The electronic structure and the participation of the simplest azomethine imine (AI) in [3+2] cycloaddition (32CA) reactions have been analysed within the Molecular Electron Density Theory (MEDT) using DFT calculations at the MPWB1K/6-311G(d) level. Electron localisation function (ELF) topological analysis reveals that AI has a pseudoradical structure, while the conceptual DFT reactivity indices characterise this TAC as a moderate electrophile and a good nucleophile. The non-polar 32CA reaction of AI with ethylene takes place through a one-step mechanism with low activation energy, 5.3 kcal/mol-1. A bonding evolution theory (BET) study indicates that this reaction takes place through a non-concerted [2n+2τ] mechanism in which the C–C bond formation is clearly anticipated prior to the C–N one. On the other hand, the polar 32CA reaction of AI with dicyanoethylene takes place through a two-stage one-step mechanism. Now, the more favourable regioisomeric transition state structure (TS) is located 8.5 kcal•mol⁻¹ below the reagents, in complete agreement with the high polar character of the TS. The current MEDT study makes it possible to extend Domingo’s classification of 32CA reactions to a new pra-type of reactivity.

“You should know the words by the company they keep!” has been one of the most famous slogans attributed to John Rubert Firth, 1957. This has ignited a whole school in linguistic research known as the British empiricist contextualism. Sixty years later, many un- or semi-supervised machine learning algorithms have been successfully designed and implemented aiming at extracting word meaning from within the context of a text corpus. These algorithms treat words, more or less, as vectors of real numbers representing frequencies of word occurrences within context and word meaning as positions of words in a high-dimensional vector space model. Word associations, in turn, are treated as calculated distances among them. With the rise of Deep Learning (DL) and other artificial neural networks based architectures, learning the positioning of words and extracting word associations as measured by their distances has further improved. In this paper, however, we revisited the main stream of algorithmic approaches and set the stage for a partly cross-disciplinary evaluation framework to judge about the nature of the extracted word associations by state-of-the-art machine learning algorithms. Our preliminary results are based on word associations extracted from the application of DL framework on a Google News text corpus, as well as on comparisons with human created word association lists such as word collocation dictionaries and psycholinguistic experiments. The results and conclusions provide some insights into the inherited limitations in interpreting the type of word associations and underpinning relations between words with inevitable consequences in other areas, such as extraction of knowledge graphs or image understanding.

As renewed interest in human space-exploration intensifies, a coherent and modernized strategy for mission-design and planning has become increasingly crucial. Biotechnology has emerged as a promising approach to increase mission resilience, flexibility, and efficiency by virtue of its ability to efficiently utilize in situ resources and reclaim resources from waste streams. Since its infancy during the Apollo years, biotechnology, and specifically biomanufacturing, have witnessed significant expansions of scope and scale. Here we outline four primary mission classes, on Luna and Mars, that drive a staged and accretive biomanufacturing strategy. Each class requires a unique approach to integrate biomanufacturing into the existing mission architecture and so faces unique challenges in technology development.These challenges stem directly from the resources available in a given mission class – the degree to which feedstocks are derived from cargo and in situ resources – and the degree to which loop-closure is necessary. We see that as mission duration and distance from Earth increase, the benefits of specialized sustainable biomanufacturing processes increases. Here we present a strategic approach, guided by technoeconomics, to development, testing, and deployment of these technologies serves to nucleate the larger effort of supporting a sustained human presence in space. The processes needed for each scenario spans the technical breadth of synthetic biology to design engineering, from sophisticated genetic tailoring of chassis-organisms to building scalable, automated, easily operable bioreactors and processing systems. As space-related technology development often does, these advancements are likely to have profound implications for the creation of a stable, resilient bioeconomy on Earth.

The COVID-19 pandemic has brought about unprecedented changes to human lifestyles across the world. The virus and associated social restriction measures have been linked to an increase in mental health conditions. A considerable body of evidence shows that spending time in and engaging with nature can improve human health and wellbeing. Our study explores nature’s role in supporting health during the COVID-19 pandemic. We created web-based questionnaires with validated health instruments and conducted spatial analyses in a geographic information system (GIS). We collected data on people’s patterns of nature exposure, associated health and wellbeing responses, and potential socioecological drivers such as relative deprivation, access to greenspaces, and land-cover greenness. We applied a range of statistical analyses including bootstrap resampled correlations and binomial regression models, adjusting for several potential confounding factors. We found that respondents significantly changed their patterns of visiting nature as a result of the COVID-19 pandemic. People spent more time in nature and visited nature more often during the pandemic. People generally visited nature for a health and wellbeing benefit and felt that nature helped them cope during the pandemic. Greater land-cover greenness within a 250 m radius around a respondent’s postcode was important in predicting higher levels of mental wellbeing. There were significantly more food-growing allotments within 100 m and 250 m of respondents with high mental wellbeing scores. The need for a mutually-advantageous relationship between humans and the wider biotic community has never been more important. We must conserve, restore and design nature-centric environments to maintain resilient societies and planetary health.

A space charge density wireless measurement system based on the idea of distributed measurement is proposed for collecting and monitoring the space charge density in an ultra-high-voltage direct-current (UHVDC) environment. The proposed system architecture is composed of a number of wireless nodes connected with space charge density sensors and a base station. The space charge density sensor based on atmospheric ion counter method is elaborated and developed, and the ARM microprocessor and Zigbee radio frequency module are applied. The wireless network communication quality and the relationship between energy consumption and transmission distance in the complicated electromagnetic environment is tested. Based on the experimental results, the proposed measurement system demonstrates that it can adapt to the complex electromagnetic environment under the UHVDC transmission lines and can accurately measure the space charge density.

Studying the two famous old problems that why the moon can move around the Sun and why the orbit of the Moon around the Earth cannot be broken off by the Sun under the condition that calculating with F=GMm/R^2, the attractive force of the Sun on the Moon is almost 2.2 times that of the Earth. We found that the planet and moon are unified as one single gravitational unit which results in that the Sun cannot have the force of F=GMm/R^2 on the moon. The moon is moved by the gravitational unit orbiting around the Sun. It could indicate that the gravitational field of the moon is limited inside the unit and the gravitational fields of both the planet and moon is unified as one single field interacting with the Sun. The findings are further clarified by reestablishing Newton’s repulsive gravity.

In this study, a high energy conversion efficient dye-sensitized solar cells (DSSC) was successfully fabricated by attaching a double anti-reflection (AR) layer which is composed of a subwavelength moth-eye structured polymethyl methacrylate (PMMA) film and a polydimethylsiloxane (PDMS) film. The efficiency is up to 6.79%. The moth-eye structured PMMA film was fabricated by using anodic aluminum oxide (AAO) template which is simple, low-cost and scalable. The nano-pattern of AAO template has been precisely reproduced onto PMMA film. The photoanode is composed of Titanium dioxide (TiO₂) nanoparticles (NPs) with diameter of 25 nm deposited on the fluorine-doped tin oxide (FTO) glass substrate and the sensitizer N3. The double AR layer can effectively improve the short-circuit current density (JSC) and conversion efficiency from 14.77 to 15.79 mA/cm² and from 6.26% to 6.79%, respectively.

This paper studies ionospheric vertical total electron content (VTEC) variations before the 2014 Mw8.2 Chile earthquake. VTEC derived from 14 GPS (Global Positioning System) stations and GIM (Global Ionospheric Map) were used to analyze ionospheric variations before the earthquake using the sliding interquartile range method, and results showed that significant positive VTEC anomalies occurred on 28 March. To explore possible causes of these anomalies, effects of solar and geomagnetic activities were examined, and VTEC variations during 17 March to 31 March in 2009-2013 were cross-compared. Also, VTEC for a full year before the earthquake was investigated. Results indicated that these anomalies were weakly associated with high solar activities and geomagnetic storms and that these anomalies were not normal seasonal and diurnal variations. An analysis of the spatial distribution of the observed anomalies was also presented, and it demonstrated that anomalies specifically appeared around the epicenter on 28 March. It suggests that observed anomalies may be associated with the subsequent Chile earthquake. Equatorial anomaly variations were analyzed to discuss the possible physical mechanism, and results showed that the equatorial anomaly unusually increased on 28 March, which indicates that anomalous electric fields generated in the earthquake preparation area and the meridional wind are possible causes of the observed ionospheric anomalies.

We propose a model for gravity based on the gravitational polarization of space. With this model, we can relate the density parameters within the Friedmann model, and show that dark matter is bound mass formed from massive dipoles set up within the vacuum surrounding ordinary matter. Aggregate matter induces a gravitational field within the surrounding space, which reinforces the original field. Dark energy, on the other hand, is the energy density associated with gravitational fields both for ordinary matter, and bound, or induced dipole matter. At high CBR temperatures, the cosmic susceptibility, induced by ordinary matter vanishes, as it is a smeared or average value for the cosmos as a whole. Even though gravitational dipoles do exist, no large scale alignment or ordering is possible. Our model assumes that space, i.e., the vacuum, is filled with a vast assembly (sea) of positive and negative mass particles having Planck mass, called planckions, which is based on extensive work by Winterberg. These original particles form a very stiff two component superfluid, where positive and negative mass species neutralize one another already at the submicroscopic level, leading to zero net mass, zero net gravitational pressure, and zero net entropy, for the undisturbed medium. It is theorized that the gravitational dipoles form from such material positive and negative particles, and moreover, this causes an intrinsic polarization of the vacuum for the universe as a whole. We calculate that in the present epoch, the smeared or average susceptibility of the cosmos equals, , and the overall resulting polarization equals, . Moreover, due to all the ordinary mass in the universe, made up of quarks and leptons, we calculate a net gravitational field having magnitude, . This smeared or average value permeates all of space, and can be deduced by any observer, irrespective of location within the universe. This net gravitational field is forced upon us by Gauss’s law, and although technically a surface gravitational field, it is argued that this surface, smeared value holds point for point in the observable universe. A complete theory of gravitational polarization is presented. In contrast to electrostatics, gravistatics leads to anti-screening of the original source field, increasing the original value, , to, , where is the induced or polarized field. In the present epoch, this leads to a bound mass, , where is the sum of all ordinary source matter in the universe, and equals the relative permittivity. A new radius, and new mass, for the observable universe is dictated by the density parameters in Friedmann's equation, and Gauss’s law. These lead to the very precise values, , and, , respectively, somewhat larger than current less accurate estimates.

We present a cosmological model in which the Big Bang was not the beginning of space and time; there was a previous phase leading up to it, with multiple cycles of contraction and expansion that repeat indefinitely. In this paper we propose a unique property of Space-time, this particular and marvelous nature of space shows us that space can stretch, expand, and shrink. When matter comes closer to each other, the space also shrinking between them. As space shrunk it produced the pressure, which pressure stretching the Shrunk space. This property of space is causes the size of the Universe changed over time: growing or shrinking. The observed accelerated expansion, which relates the stretching of Shrunk space for the new theory, is derived. When space exponentially shrunk, it creates the pressure, which leads to stretching the shrink volume of space. As pressure of shrink space decreases, the stretching of shrunk space increases, that is although in general, decelerate in the pressure of shrink space leads to accelerate the expansion of space. The pressure of the shrunk space will cease at the certain cosmic scale, so the expansion of the Universe will eventually stop, after that a period of slow contraction will begin, thus bringing the universe back to contract to its initial state, ending in a Big Crunch. The universe will not continue to expand forever, no need however, for dark energy. The new definition of eternal space and its unique properties enables us to describe a sequence of events from the Big Bang to the Big Crunch.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

In our previous papers [1,3], using only the concepts of the zero-point energy and quantized space–times, all the fields including gravity were explained. However, the previous papers had the following limitations: First, the concept of the quantized space-time must be experimentally confirmed. Second, we should clarify the meaning of the quantized Einstein’s gravity equation, which is derived in [1]. Moreover, in another paper [2], we succeeded in describing the neutrinos’ self-energy and their oscillations. However, this paper assumes the rest energy of 3-leptons in advance, which is why we needed to uncover the reason why leptons have 3-generations. As mentioned, using the concepts of the zero-point energy and quantized space–times, we derived the quantized Einstein’s gravity equation in our previous paper [1]. The paper provides an analytical solution of this equalized Einstein’s equation, which implies the conservation of angular momentum in terms of quantized space–times. Employing this solution and without the standard big bang model, a unique form of acceleration equation for the acceleration-expansion universe is derived. Moreover, the temperature of the cosmic microwave background (CMB) emission is also obtained. Further, this solution results in an analytical (not numerical) derivation of the gravity wave. Moreover, based on the configuration of quantized space–times in terms of both electric and magnetic fields, we analytically attempted to calculate every equation in terms of electromagnetic and gravity fields, using the solution of the quantized Einstein’s gravity equation. As a result of this theory, first the calculated acceleration and temperature of CMB emission agree with the measurements. Furthermore, the analytical solution of the quantized Einstein’s gravity equation resulted in all the laws of electromagnetic and gravity fields in addition to the analytically derived gravity wave, which agrees well with the recent measurements. Moreover, the calculations of the energies in the basic configuration of the quantized space–times resulted in all 3-leptons’ rest energies. Considering this basic configuration is uniformly distributed everywhere in the universe, we can conclude that τ-particles or static magnetic field energy derived from the basic configuration of the quantized space–times is the identity of dark energy, which also distributes uniformly in the universe.

