was investigated in 1930, hitherto the fifth generation aluminum alloy materials with high comprehensive properties such as high static strength, high strength, heat resistance, high toughness, damage resistance, low density and low quenching sensitivity have been improved and developed. This paper reviews the progress of 7xxx aluminum alloy materials in composition, microstructure, properties, preparation methods, heat treatment strengthening and applications from 2014 to 2021. The effect of adding trace elements on microstructure and properties of 7xxx series alloy and the problems existing in aging precipitation characteristics and reinforcement mechanism are discussed. The future development direction of 7xxx superhard aluminum alloy is prospected by optimizing heat treatment technological, adding appropriate trace elements to alloy and controlling alloy microstructure.

Efforts to quantify and reduce greenhouse gas (GHG) emissions of the built environment often neglect embodied emissions, instead focusing on reducing emissions from building operations. Utilizing sustainably sourced mass timber offers low embodied carbon alternatives to traditional concrete and steel structural systems, however the variability in embodied carbon for different mass timber approaches remains understudied. In this study, we used life cycle assessment (LCA) to compare the whole building embodied carbon of nine mass timber design options and two typical concrete and steel reference cases for an eight-story mixed-use building, ensuring structural, acoustic, thermal, programmatic, and fire-rating equivalence between the designs. The study found that the mass timber designs vary significantly, ranging between a 14-52% reduction in whole building embodied carbon from the most impactful reference case, and a 31-73% reduction when considering the structural systems alone. This study demonstrates the value that whole building LCA (WBLCA) provides as a primary driver for low-carbon structural system design and architectural development of mass timber buildings, beyond that of single material comparisons using environmental product declarations (EPDs).

In this work, we present a new way to study the genetic code mathematical and chemical structure, based on the use of mathematical computations involving some few recently designed Fibonacci-like sequences, the “seeds” (“initial conditions”) of which are chosen according to the chemical and physical data of the three amino acids serine, arginine and leucine, playing a prominent role in a recent symmetry classification scheme of the genetic code. It appears that these mathematical sequences, of the same kind as the famous Fibonacci series, apart from their usual recurrence relations, are highly interwinned by many useful linear relationships. Using these sequences and also various sums or linear combinations of them, we derive several physical and chemical quantities of interest, as the number of total coding codons, 61, obeying various degeneracy patterns, the detailed number of hydrogen atoms, the detailed number of atoms (H/CNOS) and the integer molecular mass (or nucleon number), in the side chains of the 61 “amino acids”, also in various degeneracy patterns, in agreement with those described in the literature. Also, unexpectedly but interestingly, we find, as a by-product, an accurate description of the very chemical structure of the four ribonucleotides uridine monophosphate (UMP), cytidine monophosphate (CMP), adenosine monophosphate (AMP) and guanosine monophosphate (GMP), the building blocks of RNA whose groupings, in three units, constitutes the triplet codons. In summary, we find a full mathematical and chemical connection with the “ideal sextet’s classification scheme” mentioned above as well as with several others, notably, the Findley-Findley-McGlynn symmetrical classification. We organize the content of the text in such a way that, besides the presentation of several new research results, it has also an educational dimension. The paper could therefore be read and the computations easily worked out, also by non-experts with mathematical background.

The limitations of investment casting of cobalt-based alloys are claimed to be less problematic with significant improvements in metal additive manufacturing by selective laser melting (SLM). Despite these advantages, the metallic devices are likely to display mechanical anisotropy in relation to build orientations, which could consequently affect their performance ‘in vivo’. In addition, there are inconclusive evidence concerning the requisite composition and post-processing steps (e.g. heat-treatment to relieve stress) that must be completed prior to the devices being used. In the current paper, we evaluate the microstructure of ternary cobalt-chromium-molybdenum (Co-Cr-Mo) and cobalt-chromium-tungsten (Co-Cr-W) alloys built with Direct Metal Printing and LaserCUSING SLM systems respectively at 0°, 30°, 60° and 90° inclinations (Φ) in as-built (AB) and heat-treated (HT) conditions. The study also examines the tensile properties (Young's modulus, E; yield strength, R_P0.2; elongation at failure, A_t and ultimate tensile strength, R_m), relative density (RD), and micro-hardness (HV5) and macro-hardness (HV20) as relevant physico-mechanical properties of the alloys. Data obtained indicate improved tensile properties and HV values after short and cost-effective heat-treatment cycle of Co-Cr-Mo alloy; however, the process did not homogenize the microstructure of the alloy. Annealing heat-treatment of Co-Cr-W led to significant isotropic characteristics with increased E and A_t (except for Φ = 90º) in contrast to decreased R_P0.2, R_m and HV values, compared to the AB form. Similarly, the interlaced weld-bead structures in AB Co-Cr-W were removed during heat-treatment, which led to a complete recrystallization in the microstructure. Both alloys exhibited defect-free microstructures with RD exceeding 99.5%.