Some physicists surmise that gravity lies outside of quantum mechanics. Thus theories like the standard semiclassical theory of quantum to gravity coupling (that of Rosenfeld and Møller) are possible real models of interaction, rather than a mere approximation of a theory of quantum gravity. Unfortunately, semiclassical gravity creates inconsistencies such as superluminal communication. Alternatives by authors such as Diósi, Martin, Penrose, and Wang often use the term 'stochastic' to set themselves apart from the standard semiclassical theory. These theories couple to fluctuations caused by for instance continuous spontaneous localization, hence the term 'stochastic'. This paper looks at stochastic gravity in the framework of a class of emergent or ontological quantum theories, such as those by Bohm, Cetto, and de Broglie. It is found that much or all of the trouble in connecting gravity with a microscopic system falls away, as Einstein's general relativity is free to react directly with the microscopic beables. The resulting continuous gravitational wave radiation by atomic and nuclear systems does not, in contrast to Einstein's speculation, cause catastrophic problems. The small amount of energy exchanged by gravitational waves may have measurable experimental consequences. A very recent experiment by Vinante et al. performed on a small cantilever at mK temperatures shows a surprising non-thermal noise component, the magnitude of which is consistent with the stochastic gravity coupling explored here.

Microbial electrochemical technologies (MET) rely on the presence of the metabolic activity of electroactive bacteria for the use of solid-state electrodes for oxidizing different kind of compound, that could lead to the synthesis of chemicals, bioremediation of polluted matrices, the treatment of contaminants of interest, as well as the recovery of energy. Keeping in mind those possibilities, since the beginning of the present century, there has been a growing interest in the use of electrochemical technologies for wastewater treatment, and if possible with simultaneous power generation. In the last years, there has been a growing interest to explore the possibility of merging MET with constructed wetlands, to offer a new option of intensified wetland system that could keep a high performance with a lower footprint. Based on that interest, this paper explains the general principles of MET, and the different known extracellular electron transfer mechanisms ruling the interaction between electroactive bacteria and potential solid-state electron acceptors. Also, the adoption of those principles for the development of MET set-ups for simultaneous wastewater treatment and power generation, and the challenges that the technology face. Ultimately, the most recent developments in set-ups that merges MET with constructed wetlands are presented and discussed.

Space missions have always assumed that the risk of spacecraft malfunction far outweighs the risk of human system failure. This assumption breaks down for longer duration exploration missions and exposes vulnerabilities in space medical system. Space agencies can no longer buy down the majority of human system risk through the crew member selection process and emergency re-supply or evacuation. No mature medical solutions exist to close the risk gap. With recent advances in biotechnology, there is promise in augmenting a space pharmacy with a biologically-based space foundry for on-demand manufacturing of high-value medical products. Here we review the challenges and opportunities of molecular pharming, the production of pharmaceuticals in plants, as the basis of a space medical foundry to close the risk gap in current space medical systems. Plants have long been considered an important life support object in space and can now also be viewed as programmable factories in space. Advances in molecular pharming-based space foundries will have widespread application in promoting simple and accessible pharmaceutical manufacturing on Earth.

After astrochemistry and astrobiology, astrotoxicology is a further subfield of astroscience. Astrotoxicology is an interdisciplinary science that combines physics, biology, chemistry, astronomy, medicine and toxicology. Unlike toxicology on Earth, astrotoxicology in space must take into account the specific features of extreme conditions such as gravity, radiation, temperature or pressure and also consider the distinctions of extreme conditions on other celestial bodies. The field of action of astrotoxicology is, therefore, the influence of lower gravity on the toxicological characteristics of substances in the human body, the special dangers caused by increased radiation in space and on other planets and the special chemical changes caused by the extreme conditions in space on substances and the toxicological consequences associated with them. Despite growing space research, there are so far only a few pharmacokinetic, pharmacodynamic or toxicological investigations under conditions of microgravity and knowledge of toxicology under the extreme conditions in space in particular. Future studies will be the beginning of astrotoxicology, a previously unknown branch of toxicology.

Here, applying the theory of the generalization of the Boltzmann constant in curved space-time, we will model the mechanism by which elementary particles are formed. We will determine the relationship between gravity and each of the elementary particles that form the standard model following analogies to that of stellar bodies. In order to achieve our goal, we will propose new models for photons, quarks and gluons; with this, we will demonstrate why there are stable and unstable elementary particles; why the first family of elementary particles forms hadrons and why the second and third families cannot form hadrons; why the fermions comply with the Pauli exclusion principle and why the bosons do not comply with the Pauli exclusion principle, etc. Finally, we will analyse the generalization of the ADS/CFT correspondence and propose a theory of everything (T.O.E.).

Here we will electrically-quantum model the neutron and proton as a three-phase alternating current electric generator, for this, we will use the theory of three-phase electric generators and vector or phasor diagrams. We will use this model to hypothesize how the quarks that form neutrons and protons with a combined mass of 10 MeV/c², can generate, through quarks-antiquarks-gluon interactions, a mass of 939.56 MeV/c² for the neutron and a mass of 938.27 MeV/c² for the proton. Using quantum mechanics and the theory of the generalization of the Boltzmann constant in curved space-time we will calculate the number of quarks-antiquarks-gluons and gravitons inside a neutron. We will also analyse βˉ decay using vector diagrams, we will calculate the tension of the string T₀ and the length of the string ℓs between quarks-antiquark and finally, we will model a black hole using a neutron equivalent model. In version 2 of this article, we will update the vector diagrams of the βˉ decay and theoretically calculate the energy of the W⁻ boson, the Z⁰ boson, and the Θ angle, Θ = arc cos (W⁻/Z⁰). We will demonstrate, through vector diagrams, that quarks-antiquarks-gluon interactions are the cause of the origin of the W⁻ boson and the Z⁰ boson. We will also demonstrate how the fine structure constant α originates. It is important to make clear, in future updates, we will describe the relationship that exists between the theory described in this paper and the Isospin theory, flavour and colour theory

G protein-coupled receptors (GPCRs) are critical drug targets. GPCRs convey signals from the extracellular to the intracellular environment through G proteins. There is evidence that some ligands that bind to the GPCRs activate different downstream signaling pathways. G protein activation or -arrestin biased signaling involves ligands binding to receptors and stabilizing conformations that trigger a specific pathway. Molecular dynamics (MD) simulations are especially valuable for obtaining detailed mechanistic information, including identification of allosteric sites and understanding modulators' interactions between receptors and ligands. Here, we highlight recent simulation studies and methods used to study biased G protein-coupled receptor signaling and their conformational dynamics. We also highlight applications of MD simulations to drug discovery.

NASA mission systems proposals are often compared using an equivalent system mass (ESM) framework wherein all elements of technology to deliver an effect- its components, operations and logistics of delivery- are converted to effective masses since this has a known cost scale in space operations. To date, ESM methods and the tools for system comparison have not considered complexities wherein systems that serve a mission span multiple transit and operations stages, such as would be required to support a crewed mission to Mars, and thus do not account for the different mass equivalency factors operational during each period and the inter-dependencies of the costs across the mission. Further, ESM does not account well for the differential reliabilities of the underlying technologies. Less reliability should incur an equivalent mass cost for technologies that might otherwise provide a mass advantage. We introduce an extensions to ESM to address these limitations and show that it provides a direct method for analyzing, optimizing and comparing different mission systems. We demonstrate our extended ESM (xESM) calculation with crop production technologies -- an aspect of the developing offworld biomanufacturing suite -- since it represents a case with strong coupling among stages of the mission and a relatively high-risk profile.

We have recently presented a unified quantum gravity theory [1]. Here we extend on that work and present an even simpler version of that theory. For about hundred years, modern physics has not been able to build a bridge between quantum mechanics and gravity. However, a solution may be found here; we present our quantum gravity theory, which is rooted in indivisible particles where matter and gravity are related to collisions and can be described by collision space-time. In this paper, we also show that we can formulate a quantum wave equation rooted in collision space-time, which is equivalent to mass and energy.The beauty of our theory is that most of the main equations that currently exist in physics are not changed (in terms of predictions), except at the Planck scale. The Planck scale is directly linked to gravity and gravity is, surprisingly, actually a Lorentz symmetry as well as a form of Heisenberg uncertainty break down at the Planck scale. Our theory gives a dramatic simplification of many physics formulas without altering the output predictions. The relativistic wave equation, the relativistic energy momentum relation, and Minkowski space can all be represented by simpler equations when we understand mass at a deeper level. This not attained at a cost, but rather a reflection of the benefit in having gravity and electromagnetism unified under the same theory.

Piezoelectric properties are of significant importance to medical ultrasound, actuators, sensor, and countless other device applications. The mechanism of piezoelectric properties can be deeply understood from structure evolutions. In this paper, we report a diagram of structure evolutions of the Pb(Zn1/3Nb2/3)0.91Ti0.09O3 (PZN-9PT) single crystal with excellent piezoelectric properties among the orthorhombic, tetragonal, and cubic phases with temperature increasing from room temperature to 220 C. Through fitting the temperature dependence XRD curves with Gauss and Lorenz functions, we obtained the evolutions of the content ratio of three kinds of phases (orthorhombic, tetragonal and cubic) and the lattice parameters of the PZN-9PT system with the changes of temperature. The XRD fitting results together with Raman and dielectric spectrums show that the phase transitions of PZN-9PT are a typical continuous evolution process, very similar to the phase transition of paraffin from solid to liquid. Additionally, resonance and anti-resonance spectrum show excellent piezoelectric properties of the crystals, which probably originate from the nano twin domains, as demonstrated by the TEM images. Of particular attention is that the thickness electromechanical coupling factor kt is up to 72%.

Manned missions to Mars and other deep space exploration targets are expected to take place in the next 20 years. These missions will involve prolonged crew exposure to the unique space environment, increasing the risk that astronauts will experience additional physical and psychological health conditions beyond those that would be expected through normal aging on Earth. Thus, there is an acute need to develop therapeutic solutions that can withstand the harsh space environment, while maintaining astronaut health and maximizing crew capabilities to foster successful exploration-class missions. This review covers the nuanced and interdisciplinary challenge that is providing safe and effective pharmaceuticals for future deep space missions. First, the limitations of current pharmaceutical solutions are discussed; the impacts of the space environment on human health and chemical compound stability are covered, along with an evaluation of astronaut medication use on similar missions. Second, potential pharmaceutical solutions and concepts are presented for consideration. Future research should prioritize these and other potential innovations to ensure that our space programs are well equipped to maximize crew safety as astronauts explore deep space objectives.

Two novel inorganic–organic hybrid supramolecular assemblies, namely, (4-HNA)(18-crown-6)(HSO₄) (1) and (4-HNA)₂(18-crown-6)₂(PF₆)₂(CH₃OH) (2) (4-HNA = 4-nitroanilinium), were synthesized and characterized by infrared spectroscopy, single X-ray diffraction, differential scanning calorimetry (DSC), and temperature-dependent dielectric measurements. The two compounds underwent reversible phase transitions at about 255 K and 265 K, respectively. These phase transitions were revealed and confirmed by the thermal anomalies in DSC measurements and abrupt dielectric anomalies during heating. The phase transition may have originated from the [(4-HNA)(18-crown-6)]⁺ supramolecular cation. The inorganic anions tuned the crystal packings and thus influenced the phase-transition points and types. The variable-temperature X-ray diffraction data for crystal 1 revealed the occurrence of a phase transition in the high-temperature phase with the space group of P2₁/c and in the low-temperature phase with the space group of P2₁/n. Crystal 2 exhibited the same space group P2₁/c at different temperatures. The results indicated that crystals 1 and 2 both underwent an iso-structural phase transition.

The Japanese city presents a certain number of peculiarities in the organization of its physical space (weak zoning regulations, fast piecemeal destruction/reconstruction of buildings and blocks, high compacity, incremental reorganization). Compared to countries where urban fabrics are more perennial and easily distinguishable (old centers, modern planned projects, residential areas, etc.), in Japanese metropolitan areas we often observe higher heterogeneity and more complex spatial patterns. Even within such a model, it should be possible to recognize the internal organization of the physical city. The aim of this paper is thus to study the spatial structure of the contemporary Japanese city, generalizing on the case study of Osaka and Kobe. In order to achieve this goal, we will need to identify urban forms at different local scales (building types, urban fabrics) and to analyze them at a wider scale to delineate morphological regions and their structuring of the overall layout of the contemporary Japanese city. Several analytical protocols are used together with field observations and literature. The results, and more particularly the building and urban fabrics types and their location within the Osaka-Kobe metropolitan area, are interpreted in the light of Japanese history and model of urbanization. A synoptic graphical model of an urban morphological structure based upon Osaka is produced and proposed as an interpretative pattern for the Japanese metropolitan city in general.

In this paper a perspective on the application of spatially- and Angle- Resolved PhotoEmission Spectroscopy (ARPES) for the study of two-dimensional (2D) materials is presented. ARPES allows the direct measurement of the electronic band structure of materials generating extremely useful insights into their electronic properties. The possibility to apply this technique to 2D materials is of paramount importance because these ultrathin layers are considered fundamental for future electronic, photonic and spintronic devices. In this review an overview of the technical aspects of spatially localized ARPES is given along with a description of the most advanced setups for laboratory and synchrotron-based equipment. This technique is sensitive to the lateral dimensions of the sample, therefore a discussion on the preparation methods of 2D material is presented. Some of the most interesting results obtained by ARPES are reported in three sections including: graphene, transition metal dichalcogenides (TMDCs) and 2D heterostructures. Graphene has played a key role in ARPES studies because it inspired the use of this technique with other 2D materials. TMDCs are presented for their peculiar transport, optical and spin properties. Finally, the section featuring heterostructures highlights a future direction for research into 2D material structures.

Wildland-Urban Interfaces (W-UI) are at high risk of wildfires. Defensible spaces and home ignition zones are the two main aspects to protect lives and livelihoods of W-UI in the United States, Canada and Australia. The different part of the world has different rules and regulations for W-UI land management. We have discussed the defensible spaces in fire-prone areas, current ignition zone distances from structures, building materials, architectural design, the fire resistance trees, ground cover, landscaping and some other precautions to save lives and assets in the prominent fire-prone zones for three different countries (United States, Canada and Australia) of the world.

Electron Beam Melting (EBM) is an increasingly used Additive Manufacturing (AM) technique employed by many industrial sectors, including the medical device and aerospace industries. In-process EBM monitoring for quality assurance purposes has been a popular research area. Electronic imaging has recently been investigated as one of the in-process EBM data collection methods, alongside thermal/ optical imaging techniques. Despite certain capabilities of an electronic imaging system have been investigated, experiments are yet to be carried out to benchmark one of the most important features of any imaging systems – spatial resolution. This article addresses this knowledge gap by: (1) proposing an indicator for the estimation of spatial resolution which includes the Backscattered Electrons (BSE) information depth, (2) estimating the achievable spatial resolution when electronic imaging is carried out inside an Arcam A1 EBM machine, and (3) presenting an experimental method to conduct edge resolution evaluation with the EBM machine. Analyses of experimental results indicated that the spatial resolution was of the order of 0.3mm-0.4mm when electronic imaging was carried out at room temperature. It is believed that by disseminating an analysis and experimental method to estimate and quantify spatial resolution, this study has contributed to the on-going quality assessment research in the field of in-process monitoring of the EBM process.

Despite extensive investigations of the Depression Anxiety Stress Scales-21 (DASS-21) since its development in 1995, its factor structure and other psychometric properties still need to be firmly established, with several calls for revising its item structure. Employing confirmatory factor analysis (CFA), this study examined the factor structure of the DASS-21 and five shortened versions of the DASS-21 among psychiatric patients (N = 168) and the general public (N = 992) during the COVID-19 confinement period in Saudi Arabia. Multigroup CFA, Mann Whitney W test, Spearman’s correlation, and coefficient alpha were used to examine the shortened versions of the DASS-21 (DASS-13, DASS-12, DASS-9 (two versions), and DASS-8) for invariance across age and gender groups, discriminant validity, predictive validity, item coverage, and internal consistency, respectively. Compared with the DASS-21, all three-factor structures of the shortened versions expressed good fit, with the DASS-8 demonstrating the best fit and highest item loadings on the corresponding factors in both samples (χ2(16, 15) = 16.5, 67.0; p = 0.420, 0.000; CFI= 1.000, 0.998; TLI = 0.999, 0.997; RMSEA = 0.013, 0.059, SRMR = 0.0186, 0.0203). It expressed configural, metric, and scalar invariance across age and gender groups. Its internal consistency was comparable to other versions (α = 0.94). Strong positive correlations of the DASS-8 and its subscales with the DASS-21 and its subscales (r = 0.97 to 0.81) suggest adequate item coverage and good predictive validity of this version. The DASS-8 and its subscales distinguished the clinical sample from the general public at the same level of significance expressed by the DASS-21 and other shortened versions, supporting its discriminant validity. Neither the DASS-21 nor the shortened versions distinguished patients diagnosed with depression and anxiety from other conditions. The DASS-8 represents a valid short version of the DASS-21, which may be useful in research and clinical practice for quick identification of individuals with potential psychopathologies. Diagnosing depression/anxiety disorders may be further confirmed in a next step by clinician-facilitated examinations. Brevity of the DASS-21 would save time and effort used for filling the questionnaire and support comprehensive assessments by allowing the inclusion of more measures on test batteries.

Background: Modern MEG devices include 102 sensor triplets containing one magnetometer and two planar gradiometers. The first processing step is often a signal space separation (SSS), which provides a powerful noise reduction. A question commonly raised by researchers and reviewers is which data should be employed in source reconstruction: (1) magnetometers only, (2) gradiometers only, (3) magnetometers and gradiometers together. The MEG community is currently divided about the proper answer and strong arguments in favor and against these three approaches often expressed. Methods: First, we provide theoretical evidence that both gradiometers and magnetometers contain the same information after SSS, and argue that they both result from the backprojection of the same SSS components. Then, we compare beamforming source reconstructions from magnetometers and gradiometers in real MEG recordings before and after SSS. Results: Without SSS, the correlation between source time series extracted from magnetometers and gradiometers was high, with Pearson correlation coefficient r=0.5-0.8. After SSS, these correlation values increased dramatically, reaching over 0.90 across all cortical areas. Conclusions: After SSS, almost identical source reconstructions (r>0.9) can be obtained with magnetometers and gradiometers, as long as regularization is selected appropriately to account for the different properties in magnetometers and gradiometers covariance matrices.

In the framework of a multiplicative metric space. We have discuss some Properties of convex structures in pseudo multiplicative metric space and have applied these properties toiobtain alfixed point results in complete pseudo. It would be interesting to prove some further results in such metric spaces with completeness property.

This case report describes evidence of intratubular biomineralization in root canal filled with calcium enriched material after 8 years of clinical maintenance. The schematic findings of dentinal tubules were investigated with scanning electron microscopy (SEM) and energy dispersive spectroscopy (EDS). The root canal obturation material was closely adapted to root dentin surface, suggesting the possibility of chemical bonding between the two interfaces. SEM and EDS observation of dentinal tubules showed intratubular biomineralized crystal structures with Ca/P ratio in a range of 1.30–2.12, suggesting bioactive capacity of calcium enriched cement.

Edge detection is one of the key issues in the field of computer vision and remote sensing image analysis. Although many different edge-detection methods have been proposed for gray-scale, color, and multispectral images, they still face difficulties when extracting edge features from hyperspectral images (HSIs) that contain a large number of bands with very narrow gap in the spectral domain. Inspired by the clustering characteristic of the gravitation, a novel edge-detection algorithm for HSIs is presented in this paper. In the proposed method, we first construct a joint feature space by combining the spatial and spectral features. Each pixel of HSI is assumed to be a celestial object in the joint feature space, which exerts gravitational force to each of its neighboring pixel. Accordingly, each object travels in the joint feature space until it reaches a stable equilibrium. At the equilibrium, the image is smoothed and the edges are enhanced, where the edge pixels can be easily distinguished by calculating the gravitational potential energy. The proposed edge-detection method is tested on several benchmark HSIs and the obtained results were compared with those of three state-of-the-art approaches. The experimental results confirm the efficacy of the proposed method

Transient flows result in unbalanced forces and high pressure in pipelines. Under these conditions, the combined effects of flow-induced forces along with sudden pipe displacements can create cracks in the pipeline, especially at the junctions. This situation consequently results in water leakage and reduced operational efficiency of the pipeline. In this study, displacements and stresses in a buried pressurized water transmission pipe installed by pipe jacking method are investigated using numerical modeling and considering interactions between fluid, pipe, and soil. The analyses were performed consecutively under no-flow, steady flow, and transient flow conditions, in order to investigate the effects of flow conditions on displacements and stresses in the system. Analyses of the results show that displacements and stresses in the jointed concrete pipes are significant under transient flow conditions. Moreover, because of pressure transient effects, maximum tensile stresses exceed the tensile strength of concrete at the junctions, leading to cracks and consequent water leakage.

The recently proposed Holography-inspired approach to quantum gravity is reviewed and expanded. The approach is based on the foliation of the background spacetime and reduction of the offshell states to the physical states. Careful attention is paid to the boundary conditions. It is noted that the outstanding problems such as the cosmological constant problem and black hole information can be tackled from the common thread of the quantized gravity. One-loop renormalization of the coupling constants and the beta function analysis are illustrated. Active galactic nuclei and gravitational waves are discussed as the potential applications of the present quantization scheme to astrophysics.

In general, a superconductor has zero resistance, although it requires significant refrigeration or high pressures with high manufacturing costs, which prevents it into practical applications. In other words, solving these issues implies main superconducting researches. To solve these problems, this paper describes a new type of superconductivity, which is independent for temperatures and which operates without pressures. The principles of the presented system are as follows:First a voltage source, a current source and a load are connected in series. Then, the voltage of the voltage source is adjusted to balance the voltage of the load. Under this condition, the balance of the two voltages provides a zero voltage between the taps of the current source and the generated current from the voltage source becomes zero because of the internal infinite resistance of the current source. As a result, the electric powers generated by the two sources are zero, and therefore, the load cannot generate Joule heating because of energy conservation. However, the current from the current source (not the voltage source) is not zero; therefore, we can predict that the resistance of the load must be zero. As a theory, we derived a new electric field and transient attractive force, which result in a very short coherence of an electron pair because there is not the Coulomb repulsive force due to the existence of the above transient attractive force. Note that both the forces are derived by the Poisson equation, which implies that they cannot be compatible. Therefore, the pair combination energy from spins becomes extremely strong, which is not destroyed by the normal heat energy. Moreover, every center-of-mass motion of electron pair results in the Bose-Einstein condensation and the macroscopic wave function, which produces the London equation (i.e., the Meissner effect). Moreover, by introducing the equivalent circuit, this paper conducted numerical calculations. As a result, we could derive numerically zero resistance and responses for additional static magnetic fields as a discharged current, which implies the Meissner effect. Note that this paper has prepared Appendix section, which provides a guide to reproduce actual experiments and preliminary experimental results. These results in the Appendix indicate the zero resistances and Meissner effects.

Dams are a critical infrastructure system for many communities, but they are also one of the most challenging to inspect. Dams are typically very large and complex structures, and the result is that inspections are often time-intensive and require expensive, specialized equipment and training to provide inspectors with comprehensive access to the structure. The scale and nature of dam inspections also introduces additional safety risks to the inspectors. Unmanned aerial vehicles (UAV) have the potential to address many of these challenges, particularly when used as a data acquisition platform for photogrammetric three-dimensional (3D) reconstruction and analysis, though the nature of both UAV and modern photogrammetric methods necessitates careful planning and coordination for integration. This paper presents a case study on one such integration at the Brighton Dam, a large-scale concrete gravity dam in Maryland, USA. A combination of multiple UAV platforms and multi-scale photogrammetry was used to create two comprehensive and high-resolution 3D point clouds of the dam and surrounding environment at intervals. These models were then assessed for their overall quality, as well as their ability to resolve flaws and defects that were artificially applied to the structure between inspection intervals. The results indicate that the integrated process is capable of generating models that accurately render a variety of defect types with sub-millimeter accuracy. Recommendations for mission planning and imaging specifications are provided as well.

Assuming a two component, positive and negative mass, superfluid/supersolid for space (the Winterberg model), we model the Higgs field as a condensate made up of a positive and a negative mass, planckion pair. The connection is shown to be consistent (compatible) with the underlying field equations for each field, and the continuity equation is satisfied for both species of planckions, as well as for the Higgs field. An inherent length scale for space (the vacuum) emerges, which we estimate from previous work to be of the order of,

With forty years of developments, bio-macromolecule cryo-electron microscopy has met its revolution of resolution and is playing a very important role in structural biology study. According to different specimen states, cryo-electron microscopy (cryo-EM) involves three specific techniques, single particle analysis (SPA), electron tomography and sub-tomogram averaging, and electron diffraction. All these three techniques have not realized their full potentials of solving structures of bio-macromolecules and therefore need to be developed in the future. In this review, the current existing bottlenecks of cryo-EM SPA are discussed with theoretical analysis, which includes air-water interface during specimen cryo-vitrification, bio-macromolecular conformational heterogeneity, focus gradient within thick specimen, and electron radiation damage. Besides, potential solutions of these bottlenecks are proposed and discussed, which are worthy of further investigations in the future.