In 2014, McCulloch showed, in a new and interesting way, how to derive a gravity theory from Heisenberg's uncertainty principle that is equivalent to Newtonian gravity. McCulloch utilizes the Planck mass in his derivation and obtains a gravitational constant of hbar*c/m_p^2. This is a composite constant, which is equivalent in value to Newton's gravitational constant. However, McCulloch has pointed out that his approach requires an assumption on the value of G, and that this involves some circular reasoning. This is in line with the view that the Planck mass is a derived constant from Newton's gravitational constant, while big G is a universal fundamental constant. Here we will show that we can go straight from the McCulloch derivation to measuring the Planck mass without any knowledge of the gravitational constant. From this perspective, there are no circular problems with his method. This means that we can measure the Planck mass without Newton's gravitational constant, and shows that the McCulloch derivation is a theory of quantum gravity that stands on its own. Even more importantly, we show that we can easily measure the Schwarzschild radius of a mass without knowing its mass, or Newton's gravitational constant, or the Planck constant. The very essence of gravity is linked to the Planck length and the speed of light, but here we will claim that we do not need to know the Planck length itself. Our conclusion is that Newton's gravitational constant is a universal constant, but it is a composite constant of the form G=l_p^2*c^3/hbar where the Planck length and the speed of light are the keys to gravity. This could be an important step towards the development of a full theory of quantum gravity.

As a new kind of highly compact and efficient micro-channel heat exchanger, printed circuit heat exchanger (PCHE) is a promising candidate satisfying the heat exchange requirements of liquefied natural gas (LNG) vaporization at low and high pressure. The effects of airfoil fin arrangement on heat transfer an flow resistance were numerically investigated using supercritical liquefied natural gas (LNG) as a working fluid. The thermal properties of supercritical LNG were tested by utilizing a REFPROF software database. Numerical simulation was performed using FLUENT. The inlet temperature of supercritical LNG was 121 K,and its pressure was 10.5MPa. The reference mass flow rate of LNG was set 1.22 g/s for the vertical pitch L_v = 1.67 mm and the staggered pitch L_s = 0 mm, with the Reynolds number of about 3750. The SST k-ω model with enhanced wall treatment was selected by comparing with the experimental data. The airfoil fin PCHE had better thermal-hydraulic performance than that of the straight channel PCHE. Moreover, the airfoil fins with staggered arrangement displayed better thermal performance than that of the fins with parallel arrangement. The thermal-hydraulic performance of airfoil fin PCHE was improved with increasing L_s and L_v. Moreover, L_v affected on the Nusselt number and pressure drop of airfoil fin PCHE more obviously. In conclusion, a sparser staggered arrangement of fins showed a better thermal-hydraulic performance in airfoil fin PCHE.

Fabric phase sorptive extraction, an innovative integration of solid phase extraction and solid phase microextraction principles, has been combined with gas chromatography-mass spectrometry for the rapid extraction and determination of nineteen organochlorine pesticides in various fruit juices and water samples. FPSE consolidates the advanced features of sol-gel derived extraction sorbents with the rich surface chemistry of cellulose fabric substrate, which could directly extract target analytes from complex sample matrices and substantially simplifies the sample preparation operation. Important FPSE parameters including sorbent chemistry, extraction time, stirring speed, type and volume of back-extraction solvent and back-extraction time have been optimized. Calibration curves were obtained in the concentration range 0.1-500 ng/mL. Under the optimum conditions, the limits of detection were obtained in the range 0.007-0.032 ng/mL with satisfactory precision (RSD<6%). The relative recoveries obtained by spiking organochlorine pesticides in water and selected juice samples were in the range of 91.56–99.83%. The sorbent sol-gel poly(ethylene glycol)-poly(propylene glycol)-poly(ethylene glycol) was applied for the extraction and preconcentration of organochlorine pesticides in aqueous and fruit juice samples prior to analysis with gas chromatography-mass spectrometry. The results demonstrated that the present method is simple, rapid, and precise for the determination of organochlorine pesticides in aqueous samples.

We aimed to explore student and staff perceptions and experiences of a pilot COVID-19 asymptomatic testing service (P-ATS) in a UK university campus setting. This was a mixed-method study comprised of an online survey, and thematic analysis of qualitative data from interviews and focus groups conducted at the end of the 12-week P-ATS programme. Ninety-nine students (84.8% female, 70% first year; 93.9% P-ATS participants) completed an online survey, 41 individuals attended interviews or focus groups, including 31 students (21 first year; 10 final year) and 10 staff. All types of testing and logistics were highly acceptable (virus: swab, saliva; antibody: finger prick) and 94.9% would participate again. Reported adherence to weekly virus testing was high (92.4% completed ≥6 tests; 70.8% submitted all 10 swabs; 89.2% completed ≥1 saliva sample) and 76.9% submitted ≥3 blood samples. Students tested to ‘keep campus safe’, ‘contribute to national efforts to control COVID-19’, and ‘protect others’. 31.3% had high anxiety as measured by the Generalized Anxiety Disorder scale (GAD-7) (27.1% of first year). Students with lower levels of anxiety and greater satisfaction with university communications around P-ATS were more likely to adhere to virus and antibody tests. Increased adherence to testing was associated with higher perceived risk of COVID-19 to self (virus) and others (antibody). Qualitative findings revealed 5 themes and 13 sub-themes: ‘emotional responses to COVID-19’, ‘university life during COVID-19’, ‘influences on testing participation’, ‘testing physical and logistical factors’ and ‘testing effects on mental wellbeing’. Asymptomatic COVID-19 testing (virus/antibodies) is highly acceptable to students and staff in a university campus setting. Clear communications and support for mental wellbeing is likely to be important for testing uptake and adherence. Strategies are needed to facilitate social connections and mitigate the mental health impacts of COVID-19 and self-isolation.