Of the roughly 20,000 canonical human protein sequences, as of September 15, 2020, 6,937 proteins have had their full or partial, medium- to high-resolution structures determined by x-ray crystallography or other methods. Which of these proteins dominate the Protein Data Bank (the PDB) and why? In this paper, we list the 273 top human protein structures based on the number of their PDB entries. This set of proteins accounts for more than 40% of all available human PDB entries and represent past trends as well as current status for protein structural biology. We briefly discuss the relationship which some of the prominent protein structures have with protein research as a whole and mention their relevance to human diseases. The top-10 soluble and membrane proteins are all well-known (most of their first structures being deposited more than 30 years ago). Overall, there is no dramatic change in recent trends in the PDB. Remarkably, the number of structure depositions has grown nearly exponentially over the last 10 or more years (with a doubling time of 7 yrs for proteins from all organisms). Growth in human protein structures is slightly faster (at 5.9 yrs, while E.Coli and Mouse+Rat protein structures accumulate more slowly, Zebrafish protein structures are growing most, at a doubling every 3.7 years, albeit starting from only approx. 100 structure entries in 2010). The information may be informative to senior scientists but also inspire researchers who are new to protein science, providing the year 2020 snap-shot for the state of protein structural biology.

An in vitro medium-throughput screen using M. tuberculosis H37Rv was employed to screen an in-house library of structurally diverse compounds for antimycobacterial activity. From this initial screen, eleven 7-substituted coumarin derivatives with confirmed monoamine oxidase-B and cholinesterase inhibitory activities, demonstrated growth inhibition of more than 50% at a 50 µM concentration. This prompted further exploration of all the 7-substituted coumarins in our library, nineteen in total, as potential antimycobacterial agents. Four derivatives showed promising antimycobacterial activity with MIC₉₉ values of 8.31 – 29.70 µM and 44.15 – 57.17 µM on M. tuberculosis H37Rv in independent assays using Gaste-Fe and 7H9 + OADC media, respectively. These compounds were found to bind to albumin which may explain the variations in MIC between the two assays. Preliminary antimycobacterial evaluation of moxifloxacin resistant M. tuberculosis show that these compounds are able to maintain their activity in fluoroquinolone resistant mycobacteria. Analysis of structure activity relationships for antimycobacterial versus neuronal enzyme inhibitory activity indicate that structural modification on position 4 and/or 7 of the coumarin scaffold may be utilized to improve selectivity towards either inhibition of neuronal enzymes or antimycobacterial effect. Cytotoxicity evaluations of the compounds indicate moderate cytotoxicity with slight selectivity towards mycobacteria. Further neuroprotective assays on SH-SY5Y human neuroblastoma cells indicate significant neuroprotection for selected compounds irrespective of their neuronal enzyme inhibitory properties. These coumarin molecules are thus interesting lead compounds that may provide insight into the design of new antimicrobacterial and/or neuroprotective agents.

A novel geometric interpretation of the Minkowski metric is provided, which offers a different and more intuitive approach to phenomena in special relativity. First it is shown that a change of basis in Minkowski space is the equivalent of a change of basis in Euclidean space if a basis element is replaced by its dual element, constituting a mixed basis set. The methodology of the proof includes infinitesimal changes of basis using the Lie-algebras of the involved groups. As a consequence, a direct mapping between Euclidean and Minkowski space is defined. Second, a measuring device called a local, flat observer is defined in Euclidean space and it is shown, that this device uses a mixed basis when measuring distances. Combining these steps, it is concluded that a local, flat observer in a four-dimensional Euclidean spacetime measures a Minkowski spacetime.

The synthesis and structure of the 4,4′-dipyridyl N,N′-donor ligand with a central thiazolo[5,4-d]thiazole (tztz) unit, named Dptztz is presented. With the linker Dptztz and isophthalate (benzene-1,3-dicarboxylate, 1,3-BDC²⁻) the mixed-linker, two-dimensional coordination network [Zn(1,3-BDC)Dptztz]·DMF could be obtained (DMF = dimethylformamide), which belongs to the class of coordination polymers with interdigitated structures (CIDs). The incorporated DMF solvent molecules can be removed through solvent exchange and evacuation such that the supramolecular 3D packing of the 2D networks retains porosity for CO₂ adsorption in activated [Zn(1,3-BDC)Dptztz]. The first sorption study of a tztz-functionalized porous metal-organic framework material yields a BET surface of 417 m²/g from CO₂ adsorption. The heat of adsorption for CO₂ exhibits a relative maximum with 27.7 kJ/mol at adsorbed CO₂ of about 4 cm³/g STP which is interpreted as a gate-opening effect.

Biomimicry in additive manufacturing often refers to topology optimization and the use of lattice structures, due to the organic shape of the topology-optimized designs, and the lattices often looking similar to many light-weight structures found in nature such as trabecular bone, wood, sponges, coral, to name a few. Real biomimetic design however involves the use of design principles taken in some way from natural systems. In this work we use a methodology whereby high resolution 3D analysis of a natural material with desirable properties is “reverse-engineered” and the design tested for the purpose. This allows more accurate replication of the desired properties, and adaption of the design parameters to the material used for production (which usually differs from the biological material). One such example is the impact-protective natural design of the glyptodont body armour. In this paper we report on the production of body armour models in metal (Ti4Al4V) and analyze the resulting mechanical properties, assessing their potential for impact protective applications. This is the first biomimetic study using metal additive manufacturing to date.

We have proposed a data-driven approach for designing mesoscale porous structures of Li-ion battery electrode with three-dimensional virtual structures and machine learning techniques. Over 2,000 artificial 3D structures assuming positive electrode composed of random packed spheres as active material particles are generated, and charge/discharge resistance has been evaluated using simplified Physico-chemical model. In this model, resistance from Li diffusion in active material particles (diffusion resistance), transfer resistance of Li+ in electrolyte (electrolyte resistance) and reaction resistance on the interface between active material and electrolyte are simulated based on mass balance of Li, Ohm’s law in and linearized Butler-Volmer equation, respectively. Using these simulation results, regression models via Artificial Neural Network (ANN) have been created in order to predict charge/discharge resistance from porous structure features. In this study, porosity, active material particle size and volume fraction, pressure in the compaction process, electrolyte conductivity, and binder volume fraction are adopted as features, associated with controllable process parameters for manufacturing battery electrode. As results, the predicted electrode resistance by ANN regression model is good agreement with the simulated values. Furthermore, sensitivity analysis and optimization of the process parameters have been carried out. The proposed data-driven approach could be a solution as a guiding principle for manufacturing battery electrode.

In 2014, McCulloch showed, in a new and interesting way, how to derive a gravity theory from Heisenberg's uncertainty principle that is equivalent to Newtonian gravity. McCulloch utilizes the Planck mass in his derivation and obtains a gravitational constant of hbar*c/m_p^2. This is a composite constant, which is equivalent in value to Newton's gravitational constant. However, McCulloch has pointed out that his approach requires an assumption on the value of G, and that this involves some circular reasoning. This is in line with the view that the Planck mass is a derived constant from Newton's gravitational constant, while big G is a universal fundamental constant. Here we will show that we can go straight from the McCulloch derivation to measuring the Planck mass without any knowledge of the gravitational constant. From this perspective, there are no circular problems with his method. This means that we can measure the Planck mass without Newton's gravitational constant, and shows that the McCulloch derivation is a theory of quantum gravity that stands on its own. Even more importantly, we show that we can easily measure the Schwarzschild radius of a mass without knowing its mass, or Newton's gravitational constant, or the Planck constant. The very essence of gravity is linked to the Planck length and the speed of light, but here we will claim that we do not need to know the Planck length itself. Our conclusion is that Newton's gravitational constant is a universal constant, but it is a composite constant of the form G=l_p^2*c^3/hbar where the Planck length and the speed of light are the keys to gravity. This could be an important step towards the development of a full theory of quantum gravity.

Legionella pneumophila RpoS (LpRpoS) is an alternative sigma factor of RNA polymerase (RNAP) essential for virulence and stress resistance. To investigate the mechanism of RpoS in the intracellular pathogen L. pneumophila, we determined the high-resolution crystal structure of the LpRpoS (residues 95-194) containing a partial region 1.2 and region 2. The structure of LpRpoS (residues 95-194) reveals that the conserved residues are critical for promoter melting, DNA and core RNAP binding. The differences in regulatory factor binding site between Escherichia coli RpoS and LpRpoS suggest that LpRpoS may employ a distinct mechanism to recruit alternative regulatory factors controlling transcription initiation.

The concept of smart morphing blades, which can control themselves to reduce or eliminate the need for active control systems, is a highly attractive solution in blade technology. In this paper an innovative passive control system based on Shape Memory Alloys (SMAs) is proposed. On the basis of previous thermal and shape characterization of a single morphing blade for a heavy-duty automotive cooling axial fan, this study deals with the numerical analysis of the aerodynamic loads acting on the fan. By coupling CFD and FEM approaches it is possible to analyze the actual blade shape resulting from both the aerodynamic and centrifugal loads. The numerical results indicate that the polymeric blade structure ensures proper resistance and enables shape variation due to the action of the SMA strips.

Within an Internet of Multimedia Things, the risk of disclosing streamed video content, such as arising from video surveillance, is of heightened concern. This leads to the encryption of that content. To reduce the overhead and lack of flexibility arising from full encryption of the content, a good number of selective-encryption algorithms have been proposed in the last decade. Some of them have limitations, in terms of significant delay due to computational cost, or excess memory utilization, or, despite being energy efficient, do not provide a satisfactory level of confidentiality, due to their simplicity. To address such issues, this paper presents a lightweight selective encryption scheme, in which encoder syntax elements are encrypted with the innovative EXPer (EXtended Permutation with exclusive OR). The selected syntax elements are taken from the final stage of video encoding that is during entropy coding. As a diagnostic tool, the Encryption Space Ratio measures encoding complexity of the video relative to the level of encryption so as to judge the success of the encryption process, according to entropy coder. A detailed comparative analysis of EXPer with state-of-the-art algorithms confirms that the EXPer provides significant confidentiality with a small computational cost and negligible encryption bitrate overhead. Thus, the results demonstrate that the proposed security scheme is a suitable choice for constrained devices in an Internet of Multimedia Things environment.

The aim of this study was to identify MFIs specific determinants of capital structure of selected micro finance institutions in Ethiopia. The researcher employed quantitative research approach with explanatory research design. The result of regression analysis showed that out that variables like growth, profitability, firm size, age, and asset tangibility have positive and statistically significant effect on leverage ratio. Whereas, profitability has statistically significant and negative effect on capital structure. Based on the findings of the study, the researcher concluded that the firm specific determinants of capital structure of micro finance institutions in Ethiopia were growth, profitability, firm size, age, and asset tangibility.

The processing of cloud free geo-referenced imagery is one of the preliminary processing step of any land application. This letter describe the methodology developed to obtain a seamless cloud free composite of Africa for 2016 using Sentinel-2A data at 10 meters resolution freely available from the European Space Agency. The method is based on an hybrid method resulting from the merging of the two most robust time series methods namely the "darkest pixel" and the "maximum NDVI" previously developed with AVHRR time series.

Almost all single-family detached house in Canada consume huge electricity for space heating and domestic hot water (DHW) purposes. There are many possibilities to design an energy-efficient house. A solar water heating system can be used for domestic water and space heating. Water temperature can be kept constant always by connecting a heat pump or oil burner because solar energy is intermittent. Proper and optimized solar photovoltaic and collector design, tank design, heat pump selection, house insulation, total demand calculation in each section are essential. Energy-Efficient house design has been proposed with water heating and space heating system and compared with the existing system, solar PV based systems, and solar collector based system. The tracking and non-tracking based solar thermal collector based and the solar photovoltaic based system has been compared in this paper and investigate the suitable one for practically applicable and acceptable by the people. Simulation has been done by using the PolySun software. It found that by implementing the proposed PV based system with tracking is highly suitable considering lower cost, high output power, flexibility, easy installation.

Many studies discuss carbon-based materials because of the versatility of its element. They include different opinions for scientific problems and discuss fairly at convincing and compelling levels within the scope and application. A gas-state carbon atom converts into various states depending on its conditions of processing. The electron transfer mechanism in the gas-state carbon atom is responsible to convert it into various states, namely, graphite, nanotube, fullerene, diamond, lonsdaleite and graphene. The shape of ‘energy trajectory’ enables transferring electrons from the left- and right-sides of an atom is like a parabola. That ‘energy trajectory’ is linked to states (filled state and suitable nearby unfilled state) where force-exertion along the poles of transferring electrons is remained balance. So, the mechanism of originating different states of a gas-state carbon atom is under the involvement of energy first. This is not the case for atoms executing confined inter-state electron-dynamics as the force is involved first. Graphite-, nanotube- and fullerene-state atoms ‘partially evolve partially develop’ (form) their structures. These possess one-dimensional, two-dimensional and four-dimensional ordering of atoms, respectively. Their structural formation also comprises ‘energy curve’ having a shape-like parabola. Transferring suitable filled state electron to suitable nearby unfilled state is under a balance force exerting along the poles. The graphite structure under only attained-dynamics of atoms can also be formed but in two-dimension. Here, binding energy between graphite-state carbon atoms is for a small difference of exerting forces along their opposite poles. Structural formation in diamond, lonsdaleite and graphene atoms involve energy to gain required infinitesimal displacements of electrons through which they maintain orientationally-controlled exerting forces along dedicated poles. In this study, the growth of diamond is found to be south to east-west (ground) where atoms bound ground to south. Thus, diamond atoms merge for a tetra-electron ground to south topological structure. Lonsdaleite atoms merge for a bi-electron ground to just-south topological structure. The growth of graphene is found to be north to ground where atoms bound ground to north. Thus, graphene atoms merge for a tetra-electron ground to north topological structure. Glassy carbon exhibits layered-topological structure where, tri-layers of gas-, graphite- and lonsdaleite-state atoms successively bind in repetitive order. Nanoscale hardness is also sketched based on different force-energy behaviors of different state carbon atoms. Here, structure evolution in each carbon state atom explores its own science.

This theoretical article reviews the model describing processes in social systems based on the analysis of their resource base. Application of the system theory can help to explain why some systems are aimed at prevention of type I errors, while other seek to decrease quantity of type II errors. Such differences are manifested in investment of resources either into deep interaction or into wide coverage. Some examples of such strategies in economic, market and production systems are provided in the article. The article introduces some provisions of the system theory in the context of the resource flows. The main indicators that are considered in this article are the characteristics of the sources of the exchanging flows of resources. Their relative frequency and quality are investigated, on the basis of which the most effective strategy of the system is derived, as a mechanism for redistributing resources. The rigor of the system's strategy depends on the magnitude of the difference in characteristics. It is explained how exactly it influences the exchange processes, that in reality systems do not interact simultaneously, and one of the opposite resource flows is always delayed. It is shown how the system strategy depends on the risks linked with interactions. Also, there are grounds for the need to accumulate resources, including in the situation of their surplus. The model helps also explain shift of economic centers throughout history. Additionally, there is an analogy between systems strategies and the competitive strategies described by M. Porter, and outsourcing versus integration.

WNT10B belongs to the family of WNT proteins that are implicated in a range of phenomena that are affected by the Wnt signaling pathway. Recent studies have shown that WNT10B plays a role in colorectal cancer. WNTs have been found to directly affect the stemness of the tumor cells via regulation of ASCL2. Switching off the ASCL2 literally blocks the stemness process of the tumor cells and vice versa. Furthermore, recent findings suggest BVES to be highly suppressed in malignancies and in vitro deletions of BVES show higher Wnt signaling activity to induce stem- ness. WNT10B was found to be highly expressed in such cases. Often, in biology, we are faced with the problem of exploring relevant unknown biological hypotheses in the form of myriads of combination of factors that might be affecting the pathway under certain conditions. For example, WNT10B-ASCL2 is one such 2^nd order combination whose relation needs to be tested under the influence of recently developed porcupine-WNT inhibitor ETC-1922159. The inhibitor is known to suppress PORCN (porcupine) and thus inhibit a range of oncogenes known to be directly or indirectly affected by the Wnts. In a recent unpublished work in bioRxiv, Sinha 1, we had the opportunity to rank these unknown biological hypotheses for down regulated genes at 2^nd order level after the drug was administered. The in silico observations showed that the combination of WNT10B-ASCL2 was assigned a relatively lower rank, thus validating the pipeline’s efficacy with the confirmed wet lab experiment that indicate that both WNT10B and ASCL2 were down regulated after treatment in cancer cells. Here, we take one step further by in silico analysis of the 3rd order combinations of WNT10B-X-X (X can be known or unknown factor), from a range of 100 randomly picked down regulated genes after ETC-1922159 treatment. The pipeline uses the density based HSIC (Hilbert Schmidt Information Criterion) sensitivity index with an rbf (ra- dial basis function) kernel, which is known to be highly effective in sensitivity analysis. Various unknown/unexplored/untested 3^rd order biological hypotheses emerge some of which are con- firmed in wet lab, while others need to be tested. The potential of such ranking is indispensable in the current era of search in a vast combinatorial forest.

Collective spread of aggregated viral particles may have beneficial effects on viral capability to survive in the external environment, to counteract immune responses, and to successfully colonize host cells. Here we ask whether SARS-Cov-2 particles, responsible for COVID-19, display collective clustering behavior. Looking at microphotographs and movies of SARS-Cov-2 particles emerging from the surface of cultured cells, we describe single virions that tend to aggregate in progressively larger globular assemblies, until a network-like appearance is achieved. When SARS-Cov-2 particles stick into each other, the squeezing of single virions leads to improved viral package in host’s fluids. We discuss how these findings might explain both the ability to spread of SARS-Cov-2 and the clinical severity of COVID-19 in humans, paving the way to novel therapeutic strategies to mechanically disrupt collective clustering.

In this paper, a geometric body-centered model to simulate the periodic structure of unidirectional fibrous composites is presented. To this end, three prescribed configurations are introduced to predict in a deterministic manner the arrangement of internal and neighboring fibers inside the matrix. Thus, three different representative volume elements (RVEs) are established. Furthermore, the concept of the interphase has been taken into account, stating that each individual fiber is encircled by a thin layer of variable thermomechanical properties. Next, these three unit cells are transformed in a unified manner to a coaxial multilayer cylinder model. This advanced model includes the influence of fiber contiguity in parallel with the interphase concept on the thermomechanical properties of the overall material. Then, by the use of this model, the authors propose explicit expressions to evaluate the longitudinal and transverse thermal conductivity of this type of composite. The theoretical predictions were compared with experimental results, as well as with theoretical values yielded by some reliable formulae derived from other workers, and a reasonable agreement was found.

We present a model of space that considers it to be a quantized dynamical entity which is a component of the universe along with matter and radiation. The theory is used together with thermodynamic data to provide a new view of cosmic evolution and an insight into the nature of dark energy and dark matter. Space is made up of energy quanta. The universe started from an atomic size volume at very high temperature and pressure near the Planck epoch. Upon expansion and cooling, phase transitions occurred resulting in the formation of radiation, fundamental particles, and matter. These nucleate and grow into stars, galaxies, and clusters. From a phase diagram of cosmic composition, we obtained a correlation between dark energy and the energy of space. Using the Friedmann equations, data from WMAP studies of the composition of the universe at 3.0 x 10⁵ (a=5.25 x 10^-2) years and at present (a=1), are well fitted by our model with an equation of state parameter, w= -0.7. The accelerated expansion of the universe, starting at about 7 billion years, determined by BOSS measurements, also correlates well with the dominance of dark energy at 7.25 x 10⁹ years ( a= 0.65). The expansion can be attributed to Quintessence with a space force arising from a quantum space field. From our phase diagram, we also find a correlation suggesting that dark matter is a plasma form of matter similar to that which existed during the photon epoch immediately prior to recombination. Our Quantum Space Model leads to a universe which is homogeneous and isotropic without the need for inflation. The thermodynamics of expansion is consistent with BOSS data that show the process to be adiabatic and the rate of expansion decelerating during the first 6 billion years after the Big Bang. However, it became non-adiabatic and accelerating thereafter. This implies an influx of energy from a source outside the universe; it warrants consideration as a possible factor in the accelerated expansion of the universe.

Our matter universe is made up of four components of dark energy (DE), dark matters (DMs), leptons and quarks which are created from the decay of the primary black hole through the inflation after big bang. In the three-dimensional quantized space model, the sum (DER) of the dark energy (DE) and radiations (R) is the flat photon space and there are 39 particles of 3 dark matters, 9 leptons and 27 quarks. Generally speaking, the mass ratio of the quarks with the 27 particles is smallest and the mass ratio of the DER photon space with the 1 massless photon is largest. Therefore, the mass ratios of DER, DMs, leptons and quarks are inversely proportional to the particle numbers of DER, DMs, leptons and quarks as the first assumption. This simple rule is called as the universe mass ratio golden rule in Fig. 12. This simple rule is successfully applied to the observed mass ratios of the Planck and WMAP missions. The best particle number combination (1, 3, 9, 27) of the four components (DER, DMs, Leptons, Quarks) to explain the Planck 2018 and WMAP results is the same as the particle number combination (1, 3, 9, 27) of the 3-dimensional quantized space model. The calculated mass ratios of DER, DMs, leptons and quarks are 67.5 %, 22.5 %, 7.5 % and 2.5 %, respectively. And the calculated mass ratios of neutrinos and ordinary matters are 5.0 % and 5.0 %, respectively. The mass ratios of the dark energy (68.47(23) %) and matters (31.53(23) %) obtained from the Planck 2018 results are consistent with the calculated mass ratios of the DER (67.5 %) and matters (32.5 %). The mass ratio of the dark energy (72.1(15) %) obtained from the WMAP 9 year results is explained as the summed mass ratio (72.5 %) of DER (67.5 %) and neutrinos (5.0 %). The universe evolution including the super-massive black holes (SMBHs) is shown in Fig. 4. The accelerated space expansion of our universe requires the addition of the new dark energy. If this new dark energy is added, the mass ratio of the dark energy is a little bit increased. The difference (0.97 %) between the observed value (68.47(23) %) and calculated value (67.5 %) is explained by adding the new dark energy in Figs. 2, 4, 7, 8, 9, 10 and 11. The corrected mass ratios of DER, DMs, leptons and quarks are 68.47 %, 21.8286 %, 7.2762 % and 2.4254 %, respectively. The corrected mass ratios of the neutrinos (called as cosmic background neutrinos) and ordinary matters (OMs) are 4.8508 % and 4.8508 %, respectively. These corrected mass ratios can explain the mass ratios obtained from the WMAP and Planck missions. In other words, the mass ratios calculated from the best particle number combination support the elementary particles, dark matters and dark energy (photon space) proposed by the three-dimensional quantized space model based on the 10-D Euclidean space.

A micro Sagnac interferometer integration is proposed for electron cloud distributed sensors. The Sagnac interferometer consists of four microring probes integrated into a Sagnac loop. Each of the microring probes is embedded with the silver bars to form the plasmonic wave oscillation. At the center microrings, electrons are trapped and oscillated by the whispering gallery modes (WGMs), where the plasmonic antennas are established and applied for wireless fidelity (WiFi) and light fidelity (LiFi) transmissions for distributed sensors. The antenna gains are 2.59dB, 0.93dB, 1.75dB, and 1.16dB respectively for the four antennas formed at the center microrings. The polarized light of 1.50µm wavelength is fed into the interferometer input, which is polarized randomly into upstream and downstream directions. The polarization components can be obtained by the space-time modulation control. By controlling the electron cloud spin orientation, the space-time projection can be applied, and the ultra-high measurement resolution can be obtained in terms of fast switching time (change in phase). In manipulation, the applied stimuli are substituted by the change in input source power. The light input power variation causes a change in electron cloud density. Similarly, when the electron cloud is excited by the microscopic medium, which can be employed as the microscopic sensors. The WGM sensors have sensitivities of 1.35µm-2, 0.90µm-2, 0.97µm-2 and, 0.81µm-2, respectively. The WGMs behave as a four-point probe for the electron cloud distributed sensors, where the electron cloud sensitivities of 2.31 prads-1mm3 (electrons)-1, 2.27prads-1mm3 (electrons)-1, 2.22 prads-1mm3(electrons)-1, 2.38prads-1mm3(electrons)-1 are respectively obtained.

The purpose of this study consists to verify if Er:YAG laser, at low fluences, is able to debond porcelain veneers, successfully used to improve anterior tooth esthetics, without damaging the tooth structures. A total of twelve freshly extracted teeth were used and samples were decontaminated, stored, prepared to obtain Veneers adhesion. One week after, Er:YAG laser with a non-contact sapphire tip with air-water spray was used for veneer debonding at 100 mJ of power and 30Hz of frequency (Fluence 5.91 J/cm2). Results demonstrated that veneer debonding is possible with an Er:YAG laser and that the total number of pulses does not seem related to its efficiency. SEM observation confirms that residual tooth structure is not altered when using these low fluences. Low fluences with Er:YAG laser are able to debond veneers while preserving the tooth structures. SEM observation confirmed that residual tooth structure is not altered with low fluences.

This article attempts to formulate a mathematical model for a potential explanation regarding the unavoidable impact of a rigid body's peculiar shape on the seamless flow over it. The solid body completely immersed in a Newtonian fluid and respectively has a relative open circuit flow on it will typically experience various observable phenomena like flow separation, flow transition, down-wash, stalling at the higher angle of attack, stalling velocity and how cambered airfoil can typically generate lift at a zero incidence angle. This article respectively represents an understanding of the laminar flow over a rigid body's external surface with due respect to its distinctive shape and size. This working paper formulates a more realistic and simplified mathematical model for open circuit laminar flow over a body, based on the historical data of aerodynamics and theoretical mechanics. This is intended to properly estimate forces on the continuous surface of the body in a laminar flow, to properly explain, understand and predict mentioned phenomena. Most of all the mechanism of streamline formation and its deformation with due regards to flow, shape and size of the body in an open-circuit laminar are formulated mathematically to enhance better design theory which can reduce experimentation while designing a streamlined body.