As fossil-fueled heating in the building sector is responsible for 16 % of Germanys total CO2 emissions, it is of great importance to use climate-neutral alternatives for the decarbonization of this sector. Options for the climate-neutral heating of buildings include electricity or hydrogen as energy carriers, both explicitly considered by German policy. In this paper, bottom-up studies are conducted to investigate the role of hydrogen for the climate-neutral energy supply of ten selected residential buildings in comparison to electricity-based systems. Based on a selection of as different typical buildings as possible for single- (SFH) and multi-family houses (MFH) of different construction years, demand profiles are simulated for each building and the respective cost-optimal supply system is determined. For the construction of this system, the electricity-based technologies available are electric heater and heat pump as well as the hydrogen-based technologies hydrogen boiler and fuel cell combined heat and power (CHP) system. Based on the results of the optimization, sensitivity analyses are performed. These analyses aim to identify threshold values of the hydrogen price for the use of hydrogen in building energy systems as well as to make the quantities of hydrogen consumed visible.The identified threshold values show the significant role of hydrogen-operated CHP in MFH if the hydrogen price reaches 0.17 €/kWh_H2 in 2050 at an electricity price of 0.31 €/kWh_el. So, hydrogen-based energy systems represent an economically viable alternative to electricity-based systems with heat pumps. We identify electricity to hydrogen price ratios for the economically viable use of hydrogen in the examined buildings that range from 1.67 to 2.82. According to these ratios, the economically reasonable use of hydrogen in buildings can be derived. For the individual building groups for the year 2050, a ratio of 2.5 can be determined for SFH and 1.8 for MFH, that is favored by the use of CHP which also supplies electricity to the buildings. However, the role hydrogen will finally play in German residential buildings in the future depends to a large extent on political decisions on distribution issues and price signals.

An understanding of the mechanism underlying fruit ripening is critical for fruit quality improvement. Although post-harvest ethylene application is known to enhance the onset of fruit ripening, exact mechanisms remain unclear. To characterize the fruit ripening process and mechanism, we investigated the effects of exposing kiwifruit cultivars ‘Hayward’ and ‘Gamrok’ to exogenous ethylene treatment post-harvest using comprehensive proteomic analyses. Comparative two-dimensional gel electrophoresis showed that most of the proteins aggregated in ethylene-treated samples compared to the control (non-treated). We observed that among all ethylene treatments, 95 proteins from ‘Hayward’ and 106 from ‘Gamrok’ were differentially expressed. Interestingly, among the elicited protein successfully identified by matrix-assisted laser desorption/ionization tandem time-of-flight mass spectrometry, 50% from “Hayward’ and 60% from ‘Gamrok’ are associated with fruit ripening. Furthermore, 18% and 10% of proteins, respectively, are associated with defense response, whereas other major proteins are related to protein biosynthesis and photosynthesis/Calvin cycle. Interactions between identified proteins were demonstrated by bioinformatic analysis, providing insights into biological pathways and molecular functions in post-harvest kiwifruit ripening elicited by ethylene application. The present proteomic study in accordance with physiological analysis provides a quantitative evaluation of fruit ripening in response to exogenous ethylene in post-harvest kiwifruit.

Atmospheric pollution arising from diesel-powered engines can result in acute and chronic diseases of the respiratory and cardiovascular systems. The annual carnival festival that takes place in the city of Salvador, Bahia-Brazil, is a large-scale event that gathers approximately 2 m revelers and 170,000 workers who accompany dozens of sound-trucks, or trios elétricos, for a period of seven days. These slow-moving sound-trucks run on diesel fuel, constantly exposing those around them to exhaust fumes. The present study aimed to evaluate air quality along the approximately 10km-long carnival parade circuit and determine possible impacts on human health. We applied a three-phase risk analysis strategy from 2007–2009: 1) hazard identification, 2) risk characterization and 3) risk management. Our quantification of atmospheric particulate matter 2.5 (PM2.5) and nitrogen dioxide (NO₂) concentrations revealed variable levels of PM2.5 ranging from 19 µg/m³ to 580 µg/m³, with peaks of up to 800 μg/m³ at sound-truck concentration areas. We then assessed the effects of air pollution on human health using ophthalmologic parameters obtained from 28 carnival volunteers, who often presented symptoms of eye irritation. Finally, we established strategies to communicate the study’s objectives and obtained results to the population through media outlets and open discussions with government agencies. According to our risk analysis, carnival sound-trucks represent the main source of atmospheric PM2.5 and NO₂ pollution during the annual 7-day carnival festival. As a consequence of our research, the municipal government of Salvador issued an addendum to its carnival legislation mandating organizers to monitor atmospheric pollution, and, subsequently, all large-scale public events. Municipal government authorities have also promoted a shift from petroleum-based diesel fuel to biodiesel, a less-polluting fuel, for all adapted carnival sound-trucks. Our approach, which employed easily accessible and inexpensive methodology, provided substantial scientific evidence to support improvements in the regulation of air quality during large-scale public events held in the city of Salvador.Keywords: environmental