Below T_CO=157 K the quasi-one-dimensional charge-transfer salt (TMTTF)_2SbF_6 undergoes a pronounced phase transition to a charge-ordered ground state. We have explored the non-linear and photoconductive behavior as a function of applied voltage, laser pulse energy and temperature. Besides a decay of the photoconductive signal in a double exponential fashion in the millisecond range, we discover current oscillations in the kHz range induced by the application of short laser pulses. While the resonance frequencies do not depend on voltage or laser intensity and vary only slightly with temperature, the amplitude changes linearly with the laser intensity and voltage. The findings are discussed and compared to comparable phenomena in other low-dimensional electron systems.

We report the use of Einstein rings to reveal the quantized and dynamical states of space-time in a region of impressed gravitational field as predicted by the Nexus Paradigm of quantum gravity. This in turn reveals the orbital speeds of objects found therein and the radius of curvature of the quantized space-time. Similarities between the Nexus graviton and the singular isothermal sphere (SIS) in the Cold Dark Matter (CDM) paradigm are highlighted. However unlike the singular isothermal sphere, the Nexus graviton does not contain singularities or divergent integrals. This solves the core cusp problem. In this work, data from a sample of fifteen Einstein rings published on the Cfa-Arizona Space Telescope Lens Survey (CASTLES) website is used to probe the quantized properties of space-time.

Titanium dioxide (TiO₂) micro and nano architectures have been intensively studied in the past years because of many varied applications in environmental, energy conversion, and storage fields, such as heterogeneous catalysis, dye-sensitized solar cells, lithium/sodium ion batteries, lithium-sulfur (Li-S) batteries, and bio-nanotechnology, etc. Especially the surface and interface structures in the TiO₂ structures play important roles in those applications. This mini review article focuses on TiO₂ micro and nano architectures with the prevalent crystal structures (anatase, rutile, brookite, and TiO₂(B)), and summarizes major advances in the surface and interface engineering and applications in environmental and electrochemical applications. We present the principles and growth mechanisms of TiO₂ nanostructures via different strategies, with an emphasis on rational control of the surface and interface structures. We further discuss the applications of TiO₂ micro and nano architectures in photocatalysis, lithium/sodium ion batteries, and Li-S batteries. Throughout the discussion, the relationship between the device performance and the surface structures of TiO₂ micro/nano structures will be highlighted. Then we discuss the phase transitions of TiO₂ nanostructures and possible strategies of improving the phase stability. The review concludes with a perspective on the current challenges and future research directions.

We consider partition functions, in the form of state sums, and associated probabilistic measures for aperiodic substrates described by model sets and their associated tiling spaces. We propose model set tiling spaces as microscopic models for small scales in the context of quantum gravity. Model sets possess special self-similarity properties that allow us to consider implications on large and observable scales from the underlying (non-ergodic) dynamics. In particular we consider the implication of the underlying aperiodic substrate for the well known problem of time in quantum gravity, and propose a correspondence between small and large scales, the so-called ergodic correspondence, that addresses the emergence of matter properties and spacetime structure. In the process we find a possible bound in the mass spectrum of fundamental particles.

Methylsilsesquioxane aerogels with uniform mesopores have been facilely prepared via a sol–gel process followed by microwave drying with methyltrimethoxysilane (MTMS) as precursor, hydrochloric acid (HCl) as catalyst, water and methanol as solvents, hexadecyltrimethylammonium chloride (CTAC) as surfactant and template and propylene oxide (PO) as gelation agent. The microstructure, chemical composition and pore structures of the resultant MSQ aerogels were investigated in detail to achieve controllable preparation of MSQ aerogels, and the thermal stability of MSQ aerogels was also analyzed. The gelation agent, catalyst, solvent and microwave power have important roles on pore structures of MSQ aerogels. Meanwhile, microwave drying method is found to not only have a remarkable effect on improving production efficiency, but also be conducive to avoid the collapse of pore structure especially micropores during drying. The resulting MSQ aerogel microwave-dried at 500 W possesses a specific surface area up to 821 m2/g and a mesopore size of 20 nm, and displays good thermal stability.

We introduce a device for automatic detection and reporting of crawling insects in urban environments. It is a monitoring device for urban pests that complies with the context of smart homes, smart cities and is compatible with the emerging discipline of the Internet of Things (IoT). We believe it can find its place to every room of a hotel, hospital, military camp and residence. This box-shaped device attracts targeted insect pests, senses the entering insect and takes automatically a picture of the internal space of the box. The picture is communicated through the Wi-Fi commonly found in such establishments to an authorized person/stakeholder receiving the picture to take proper action. The e-trap includes strong attractants (pheromone and/or food) to increase capture efficiency. The insect is trapped on the sticky floor of the device. The device carries the necessary optoelectronic sensors to guard all entrances of the trap. As the insect enters it interrupts the infrared light source. This triggers a detection event; a picture is taken, and a time-stamp is set before reporting the event through the Wi-Fi. The device can be integrated seamlessly in urban environments and operates unobtrusively to human activities. We report results on various insect pests and depending on the insect species, can reach a detection accuracy ranging from 96-99%.

This topical review describes the results of recent research into and development of silicon nitride, a ceramic material with unique properties. The outcome of this ongoing research strongly encourages the use of monolithic silicon nitride and coatings as contemporary and future biomaterial for a variety of medical applications. Crystallographic structure, synthesis and processing of monolithic structures and coatings, and examples of their medical applications are covered that relate to spinal, orthopedic and dental implants, bone grafts and scaffolds, platforms for intelligent synthetic neural circuits, antibacterial and antiviral particles and coatings, optical biosensors, and nano-photonic waveguides for sophisticated medical diagnostic devices. The examples provided show convincingly that silicon nitride is destined to become a leader to replace titanium and other entrenched biomaterials in many fields of medicine.

Space exploration is demanding longer lasting human missions and water resupply from Earth will become increasingly unrealistic. In a near future, the spacecraft water monitoring systems will require technological advances to promptly identify and counteract contingent events of waterborne microbial contamination, posing health risks to astronauts with lowered immune responsiveness. The search for bio-analytical approaches, alternative to those applied on Earth by cultivation-dependent methods, is pushed by the compelling need to limit waste disposal and avoid microbial regrowth from analytical carryovers. Prospective technologies will be selected only if first validated in a flight-like environment, by following basic principles, advantages, and limitations beyond their current applications on Earth. Starting from the water monitoring activities applied on the International Space Station, we provide a critical overview of the nucleic acid amplification-based approaches (i.e., loop-mediated isothermal amplification, quantitative PCR, and high-throughput sequencing) and early-warning methods for total microbial load assessments (i.e., ATP-metry, flow cytometry), already used at a high readiness level aboard crewed space vehicles. Our findings suggest that the forthcoming space applications of mature technologies will be necessarily bounded by a compromise between analytical performances (e.g., speed to results, identification depth, reproducibility, multiparametricity) and detrimental technical requirements (e.g., reagent usage, waste production, operator skills, crew time). As space exploration progresses toward extended missions to Moon and Mars, miniaturized systems that also minimize crew involvement in their end-to-end operation are likely applicable on the long-term and suitable for the in-flight water and microbiological research.

Identifying the total number of fruits on trees has long been of interest in agricultural crop estimation work. Yield prediction of fruits in practical environment is one of the hard and significant tasks to obtain better results in crop management system to achieve more productivity with regard to moderate cost. Utilized color vision in machine vision system to identify citrus fruits, and estimated yield information of the citrus grove in-real time. Fruit recognition algorithms based on color features to estimate the number of fruit. In the current research work, some low complexity and efficient image analysis approach was proposed to count yield fruits image in the natural scene. Semi automatic segmentation and yield calculation of fruit based on shape analysis is presented. Color and shape analysis was utilized to segment the images of different fruits like apple, pomegranate obtained under different lighting conditions. First the input sectional tree image was converted from RGB colour space into the colour space transform (i.e., YUV, YIQ, or YCbCr). The resultant image was then applied to the algorithm for fruit segmentation. After it is applied Morphological Operations which is enhanced image then execute Blob counting method which identify the object and count the number of it. Accuracy of this algorithm used in this thesis is 82.21% for images that have been scanned.

Salutogenic landscape with its health-promoting qualities is a solution for ever-increasing problem of stress for university students as a vulnerable group. Based on nature related theories, natural environments could have a salutary effect on psychological restoration through stress alleviation. There is a body of research on investigating the impact of open green space characteristics for increasing of psychological restoration through framework of attention restoration theory and supportive environment theory. However, there is little knowledge on how the interaction among these characteristics could promote perceived restoration experience (PRE). To address this problem, using perceived sensory dimension (PSD) for open green space qualities and Perceived Restorativeness (PR) as properties of restorative environments, this study assessed the extent to which the PSD and PR impact on PRE. Using 444 screened data, the mediation effect of PR on the association of PSD to PRE is shown as well as the validity and reliability of proposed relationships. `Serene', `space', `prospect', `rich in species' and `nature' were the most influential PSDs on PRE through their higher effect on perceived characteristics of `fascination' and `compatibility'. These results provide information within landscape architecture and planning to promote the development of open spaces as resources for psychological restoration and stress relief.

This compendium presents new mathematical techniques for modeling Point Absorbers. A combined frequency-time domain framework is developed. It is used to simulate the energy generated by the wave farms. With Matlab and Fortran as a base, this leads to obtain physical variables of primary importance, namely position, velocity and power to energy net balance relationships of absorption. Integration of different degrees of freedom with heave as main executable leads in turn to a single buoy motion focus. Acquisition of the needed hydrodynamic coefficients is provided through application of potential field solvers with Boundary Element Methodology background. Initially, this Wave-to-motion model is validated by comparison with previous experimental results for a floating cone cylinder shape (Buldra-FO3). A single, generic, vertical floating cylinder is contemplated then, that responds to the action of the passing regular waves excitation. Later, two equally sized vertical floating cylinders aligned with the incident wave direction are modeled for a variable distance between the bodies. For both unidirectional regular and irregular waves as an input in deep water, we approximate the convolutive radiation force function term through the Prony method. By changing the spatial disposition of the axisymmetric buoys, using for instance triangular or rectangular shaped arrays of three and four bodies respectively, the study delves into motion characteristics for regular waves. The results highlight efficient layouts for maximizing the energy production whilst providing important insights into their performance, revealing displacement amplification- and capture width-ratios, while deriving in possible interpretations of scenarios related to the known park effect. These terms are encompassed by the novelty of a new conceptual Post-Processing methodology in the field, which leads to obtain an optimal distance for the separated bodies with effective energy absorption in a regular wave regime. The main objective is to generate a tendency within the hydrodynamic field of study, which is the Wave to motion perspective. More generally, this computational excursion envisions and depicts potential fields of study, which will surely enhance new connections and link this renewable energy form. Therefore, this research delves first into the historical and technical background on Ocean Wave Energy. Next, it is in the section regarding Materials and Methods, where boundaries and related equations are introduced step by step, together with latter mentioned case scenarios, and their corresponding configuration parameters. A separate section frames then the scope of results, while finally, there is an ensuing discussion and conclusions for evaluation assessment.

Mereotopology is a concept rooted in analytical philosophy. The phase-field concept is based on mathematical physics and finds applications in materials engineering. The two concepts seem to be disjoint at a first glance. While mereotopology qualitatively describes static relations between things like x isConnected y (topology) or x isPartOf y (mereology) by first order logic and Boolean algebra, the phase-field concept describes the geometric shape of things and its dynamic evolution by drawing on a scalar field. The geometric shape of any thing is defined by its boundaries to one or more neighboring things. The notion and description of boundaries thus provides a bridge between mereotopology and the phase-field concept. The present article aims to relate phase-field expressions describing boundaries and especially triple junctions to their Boolean counterparts in mereotopology and contact algebra. An introductory overview on mereotopology is followed by an introduction to the phase-field concept already indicating first relations to mereo- topology. Mereotopological axioms and definitions are then discussed in detail from a phase-field perspective. A dedicated section introduces and discusses further notions of the isConnected relation emerging from the phase-field perspective like isSpatiallyConnected, isTemporallyConnected, isPhysicallyConnected, isPathConnected and wasConnected. Such relations introduce dynamics and thus physics into mereotopology as transitions from isDisconnected to isPartOf can be described.

It is shown that Verlinde’s hypothetical concepts of entropic gravity can be successfully applied to the author’s previous work on the modification of the Newtonian gravity by Einstein’s Cosmological Constant. It allows a theoretical justification for Milgrom’s empirical acceleration constant, thereby revealing some fundamental differences with Verlinde’s conclusions.

For more than one hundred years, scientists dispute the correct interpretation of Lorentz transformations within the framework of the special theory of relativity of Albert Einstein. On the one hand, the changes in length, time and mass with increasing velocity are interpreted as apparent due to the observer dependence within special relativity. On the other hand, real changes are described corresponding to the experimental evidence of mass increase in particle accelerators or of clock delay. This ambiguity is accompanied by an ongoing controversy about valid Lorentz-transformed thermodynamic quantities such as entropy, pressure and temperature. In this paper is shown that the interpretation problem of the Lorentz transformations is genuinely anchored within the postulates of special relativity and can be solved on the basis of the thermodynamic approach of matter-energy equivalence, i.e. an energetic distinction between matter and mass. It is suggested that the velocity-dependent changes in state quantities are real in each case, in full agreement with the experimental evidence.