Fractional-time Schrödinger equation (FTSE) describes the evolution of quantum processes endowed with memory effects. FTSE manifestly breaks all consistency requirements of quantum field theory (unitarity, locality and compliance with the clustering theorem), unless the order of fractional differentiation and integration ( ) falls close to the standard index . Working in the context of the minimal fractal manifold (where , ), we confirm here that FTSE approximates the attributes of gravitational metric and provides an unforeseen generation mechanism for massive fields.

What proportions should a thermally massive building have? How should the thermal mass be distributed? Should the "massing" change with the choice of material? This paper shows how to optimize the physical proportions of a building so that it synchronizes ambient heat exchanges in a natural feedback cycle. The internal mass is thermally coupled with buoyancy ventilation; the cycle is driven by the daily swing of outdoor temperature. Tripling up functions in this way—so that structural materials can reliably cool and power the ventilation for buildings—could help decarbonize the construction industry and provide an effective strategy for adapting to life-threatening heatwaves. Based on harmonic analysis, the method allows designers to thermally tune the form and mass of a building to meet chosen targets for temperature and ventilation in free-running mode. Once the optimal balance of exchange rates is known, design teams can proportionally vary the building height and ventilation openings against the surface area and thickness of an internal thermal mass. The possible permutations are infinite but parametrically constrained, allowing teams to fairly compare the functional and environmental credentials of different construction materials while they produce and evaluate preliminary options for organizing the exterior form and interior spaces of a building. An example study suggests that thin-shell structures of minimum weight, and even timber buildings, may be optimally tuned to produce ample ventilation and temperature attenuation.

The fatigue strength of the hot work steel depends on various factors, including the mechanical, properties and behavior and bulk and the surface under layer, the microstructural features as well as heat treatments. The influence of a series of heat treatments on the fatigue strength of H13 hot work steel was investigated. Different preheating, quenching and tempering treatments were applied to four sets of specimens and fatigue tests were conducted at room temperature using a rotating bending test machine. All heat treatments resulted in a certain improvement of the fatigue strength. Highest fatigue strength obtained by applying a double tempering heat treatment (first tempering at 550 °C for two hours and second tempering at 610 °C for two hours) after initial preheating and quenching. One tempering treatment (550 °C for two hours after preheating and quenching) did not significantly improve the fatigue strength.

Theory of the Thermal Response Testing (TRT) is a well-known part of sizing process of the geothermal exchange system. Multiple parameters influence accuracy of effective ground thermal conductivity measurement; like testing time, variable power, climate interferences, groundwater effect etc. To improve accuracy of the TRT we introduced procedure to additionally analyze falloff temperature decline after power test. Method is based on a premise of analogy between TRT and petroleum well testing, since origin of both procedures lies in diffusivity equation with solutions for heat conduction or pressure analysis during radial flow. Applying pressure build-up test interpretation technique to the borehole heat exchanger testing, greater accuracy could be achieved since ground conductivity could be obtained from this period. Analysis was conducted on coaxial exchanger with five different power steps, and with both direct and reverse flow regime. Each test was set with 96hr of a classical TRT, followed by 96hr of temperature decline, making it almost 2000 hours of cumulative borehole testing. Results showed that ground conductivity value could vary as much as 25% depending on test time, seasonal period and power fluctuations while thermal conductivity obtained from a falloff period gives more stable values with only 10% value variation.

The performance of ground heat exchangers systems depends on the knowledge of the thermal parameters of the ground like thermal conductivity, thermal capacity and diffusivity. The knowledge of these parameters often requires quite accurate experimental analysis, known under the name of Thermal Response Test (TRT). In this paper, after a general analysis of the various available types of TRT and the study of the theoretical basics of the method, the perspective of the definition of a simplified routine method of analysis based on the combination of a particular version of TRT and the routine geotechnical tests for the characterization of soil stratigraphy and of the ground characteristics, mandatory before the construction of a new buildings, even if limited to quite short drilling depth (lower than 30 m). The idea of developing TRT in connection with geotechnical test activity has the objective of promoting a widespread use of in-situ experimental analysis and of reducing TRT costs and time duration of the experimental analysis. The considerations exposed in the present paper lead to reconsider a particular variety of the TRT in particular the version known as Thermal Response Test while Drilling (TRTWD).

Our matter universe is made up of four components of dark energy (DE), dark matters (DMs), leptons and quarks which are created from the decay of the primary black hole through the inflation after big bang. In the three-dimensional quantized space model, the sum (DER) of the dark energy (DE) and radiations (R) is the flat photon space and there are 39 particles of 3 dark matters, 9 leptons and 27 quarks. Generally speaking, the mass ratio of the quarks with the 27 particles is smallest and the mass ratio of the DER photon space with the 1 massless photon is largest. Therefore, the mass ratios of DER, DMs, leptons and quarks are inversely proportional to the particle numbers of DER, DMs, leptons and quarks as the first assumption. This simple rule is called as the universe mass ratio golden rule in Fig. 12. This simple rule is successfully applied to the observed mass ratios of the Planck and WMAP missions. The best particle number combination (1, 3, 9, 27) of the four components (DER, DMs, Leptons, Quarks) to explain the Planck 2018 and WMAP results is the same as the particle number combination (1, 3, 9, 27) of the 3-dimensional quantized space model. The calculated mass ratios of DER, DMs, leptons and quarks are 67.5 %, 22.5 %, 7.5 % and 2.5 %, respectively. And the calculated mass ratios of neutrinos and ordinary matters are 5.0 % and 5.0 %, respectively. The mass ratios of the dark energy (68.47(23) %) and matters (31.53(23) %) obtained from the Planck 2018 results are consistent with the calculated mass ratios of the DER (67.5 %) and matters (32.5 %). The mass ratio of the dark energy (72.1(15) %) obtained from the WMAP 9 year results is explained as the summed mass ratio (72.5 %) of DER (67.5 %) and neutrinos (5.0 %). The universe evolution including the super-massive black holes (SMBHs) is shown in Fig. 4. The accelerated space expansion of our universe requires the addition of the new dark energy. If this new dark energy is added, the mass ratio of the dark energy is a little bit increased. The difference (0.97 %) between the observed value (68.47(23) %) and calculated value (67.5 %) is explained by adding the new dark energy in Figs. 2, 4, 7, 8, 9, 10 and 11. The corrected mass ratios of DER, DMs, leptons and quarks are 68.47 %, 21.8286 %, 7.2762 % and 2.4254 %, respectively. The corrected mass ratios of the neutrinos (called as cosmic background neutrinos) and ordinary matters (OMs) are 4.8508 % and 4.8508 %, respectively. These corrected mass ratios can explain the mass ratios obtained from the WMAP and Planck missions. In other words, the mass ratios calculated from the best particle number combination support the elementary particles, dark matters and dark energy (photon space) proposed by the three-dimensional quantized space model based on the 10-D Euclidean space.

The principle of the constancy of the velocity of light, which stated that the light velocity is invariant to the motion of the emitter, was well established and directly proven by experiments. Interestingly, the further assumption that the light velocity is independent of the motion of the observer was, arguably, never directly proven by any experiment for a century. This paper proposed the design of two experiments to directly test this assumption, which tried to address some perceived technical difficulty in such experiments. One is to directly measure the light speed as to moving sensors. The experiment setup is designed in such a way that the concerns of time synchronization and dilation can be avoided. Another experiment is to test the isotropy of the light speed to a moving particle in the electromagnetic accelerator by measuring the momentum to acceleration ratio. The experiment result, if positive, will provide direct and solid proof of the assumption. Otherwise, it may imply a need for further investigation. Since the light speed invariance to moving observers is a key assumption of some fundamental physical theory, either way, the experiments will have significant meanings.

Samples of sunflower Waste Cooking Oils (WCOs) subjected to several cycles of frying were treated with water under four different combinations of temperature and pH. The variation of the chemical composition of the oil samples was monitored through headspace Solid-Phase Microextraction (HS-SPME) coupled with gas-chromatographic technique (GC), ¹H NMR spectroscopy and ESI⁺ mass spectrometry measurements. The possibility to modify the chemical composition of the recycled vegetable oil by tuning the water treatment parameters was exploited for the designing of a mini-plant for the production of bio-lubricants. A full description of the proposed prototype is also reported.

Coronavirus disease 2019 (COVID-19), caused by the novel coronavirus SARS-CoV-2, has been confirmed in over 10,000,000 individuals worldwide and has resulted in more than 500,000 deaths in a few months since it first surfaced. With such a rapid spread it is no surprise that there has been a massive effort around the world to collectively elucidate the mechanism by which the virus is transmitted. Despite this, there is still no definitive consensus regarding droplet versus airborne transmission of SARS-CoV-2. Public health officials around the world have introduced guidelines within the scope of droplet transmission. However, increasing evidence and comparative analysis with similar coronaviruses, such as severe acute respiratory syndrome (SARS-CoV-1) and middle eastern respiratory syndrome (MERS), suggest that airborne transmission of SARS-CoV-2 cannot be effectively ruled out. As the data supporting COVID-19 airborne transmission grows, there needs to be an increased effort in terms of technical and policy measures to mitigate the spread of viral aerosols. These measures can be in the form of broader social distancing and facial covering guidelines, exploration of thermal inactivation in clinical settings, low-dose UV-C light implementation, and greater attention to ventilation and airflow control systems. This review summarizes the current evidence available about airborne transmission of SARS-CoV-2, available literature about airborne transmission of similar viruses, and finally the methods that are already available or can be easily adapted to deal with a virus capable of airborne transmission.