In this paper we review a proposal to represent the geometric degrees of freedom of the gravitational field as a branched covering space, and introduce a new application of this in which the branch loci are 1- or 2-knots. This allows one to construct arbitrary smooth, closed 3- and 4-manifolds with enough geometric and topological information to write down a partition function and calculate statistical quantities in the thermodynamic limit. Further, we find clear evidence for a dimensional reduction of the spacetime geometry from four to two. As an example, we choose a family of smooth 4-manifolds presented in this way, and calculate the entropy of the system.

The nitrogen-doped amorphous oxide semiconductor (AOS) thin film transistors (TFTs) with double-stacked channel layers (DSCL) were prepared and characterized. The DSCL structure composed of nitrogen-doped amorphous InGaZnO and InZnO films (a-IGZO:N/a-IZO:N or a-IZO:N/a-IGZO:N) made the corresponding TFT devices exhibit quite large field-effect mobility due to the existence of double conduction channels. Especially, the a-IZO:N/a-IGZO:N TFTs showed even better electrical performance (μ_FE = 15.0 cm²·V^-1·s^-1, SS = 0.5 V/dec, V_TH = 1.5 V, I_ON/I_OFF = 1.1×10⁸) and stability (V_TH shift of 1.5, -0.5, and -2.5 V for positive bias-stress, negative bias-stress and thermal stress tests, respectively) than the a-IGZO:N/a-IZO:N TFTs. Based on the X-ray photoemission spectroscopy measurements and energy band analysis, it was assumed that the optimized interface trap states, the less ambient gas adsorption, and the better suppression of oxygen vacancies in the a-IZO:N/a-IGZO:N hetero-structures might be responsible for the better behaviors of the corresponding TFTs.

The definition, origin and recreation of life remain elusive. As others have suggested, only once we put life into reductionist physical terms will we be able to solve those questions. To that end, this work proposes the phenomenon of life to be the product of two dissipative mechanisms. From them, one reinterprets extant biological life and deduces a testable scenario for its origin. The proposed theory of life allows its replication, reinterprets ecological evolution, creates new constraints on the search for life and lays the foundations for groundbreaking technologies.

Even though materialistic atoms are having independent existence in this current accelerating universe, they are not allowing scientists and engineers to explore the secrets of gravity at atomic scale. This may be due to incomplete unification paradigm, inadequacy of known physics and technological difficulties etc. In this challenging scenario, one fundamental question to be answered is: Is Newtonian gravitational constant having a physical existence? We would like to suggest that, it’s a man created empirical constant and is having no physical existence. Clearly speaking, it’s not real but virtual. For understanding the secrets of large scale gravitational effects, scientists consider it as a physical constant. In the same way, each atomic interaction can be allowed to have its own gravitational constant. With further study, their magnitudes can be refined for a better understanding of the nature. Thinking in this way, we tried to fit the Newtonian gravitational constant. It’s estimated value seems to be 6.679855x10^(-11) m3/kg/sec2. Proceeding further, the famous radiation constants can be shown to be complex or secondary physical constants. By considering proton neutron stability, nuclear binding energy, nuclear charge radii, neutron life time, Fermi’s weak coupling constant and strong coupling constant, we are trying to understand the validity of the proposed three atomic gravitational constants. It needs further study.

The study of vegetation community and structural change has been central to ecology for over a century, yet how disturbances reshape the physical structure of forest canopies remains relatively unknown. Moderate severity disturbance including fire, ice storms, insect and pathogen outbreaks, affects different canopy strata and plant species, which may give rise to variable structural outcomes and ecological consequences. Terrestrial lidar (light detection and ranging) offers an unprecedented view of the interior arrangement and distribution of canopy elements, permitting the derivation of multidimensional measures of canopy structure that describe several canopy structural traits with known linkages to ecosystem functioning. We used lidar-derived canopy structural measured within a machine learning framework to detect and differentiate among various disturbance agents, including moderate severity fire, ice storm damage, age-related senescence, hemlock woolly adelgid, beech bark disease, and chronic acidification. We found that disturbance agents such as fire and ice storms primarily affected the amount and position of vegetation within canopies, while acidification, pathogen and insect infestation, and senescence altered canopy arrangement and complexity. Only two of the six disturbance agents significantly reduced leaf area, indicating that this commonly quantified canopy feature is insufficient to characterize many moderate severity disturbances. Rather, measures of canopy structure, including those that describe multidimensional change, are needed to characterize disturbance at moderate severities because structural changes from these events are spatially and quantitatively variable. Our findings suggest that standard disturbance detection methods, such as optical based remote sensing platforms, may currently be limited in their ability to detect, differentiate, and characterize disturbance. Further, we conclude that a more broadly inclusive definition of ecological disturbance that incorporates multiple aspects of canopy structure change will improve the modeling, detection, and prediction of functional implications of moderate severity disturbance.

The manuscript wants to investigate the debate on urban resilience and climate change linking theory and practice, describing the possible innovations that concern urban design, urban normative and regional laws developing in different countries. The approach pursued would encourage resilience and flood protection through smart planning and through the architectural and urban project; considering public space as strategic soil where developing the resilient city, using engineering technical climate defence as new space for citizens and communities. Resilience themes are included in all levels of government and in spatial and strategic development policies such as in some project concerning public and private space and in municipal plans; the urban defense structures has to become new pleasant space for the city; these actions will not only contribute to making cities more resilient but will contribute to the creation of a more pleasant and attractive urban environment. The Resilience is the main keyword of some strategic vision of the Netherlands and of Italian laws and the concept is tested in some best practice such as in Rotterdam, in Bordeaux, in London and in the research carried out by "Arquitectos de Cabecera" in Barcelona. Resilience is seen as a new paradigm of smart planning.

Graphite nanoplatelets (GNPs) were produced from flake graphite that had been immersed in isopropyl alcohol solution (70%) and converted to powder form in an ultrasonic bath (5 h, room temperature). Scanning and transmission electron microscopy, X-ray diffractometry, and Raman spectroscopy identified 120-nm-thick GNP crystallites and 0.5–21 µm plates with different areas and shapes. Extensive exfoliation was observed by transmission electron microscopy with abundant multilayer and some monolayer GNPs. X-ray diffractometry confirmed 43 GNP layers along the c-axis. Raman spectroscopy indicated well-defined GNPs with few defects and no oxide content. Rietveld analysis indicated a GNP crystal lattice with stacks of parallel two-dimensional graphene layers and tightly bound hybridized carbon atoms stacked in a translational …ABAB… sequence in hexagonal rings.

Automatic methods for constructing navigation routes do not fully meet all requirements. The aim of this study was to modify the methodology for generating indoor navigation models based on the Medial Axis Transformation (MAT) algorithm. The simplified method for generating corridor axes relies on the Node-Relation Structure (NRS) methodology. The axis of the modeled structure (corridor) is determined based the points of the middle lines intersecting the structure (polygon). The proposed solution involves a modified approach to the segmentation of corridor space. Traditional approaches rely on algorithms to construct Triangulated Irregular Networks (TINs) by Delaunay triangulation or algorithms for generating Thiessen polygons known as Voronoi diagrams (VDs). In this study, both algorithms were used in the segmentation process. The edges of TINs intersect structures. Selected midpoints on TIN edges, which are located in the central part of the structure, are used to generate VDs. Polygon VDs segment corridor structures. The identifiers or structure nodes are the midpoints on TIN edges rather than the calculated centroids. The generated routes are not zigzag lines, and they approximate natural paths. The main advantage of the proposed solution is its simplicity which can be attributed to the use of standard tools for processing spatial data in a geographic information system.

In this paper, a novel biocompatible alloy defined as FeMoTaTiZr was obtained and functionalized by hydroxyapatite-based coatings (HAP) in order to increase their biocompatibility, bioactivity, and resistance to corrosion for to be used as bone implants. To obtain the surface with antibacterial properties, the HAP coatings were doped with small amount of Zn. The alloy was prepared using the VAR (Vacuum Arc Remelting) equipment, while the coatings by RF magnetron sputtering method. The EDS analysis confirmed the presence of Ca and P in the case of all developed coatings, having Ca/P or Ca/(P+Zn) ratio of about 1.70 and 1.66, respectively. The XRD and ATR-FTIR investigations confirmed the presence of calcium phosphate phases. The roughness of uncoated substrates increased after coating with HAP, and it was considerably increased by the Zn addition. The electrochemical tests showed that the un-doped HAP exhibited good corrosion behavior, while Zn doped HAP coatings have a high dissolution rate in fetal bovine serum, being more proper as a biodegradable material.

A physical model based on the mechanism observed in experimental investigations is introduced to describe the formation of negative leader steps. Starting with a small length of a space leader located at the periphery of the negative streamer system of the stepped leader the model simulates the growth and the subsequent formation of the leader step. Based on the model, the average step length, the average step forming time and the average stepped leader propagation speed is estimated as a function of prospective return stroke peak current. The results show that the average step length and the average leader speed increases with increasing prospective return stroke current. The results also show that the speed of the stepped leader increases as it approaches the ground. For a 30 kA prospective return stroke current the average leader speed obtained is about 5 x 10⁵ m/s and the average step length was about 10 m. The results obtained are in reasonable agreement with the experimental observations.

The capacity and the mechanism of the adsorption of aqueous barium (Ba), cobalt (Co), strontium (Sr) and zinc (Zn) by Ecuadorian (NatAllo) and synthetic (SynAllo-1 and SynAllo-2) allophanes were studied as a function of contact time, pH and metal ion concentration using kinetic and equilibrium experiments. The mineralogy, nano-structure and chemical composition of the allophanes were characterized by X-ray diffraction, Fourier transform infrared spectroscopy, transmission electron microscopy and specific surface area analyses. The evolution of adsorption fitted to a pseudo-first-order reaction kinetics, where equilibrium between aqueous metal ions and allophane was reached within < 10 min. The metal ion removal efficiencies varied from 0.7 to 99.7 % at pH 4.0 to 8.5. At equilibrium, the adsorption behavior is better described by the Langmuir model than by the Dubinin-Radushkevich model, yielding sorption capacities of 10.6, 17.2 and 38.6 mg/g for Ba^(2+), 12.4, 19.3 and 29.0 mg/g for HCoO_2^-, 7.2, 15.9 and 34.4 mg/g for Sr^(2+) and 20.9, 26.9 and 36.9 mg/g for Zn^(2+), respectively, by NatAllo, SynAllo-2 and SynAllo-1. The uptake mechanism is based on a physical adsorption process. Allophane holds great potential to remove aqueous metal ions and could be used instead of zeolites, montmorillonite, carbonates and phosphates for wastewater treatment.

A new framework in quantum chemistry has been proposed recently ("An approach to first principles electronic structure calculation by symbolic-numeric computation'' by A. Kikuchi). It is based on the modern technique of computational algebraic geometry, viz. the symbolic computation of polynomial systems. Although this framework belongs to molecular orbital theory, it fully adopts the symbolic method. The analytic integrals in the secular equations are approximated by the polynomials. The indeterminate variables of polynomials represent the wave-functions and other parameters for the optimization, such as atomic positions and contraction coefficients of atomic orbitals. Then the symbolic computation digests and decomposes the polynomials into a tame form of the set of equations, to which numerical computations are easily applied. The key technique is Grröbner basis theory, by which one can investigate the electronic structure by unraveling the entangled relations of the involved variables. In this article, at first, we demonstrate the featured result of this new theory. Next, we expound the mathematical basics concerning computational algebraic geometry, which are necessitated in our study. We will see how highly abstract ideas of polynomial algebra would be applied to the solution of the definite problems in quantum mechanics. We solve simple problems in "quantum chemistry in algebraic variety'' by means of algebraic approach. Finally, we review several topics related to polynomial computation, whereby we shall have an outlook for the future direction of the research.

The cosmological relevance of emptiness—that is, space without bodies—is not yet sufficiently appreciated in natural philosophy. This paper addresses two aspects of cosmic emptiness from the perspective of natural philosophy: the distances to the stars in the closer cosmic environment and the expansion of space as a result of the accelerated expansion of the universe. Both aspects will be discussed from both a historical and a systematic perspective. Emptiness can be interpreted as “coming” in a two-fold sense: Whereas in the past knowledge of emptiness as it were came to human beings, in the future it is coming insofar as its relevance in the cosmos will increase.The longer and more closely emptiness was studied since the beginning of modernity, the larger became the spaces over which it was found to extend. From a systematic perspective, I will show with regard to the closer cosmic environment that the earth may be separated from the perhaps habitable planets of other stars by an emptiness that is inimical to life and cannot be traversed by humans. This assumption is a result of the discussion of the constraints and possibilities of interstellar space travel as defined by the known natural laws and technical means. With the accelerated expansion of the universe, the distances to other galaxies (outside of the so-called local group) are increasing. According to the current standard model of cosmology and assuming that the acceleration will remain constant, in the distant future this expansion will lead first to a substantial change in the epistemic conditions of cosmological knowledge and finally to the completion of the cosmic emptiness and of its relevance, respectively. Imagining the postulated completely empty last state leads human thought to the very limits of what is conceivable.