Fever remains an integral part of the acute clinical diseases management, esp. viral, for which effective therapeutics remain desired. However, the presence of often confusing fever reduction recommendations for COVID-19 in the public domain during the pandemic, as late as 28 April 2021, seems to suggest the reduction of any ‘uncomfortable’ fever ranging from 37.8 - 39oC, as opposed to WHO fever reduction guidelines (≥39oC), urgently need attention. The confusion could percolate down into different agencies who look up to these agencies for guidance in framing their own, denying the benefits of fever to populations, and effectively undo whatever successive WHO’s guidelines have achieved in the last two decades. The existence of conflicting guidelines in public domains which are open to interpretations has consequences to public health and the healthcare infrastructure, on implementation. For controlling acute infectious diseases, esp. viral, the fever remains the most important enabler. Historically, our chief obstacles to harnessing the benefits of fever in acute clinical diseases with limited therapeutics had been: a) widespread myths about ‘fevers’ arising from a general misunderstanding of basic facts; b) presence of confusing guidelines by different agencies which are open to alternate interpretation. The article attempts to briefly indicate the benefits of fever in disease resolution, dispel myths, underline vagueness in illustrative national guidelines and the need to align them with evidence-based WHO guidelines, as it has the potential to perpetuate myths/confusion in masses leading to adverse impact on disease management – more morbidity and mortality from diseases including COVID-19.

Regional heat capacity change is calculated from the ratio between the addition or subtraction of heat (ΔQ) with the increase or decrease in temperature (ΔT) region. The purpose of this study is to calculate the regional heat capacity change due to the changes of land cover composition with forest, shrubs, oil palm plantation and bare soil using Landsat-5 TM satellite data on 1994, 2000 and 2010. Total area that used on ​​this study is 12971 ha. In 1994-2000, 4 % of forest area and 2% shrubs were increased, followed by additional of biomass forest 4.01 tons/ha and 2.83 tons/ha for shrubs. The increased of forest area and biomass (tons/ha) caused by forest and shrubs growth processing towards climax that added the canopy volume. So that, the regional heat capacity in 1994 amounted 19384 MJC^o-1 increased to 19929 MJC^o-1 in 2000. Data observation for 2000-2010 showed that forest area decreased by 66% due to forest’s clearing into oil palm plantations (47%), shrubs (8%) and bare soil (11%). But, plant’s biomass continue to increased, i.e 1.48 ton/ha for forest, 2.73 tons/ha for shrubs and 4.63 tons/ha for bare soil. Before 2000, there was no land cover by oil palm plantations, so the increasing rate from this land was the biggest than the three other lands, amounting to 122.29 tons/ha. Decreasing in the percentage of forest area does not cause a decrease in the heat capacity of the region. Intensive maintenance on oil plam plantation such as water management, fertilizer and planting space made it biomass productivity and ability to save the heat is greater than the forest. As the result, in 2010 regional heat capacity increased to 22508 MJC^o-1.

Low back pain (LBP) is a leading cause of disability. It significantly impacts the patient’s quality of life, limits their daily living activities, and reduces work productivity. To reduce the burden of LBP, several pharmacological and non-pharmacological treatment options are available. This review summarizes the role of heat therapy in the management of LBP. First, we outline the common causes of LBP, then discuss the general mechanisms of heat therapy on (LB)P, and finally review the published evidence regarding the impact of heat therapy in patients with acute or chronic non-specific LBP. This review demonstrates that continuous, low-level heat therapy provides pain relief, improves muscular strength, and increases flexibility. Therefore, this effective, safe, easy-to-use, and cost-effective non-pharmacological pain relief option is still relevant in modern clinical practice.

We have recently proposed a pre-quantum, pre-space-time theory as a matrix-valued Lagrangian dynamics on an octonionic space-time. This pre-theory offers the prospect of unifying the internal symmetries of the standard model with gravity. It can also predict the values of free parameters of the standard model, because these parameters arising in the Lagrangian are related to the algebra of the octonions which define the underlying non-commutative space-time on which the dynamical degrees of freedom evolve. These free parameters are related to the algebra $J_3(\mathbb O)$ [exceptional Jordan algebra] which in turn is related to the three fermion generations. The exceptional Jordan algebra [also known as the Albert algebra] is the finite dimensional algebra of 3x3 Hermitean matrices with octonionic entries. Its automorphism group is the exceptional Lie group $F_4$. These matrices admit a cubic characteristic equation whose eigenvalues are real and depend on the invariant trace, determinant, and an inner product made from the Jordan matrix. Also, there is some evidence in the literature that the groups $F_4$ and $E_6$ could play a role in the unification of the standard model symmetries, including the Lorentz symmetry. The octonion algebra is known to correctly yield the electric charge values (0, 1/3, 2/3, 1) for standard model fermions, via the eigenvalues of a $U(1)$ number operator, identified with $U(1)_{em}$. In the present article, we use the same octonionic representation of the fermions to compute the eigenvalues of the characteristic equation of the Albert algebra, and compare the resulting eigenvalues with the known mass ratios for quarks and leptons. We find that the ratios of the eigenvalues correctly reproduce the [square root of the] known mass ratios for quarks and charged leptons. We also propose a diagrammatic representation of the standard model bosons, Higgs and three fermion generations, in terms of the octonions, exhibiting an $F_4$ and $E_6$ symmetry. In conjunction with the trace dynamics Lagrangian, the Jordan eigenvalues also provide a first principles theoretical derivation of the low energy value of the fine structure constant, yielding the value $1/137.04006$. The Karolyhazy correction to this value gives an exact match with the measured value of the constant, after assuming a specific value for the electro-weak symmetry breaking energy scale.

Dynamic tribochemical processes for dicationic ionic liquid containing a germinal imidazolium cation head groups bridged by a poly(ethylene glycol) and bis(trifluoromethylsulfonyl)imide anion were studied using time-resolved Mechanically Stimulated Gas Emission Mass-Spectrometry (MSGE-MS). In comparison with similar monocationic imidazolium ionic liquids with short alkylic or long polyether side chains the dicationic ionic liquid had lower coefficient of friction on Ti6Al4V alloy and smoother behaviour. The analysis of volatile decomposition products suggested multiple tribochemical reactions in which both anionic and cationic moieties are involved. Tribochemical degradation of cations was mainly through detachment of the side and bridging chains from the imidazolium head groups. Absence of volatile products containing nitrogen implies that imidazole group remained unchanged. Hydrogen and water desorption were attributed to the reactions of hydrogen fluoride being a product of anion degradation with titanium and titanium oxide.

The research is devoted to the acute problem of cinema influence on the young audience. With the continuous development of mass media, cinema is still one of the most popular leisure activities, remaining an influential tool on the picture of the world, values, stereotypes, the behavior of viewers, etc. The paper studies the effects of the cinema on young viewers in relation to their ideas about the elderly. Using a psychosemantic technique that includes 25 scales designed specifically to identify the content of representation of older people, respondents evaluated their various characteristics before and after watching the film. It should be noted that after watching a film about the elderly, the respondents changed their representations of motivational and regulatory, cognitive and emotional characteristics of the older people. However, the changes were not similar in different groups of young people: students seemed to have more negative representation, graduate students’ assessment, on the contrary, changed for a better one. The discovered opposite effects of the cinema influence can be explained by a number of reasons starting from age, personal experience of the respondents, the formation of ideas to the special features of the film itself. In this regard, the contribution of individual factors to the efficiency of the cinema impact and the prediction of its specific effects requires further study.

Recent experimental research has shown that mass is linked to Compton periodicity. We suggest a new way to look at mass: Namely that mass at its most fundamental level can simply be seen as reduced Compton frequency over the Planck time. In this way, surprisingly, neither the Planck constant nor Newton's gravitational constant are needed to observe the Planck length, nor in any type of calculation or gravitational predictions. The Planck constant is only needed when we want to convert back to the more traditional and we would say arbitrary mass measures such as kg. The theory gives the same predictions as Einstein's special relativity theory, with one very important exception: anything with mass must have a maximum velocity that is a function of the Planck length and the reduced Compton wavelength. For all observed subatomic particles, such as the electron, this velocity is considerably above what is achieved in particle accelerators, but always below the speed of light. This removes a series of infinity challenges in physics. The theory also offers a way to look at a new type of quantum probabilities. As we will show, a long series of equations become simplied in this way. Further Newton's gravitational constant G is clearly not needed for gravity calculations or predictions; it is the Planck length and the speed of light (gravity) that are essential for gravity, and both can be measured easily with no knowledge of G.

The epidemiological situation generated by COVID-19 has highlighted the importance of applying non-pharmacological measures. Among these, mass screening of the asymptomatic general population has been established as a priority strategy by carrying out diagnostic tests to limit the spread of the virus. In this article, we aim to evaluate the economic impact of mass COVID-19 screenings of an asymptomatic population through a Cost-Benefit Analysis based on the estimated total costs of mass screening versus health gains and associated health costs avoided. Excluding the value of monetized health, the Benefit-Cost ratio was estimated at approximately 0.45. However, if monetized health is included in the calculation, the ratio is close to 1.20. The monetization of health is the critical element that tips the scales in favour of the desirability of screening. Screenings with the highest return are those that maximize the percentage of positives detected.

We suggest that momentum should be redened in order to help make physics more consistent and more logical. In this paper, we propose that there is a rest-mass momentum, a kinetic momentum, and a total momentum. This leads directly to a simpler relativistic energy momentum relation. As we point out, it is the Compton wavelength that is the true wavelength for matter; the de Broglie wavelength is mostly a mathematical artifact. This observation also leads us to a new relativistic wave equation and a new and likely better QM. Better in terms of being much more consistent and simpler to understand from a logical perspective.