Based on panel data of 31 provincial-level administrative units (excluding Hong Kong, Macao and Taiwan) in China from 2015 to 2019, using fixed effect model and mediation effect model, this paper makes an empirical analysis on the interaction among digital economy, industrial structure upgrade and high-quality economic development. The results show that, from the overall effect, the digital economy can significantly promote the high-quality development of the economy, and there are regular regional differences, and the relationship between the promotion intensity and the development level of the digital economy is proportional. From the mediation effect, in the relationship between digital economy and high-quality economic development, the upgrade of industrial structure has played a significant part of the mediation effect, the proportion of mediation effect is 25.17% . In addition, the mediation effect of industrial structure upgrade has obvious regional difference, the western area is the strongest, the eastern area is the second, the central area is the weakest. Based on the above research,the concrete policy suggestions are given to promote the development of digital economy and upgrade the level of industrial structure to promote the high-quality development of economy.

We examine the mass balance of the glaciers in the Novaya Zemlya Archipelago, located in the Russian High Arctic using time series of time-variable gravity from the NASA/DLR Gravity Recovery and Climate Experiment (GRACE) mission, laser altimetry data from the NASA Ice Cloud and land Elevation Satellite (ICESat) mission, and radar altimetry data from the ESA CryoSat-2 mission. We present a new algorithm for detecting changes in glacier elevation from these satellite altimetry data and evaluate its performance in the case Novaya Zemlya by comparing the results with GRACE. We find that the mass loss of Novaya Zemlya increased from 10±5 Gt/yr over 2003-2009 to 14±4 Gt/yr over 2010-2016, with a brief period of near mass balance between 2009 and 2011. The results are consistent across the gravimetric and altimetric methods. Furthermore, the analysis of elevation change from CryoSat-2 indicates that 60\% of the mass loss occurs at low elevation, where thinning rates are highest. We also find that marine-terminating glaciers in Novaya Zemlya are thinning significantly faster than land-terminating glaciers, which indicates an important role of ice dynamics of marine-terminating glaciers. We posit that the glacier changes have been caused by changes in atmospheric and ocean temperatures. We find that the increase in mass loss after 2010 is associated with a warming in air temperatures, which increased the surface melt rates. There is no enough information on the ocean temperature at the front of the glaciers to conclude on the role of the ocean, but we posit that the temperature of subsurface ocean waters must have increased during the observation period.

This article is some review of results that were obtained at 2007-2021 years development of “The Information as Absolute” concept and the informational physical model, which is based on the concept; including a number of fundamental physical problems are briefly considered in framework of the conception and the model. Recently in physics there are several publications, that present lists of the problems. However, those lists are essentially incomplete, for at least two reasons. Firsts of all, a number of phenomena are studied traditionally by philosophy, and so corresponding problems are usually considered to be “metaphysical”. However, they relate also to some concrete physical phenomena. For example, physics evidently studies Matter, and so the metaphysical problems “what is ontology of Matter”, “what is “Space”, “Time” and a few other physical phenomena and notions as well, are really a Meta-physical problems “what does physics study?” There are other fundamental physical problems, which are not considered as such in physics, and are absent in the “fundamental problems lists”. Those include the problems, which really exist, yet are incorporated into standard physical theories, and so are fundamental “implicitly”, which in physics are “solved by default” ‒ and mostly erroneously. Note, though, that a number of “Meta-physical”, and concrete fundamental, problems more in detail are considered in the paper “The Informational Conception and Basic Physics”, https://arxiv.org/abs/0707.4657, v5 (2021), so this paper is, in certain sense, an expanded conclusion of this paper, which includes, correspondingly, more in detail consideration of some more general physical problems; and, besides, in this article, the problem “what are Gravity and Electric Forces” is essentially clarified comparing with the arXiv 2021 paper version above. Besides, the concrete problem “What is Life”, and the rational cosmological model, where a few vague points in standard cosmology rather probably are rationally clarified, while the fundamental problem “matter – antimatter asymmetry” in Matter is solved practically for sure, are considered, and one of recently published rather complete “lists of fundamental problems” is commented in Appendix.

I demonstrate that the macrocosmic gravitational interaction between two masses and the microcosmic electrostatic interaction between two charges unify in simple concepts and mathematical laws when electric charge and ordinary mass are interpreted in reciprocal terms. No previous research has ever attempted to unify charge and mass. The difficulty has been lack of an intelligible definition of charge. A three-point paradigm shift solves the problem, giving convincing evidence – for the first time – that positron and negatron are the ultimate elementary particles. That is, matter is pure positive and negative grains of electricity. Paradigm shift #1: Electron is a moving charge; a charge is static electron – ‘one entity two identities’. This implies that ordinary matter contains equal numbers of positive and negative electrons – observed in motion as ‘electrons’ and at rest as ‘charges’. In motion, a positron-negatron pair obeys the laws of electrodynamics and annihilates; at rest, the pair obeys the laws of electrostatics and neutralizes. Paradigm shift #2: Electron mass and electrostatic field are either positive or negative. Opposite masses and fields, rather than indefinable ‘charge’, make opposite electrons physically different. Paradigm shift #3: Electric charge and ordinary mass interconvert. Positive charge (e⁺) and negative charge (e^-) neutralize to neutral charge (2e⁰), which is nature’s quantum of ordinary mass. Conversely, a quantum of ordinary mass splits to opposite charges e.g. in frictional electrification. The insights systematize the search, identification and classification of ‘elementary particles’, ending decades of confusion in the ‘elementary particle zoo’. They identify a new, stable subatomic particle – a third nucleon.

The exact dynamics of emergence remains one of the most prominent outstanding questions for the field of complexity science. I first discuss various perspectives on emergence in various contexts, then offer a different perspective on understanding emergence in a graph-theoretic representation. From the discussion, an observer’s choice in state space seems to have an effect for that observer to detect emergent behavior. To test these ideas, I analyze the dynamics of all possible spatial state spaces near the critical temperature in an Ising model. As a result, state space topologies that appear more deterministic flip more bits than topologies that appear more random, which is contrary to our intuitions about randomness. In addition, the size of different state spaces constrain a system’s ability to explore various states within the same time frame. These results are important to understanding emergent phenomena in biological systems, which are layered with various state spaces and observational perspectives.

Structure-based design and synthesis of two biphenyl-N-acyl-β-D-glucopyranosylamine derivatives as well as their assessment as inhibitors of human liver glycogen phosphorylase (hlGPa, a pharmaceutical target for type 2 diabetes) is presented. X-ray crystallography revealed the importance of structural water molecules and that the inhibitory efficacy correlates with the degree of disturbance caused by the inhibitor binding to a loop crucial for the catalytic mechanism. The in silico derived models of the binding mode generated during the design process corresponded very well with the crystallographic data.

Collisions of low energy electrons with molecules are important for understanding many aspects of the environment and technologies. Understanding the processes that occur in these types of collisions can give insights into plasma etching processes, edge effects in fusion plasmas, radiation damage to biological tissues and more. A radical update of the previous expert system for computing observables relevant to these processes, Quantemol-N, is presented. The new Quantemol Electron Collision (QEC) expert system simplifyies the user experience, improving reliability and implements new features. The QEC GUI interfaces the Molpro quantum chemistry package for molecular target setups and to the sophisticated UKRmol+ codes to generate accurate and reliable cross-sections. These include elastic cross-sections, super elastic cross-sections between excited states, electron impact dissociation, scattering reaction rates, dissociative electron attachment, differential cross-sections, momentum transfer cross-sections, ionization cross sections and high energy electron scattering cross-sections. With this new interface we will be implementing dissociative recombination estimations, vibrational excitations for neutrals and ions, and effective core potentials in the near future.

Blood Concentrates (BCs) are autologous non-transfusional therapeutical preparations with biological properties applied in tissue regeneration. These BCs differ in the preparation method, in fibrin network architecture, growth factors release as well as in platelet/cell content. Methodological changes result in distinct matrices that can compromise their clinical effectiveness. The present study evaluated the influence of different g-forces and types of tubes in the release of vascular endothelial growth factor (VEGF) from platelet-rich fibrin (PRF) as a function of time. The PRF-like samples were obtained with three g-forces (200, 400, and 800 x g) for 10 minutes in pure glass tubes or in polystyrene-clot activator tubes. Scanning and Transmission electron microscopy was used to morphometric analyzes of PRF’s specimens and flow cytometry was used to quantify VEGF slow release until 7 days. Our results showed that platelets were intact and adhered to the fibrin network, emitting pseudopods and in degranulation. The fibrin network was rough and twisted with exosomic granulations impregnated on its surface. An increase in the concentration of VEGF in the PRF supernatant was observed until 7 days for all g forces (200, 400 or 800 x g), with the highest concentrations observed with 200 x g, in both tubes, glass or plastic. Morphological analyzes showed a reduction in the diameter of the PRF fibers after 7 days. Our results showed that g-force interferes with the shape of the fibrin network in the PRF, as well as affect the release of VEGF stored into platelets. This finding may be useful in applying PRF to skin lesions, in which the rapid release of growth factors can favor the tissue repair process. Our observations point to a greater clarification on the methodological variations related to obtaining PRF matrices, as they can generate products with different characteristics and degrees of effectiveness in specific applications.

This thesis completion works it out to deepen into diverse modeling techniques for Point Absorbers. A combined frequency-time domain model is conceived, designed and developed in Matlab with Fortran as a base, leading to obtain physical variables of primary importance, namely position, velocity and power to energy net balance relationships of absorption. Integration of different degrees of freedom with heave as main executable leads in turn to a single buoy motion focus. Acquisition of the needed hydrodynamic coefficients is provided through application of NEMOH \& BEMIO solvers due to the Boundary Element Methodology. Initially, this Wave-to-motion model is validated by comparison with previous experimental results for a floating cone cylinder shape (Buldra-FO3). A single, generic, vertical floating cylinder is contemplated then, that responds to the action of the passing regular waves excitation. Later, two equally sized vertical floating cylinders aligned with the incident wave direction are modeled for a variable distance between the bodies. For both unidirectional regular and irregular waves as an input in deep water, we approximate the convolutive radiation force function term through the Prony method. By changing the spatial disposition of the axisymmetric buoys, using for instance triangular or rectangular shaped arrays of three and four bodies respectively, the study delves into motion characteristics for regular waves. The results highlight efficient layouts for maximizing the energy production whilst providing important insights into their performance, revealing displacement amplification- and capture width-ratios, while deriving in possible interpretations of scenarios related to the the known park effect. These terms are encompassed by the novelty of a new conceptual Post-Processing methodology in the field, which leads to obtain an optimal distance for the separated bodies with effective energy absorption in a regular wave regime. In conclusion, this computational excursion envisions and proposes potential fields of study, which will surely enhance new connections and link this renewable energy form.

Unmanned aerial vehicles (UAV) provide an unprecedented capacity to monitor the development and dynamics of tree growth and structure through time. It is generally thought that the pruning of tree crops encourages new growth, has a positive effect on fruiting, makes fruit-picking easier, and may increase yield, as it increases light interception and tree crown surface area. To establish the response of pruning in an orchard of lychee trees, an assessment of changes in tree structure, i.e. tree crown perimeter, width, height, area and Plant Projective Cover (PPC), was undertaken using multi-spectral UAV imagery collected before and after a pruning event. While tree crown perimeter, width and area could be derived directly from the delineated tree crowns, height was estimated from a produced canopy height model and PPC was most accurately predicted based on the NIR band. Pre- and post-pruning results showed significant differences in all measured tree structural parameters, including an average decrease in tree crown perimeter of 1.94 m, tree crown width of 0.57 m, tree crown height of 0.62 m, tree crown area of 3.5 m², and PPC of 14.8%. In order to provide guidance on data collection protocols for orchard management, the impact of flying height variations was also examined, offering some insight into the influence of scale and the scalability of this UAV based approach for larger orchards. The different flying heights (i.e. 30, 50 and 70 m) produced similar measurements of tree crown width and PPC, while tree crown perimeter, area and height measurements decreased with increasing flying height. Overall, these results illustrate that routine collection of multi-spectral UAV imagery can provide a means of assessing pruning effects on changes in tree structure in commercial orchards, and highlight the importance of collecting imagery with consistent flight configurations, as varying flying heights may cause changes to tree structural measurements.

In 2011 over 1.7 million people were hospitalized because of a fragility fracture, and direct costs associated with osteoporosis treatment exceeded 70 billion dollars in the United States. Failure to reach and maintain optimal peak bone mass during adulthood is a critical factor in determining fragility fracture risk later in life. Physical activity is a widely accessible, low cost, and highly modifiable contributor to bone health. Here, we will review the evidence linking exercise and physical activity to bone health in women. Bone structure and quality will be discussed, especially in the context of clinical diagnosis of osteoporosis. We will review the mechanisms governing bone metabolism in the context of physical activity and exercise. Questions such as, when during life is exercise most effective, and what specific types of exercises improve bone health, will be addressed. Finally, we will discuss some emerging areas of research on this topic, and will summarize areas of need and opportunity.