Rhizophora mangle L. is a well-known medicinal plant found in mangroves worldwide used to treatment diabetes. This study evaluated the chemical composition of the acetonic extract from Rhizophora mangle barks (AERM), by HPLC-PDA and FIA-ESI-IT-MS/MS and the effects on high-fat diet induced obesity in mice and its mechanism of action by gene expression of inflammatory markers (Pparg, Ppara, Srebf1, Cd36, Tnf, Ccl2, Lep, Il10, Il6, Fasn, 18s). High-fat diet fed mice during 12 weeks was used as model of obesity and associated alterations. The results were very satisfactory, the extract, rich in polyphenolic compounds, flavonoids and phenolic acids, displayed intense antioxidant activity in vitro (608 µmol Trolox/g), and showed excellent activity against non-alcoholic fatty liver disease (NAFLD) and reverse insulin resistance in a model of diet-induced obesity. We can registered a modulatory effect of AERM in liver PPAR-γ mRNA expression associated to an important inhibition of CD36 mRNA expression suggesting that AERM induces the down regulation of CD36 mRNA via PPAR-gamma inhibition. These results support the traditional knowledge about the use of R. mangle for the treatment of type 2 diabetes and reveal the potential of AERM for the treatment of NAFLD and management of obesity and comorbidities.

Estimates of dog population sizes are a prerequisite for delivering effective canine rabies control. However, dog population sizes are generally unknown in most rabies-endemic areas. Several approaches have been used to estimate dog populations but without rigorous evaluation. We compare post-vaccination transects, household surveys and school-based surveys to determine which most precisely estimates dog population sizes. These methods were implemented across 28 districts in southeast Tanzania, in conjunction with mass dog vaccinations, covering a range of settings, livelihoods and religious backgrounds. Transects were the most precise method, revealing highly variable patterns of dog ownership, with human: dog ratios ranging from 12.4:1 to 181.3:1 across districts. Both household and school-based surveys generated imprecise and sometimes inaccurate estimates, possible due to low sample size. Transect data were subsequently used to develop a predictive model for estimating dog populations in districts lacking transect data. We predicted a dog population of 2,316,000 (95% CI 1,573,000-3,122,000) in Tanzania and an average human: dog ratio of 20.7:1. Our modelling approach has the potential be applied to predicting dog population size in other districts where mass dog vaccination is carried out, given census and livelihood data. We recommend transects as a rapid and effective method to refine dog population estimates across large geographic areas and guide dog vaccination programs.

Glycosphingolipids (GSL) represent a highly heterogeneous class of lipids with many cellular functions, implicated in a wide spectrum of human diseases. Their isolation, detection, and comprehensive structural analysis is a challenging task due to the structural diversity of GSL molecules. In this work, GSL subclasses are isolated from human plasma using an optimized monophasic ethanol–water solvent system capable to recover a broad range of GSL species. Obtained deproteinized plasma is subsequently purified and concentrated by C18-based solid-phase extraction (SPE). The hydrophilic interaction liquid chromatography (HILIC) coupled to electrospray ionization linear ion trap tandem mass spectrometry (ESI-LIT-MS/MS) is used for GSL analysis in the human plasma extract. Our results provide an in-depth profiling and structural characterization of glycosphingolipid and some phospholipid subclasses identified in the human plasma based on their retention times and the interpretation of tandem mass spectra. The structural composition of particular lipid species is readily characterized based on the detailed interpretation of MS and MS/MS spectra and further confirmed by specific fragmentation behavior following predictable patterns, which yields to the unambiguous identification of 154 GSL species within 7 lipid subclasses and 77 phospholipids representing the highest number of GSL species ever reported in the human plasma. The developed HILIC-ESI-MS/MS method can be used for further clinical and biological research of GSL in the human blood or other biological samples.

Mass timber products, together with careful forestry management, could help decarbonize the construction industry. These products must be long-lasting, to safely store atmospheric carbon for decades or centuries, and multi-functional, to displace materials and equipment that are emissions-intensive. This paper shows how to optimize mass timber panels as heat-exchangers, suggesting how to eliminate insulation while simplifying HVAC systems. Test panels measured the heat-exchange in steady and transient conditions, when the ventilation was driven by a fan or by thermal buoyancy. The total heatexchange was predicted accurately by theory in all cases. Further investigation is needed to understand the possible heat-recovery effects at the exterior surface.

Transplant of human cancer cells into zebrafish larvae has emerged as a useful methodology in cancer research. Zebrafish have very low husbandry costs, are amenable to large-scale drug screening, and are unmatched for optical clarity in live animal imaging. However, there is currently no consensus on the ideal methods for xenograft of human cancer cells into zebrafish. Here, we have examined the effects of transplant site and housing temperature on both zebrafish larvae and human cancer cells using survival analyses, metabolomic approaches, and in vivo imaging. Our data show that while zebrafish larvae can adapt to the ideal conditions for mammalian cells, human cancer cells are highly sensitive to both temperature change and transplant site. Human cells housed in slightly cooler than physiologic temperatures had a significantly altered metabolism that resulted in changes in growth, survival, and response to chemotherapy. Cancer cells xenografted into the yolk of the larvae also had reduced proliferation and drug response compared to those xenografted into the soma, in part due to the differences in metabolites available at these sites. In total, temperature and transplant site can have profound effects on xenografted cells. Standardization of zebrafish xenograft methods will enhance data reproducibility between individual laboratories.