The role of hydrogen in a future energy system with a high share of variable renewable energy sources (VRES) is regarded as crucial in order to balance fluctuations in electricity generation. These fluctuations can be compensated for by flexibility measures such as the expansion of transmission, flexible generation, larger back-up capacity and storage. Salt cavern storage is the most promising technology due to its large storage capacity, followed by pumped hydro storage. For the underground storage of chemical energy carriers such as hydrogen, salt caverns offer the most promising option owing to their low investment cost, high sealing potential and low cushion gas requirement. This paper provides a suitability assessment of European subsurface salt structures in terms of size, land eligibility and storage capacity. Two distinct cavern volumes of 500,000 m³ and 750,000 m³ are considered, with preference being given for salt caverns over bedded salt deposits and salt domes. The storage capacities of individual caverns are estimated on the basis of thermodynamic considerations based on site-specific data. The results are analyzed using three different scenarios: onshore and offshore salt caverns, only onshore salt caverns and only onshore caverns within 50 km of the shore. The overall technical storage potential across Europe is estimated at 84.8 PWh_H2, 27% of which constitutes only onshore locations. Furthermore, this capacity decreases to 7.3 PWh_H2 with a limitation of 50 km distance from shore. In all cases, Germany has the highest technical storage potential, with a value of 9.4 PWh_H2, located onshore only in salt domes in the north of the country. Moreover, Norway has 7.5 PWh_H2 of storage potential for offshore caverns, which are all located in the subsurface of the North Sea Basin.

The dynamic behaviour of a machine tool (MT) directly influences the machining performances. The adoption of lightweight structures may reduce the effects of undesired vibrations and increasing the workpiece quality. This paper aims to present and compare a set of hybrid materials that may be excellent candidate to fabricate the MT moving parts. The selected materials have high dynamic characteristics and capacity to damp mechanical vibrations. In this way, starting by the kinematic model of a milling machine that highlights the main critical factors, this study paper evaluates a number of prototypes made of Al Foam sandwiches (AFS), Al Corrugated sandwiches (ACS) and materials reinforced by carbon fibres (CFRP). A set of prototypes has been fabricated, represented the Z-axis ram of a commercial milling machine. The static and dynamical properties have been evaluated by using both FE simulations and experimental tests. The obtained results show that the proposed structures may be a valid alternative to the conventional materials of MT moving parts, increasing machining performances. In particular, the AFS prototype highlighted a damping coefficient that is 20 times greater than a conventional ram (e.g. steel). The CFRP structure is able to satisfy the machining requirements with a reduced weight of 48.5%, while the ACS prototype showed a good trade-off between stiffness and damping.

The consistently positive Australian economic environment and stable population increase have led to a higher demand for new houses in recent years. Prefabrication is a promising method to help alleviate the issues related to housing shortage and affordability due to reduced material wastage, construction delays due to weather conditions, unexpected costs, shortage in labour and onsite risks. With the advancements in automation and manufacturing methods such as Design for Manufacturing and Assembly (DfMA), the quality and precision of prefabricated materials is tightly controlled, and the fabrication and assembly period are reduced. However, the full potential of prefabricated construction is yet to be realised in part due to most of developments being focused on its superstructure. A review of the current available options suitable for houses is necessary to understand the present state of the residential footing industry, which will help evaluate the necessary innovations for the growth of the Australian construction industry considering the local reactive soil conditions. This paper presents a summary of existing footing systems and potential prefabricated footing solutions for low-rise residential structures with one storey to two storeys. This paper also reviews the benefits and challenges of designing, manufacturing, transporting, handling and installing of prefabricated footings on site, which have great influence on the acceptance of these innovative footing systems.

Lightweight composite sandwich structures are laminated composite structures that are composed of thin stiff face sheets bonded to a thicker lightweight core in between. These structures have high potential to be used in marine, aerospace, defense and civil engineering applications due to their high strength to weight ratios and energy absorption capacity.In this study, composite sandwich structures were developed with carbon fiber reinforced polymer composite face sheets and aluminum honeycomb core materials with various thicknesses. Carbon fiber/epoxy composite face sheets were fabricated with lamination of [0/90]_s carbon fabrics by vacuum infusion technique. Al honeycomb layers were sandwiched together with the face sheets using a thermosetting adhesive. Mechanical tests were carried out to determine the mechanical behavior of face sheets, Al cores and the composite structure. Effect of core thickness on the mechanical properties of the sandwich was investigated.

Aeromagnetic data coupled with Landsat ETM+ data and SRTM DEM have been processed in order to map regional hydrogeological structures in the basement complex region of Paiko, north-central Nigeria. Lineaments were extracted from derivative maps from aeromagnetic, Landsat ETM+ and SRTM DEM datasets. Ground geophysical investigation utilizing Radial Vertical Electrical Sounding (RVES) was established in nine transects comprising of four sounding stations which are oriented in three azimuths. Source Parameter Imaging (SPI) was employed to map the average depths structures from aeromagnetic dataset. Selected thematic layers which included lineaments density, lithologic, slope, drainage density and geomorphologic maps were integrated and modelled using ArcGIS to generate groundwater potential map of the area. Groundwater zones were classified into four categories: very good, good, moderate and poor according to their potential to yield sustainable water to drilled wells. Results from RVES survey reveal a close correlation to lineaments delineated from surface structural mapping and remotely sensed datasets. Hydrogeological significance of these orientations suggest that aeromagnetic data can be used to map relatively deep-seated fractures which are likely to be open groundwater conduits while remotely sensed lineaments and orientations delineated from the RVES survey may indicate areas of recharge. Regions with high lineament density have relatively better groundwater potential. This is attributable to areas having deep weathering profiles associated with intrusive bodies that have resulted in intense fracturing in the area. Drill depths in this area should target a minimum of 80 m to ensure sufficient and sustainable supplies to drilled wells. The outcome of this study should act as information framework that would guide the siting of productive water wells and while providing needed information for relevant agencies in need of data for the development of groundwater resources.

Because this issue journal is dedicated to Gelatin here we present a few applications of gelatin in the field of optics. It is understood that optics is the science that studies the production, propagation, interaction and detection of light. Regarding the detection there are some materials sensitive to light (photosensitive) that are used like photomultipliers, CCD’s, crystals, two dimension (2D) materials and more. Among the 2D materials the most popular through several centuries has been gelatin based photographic emulsion that records spatial distributions of light. More recently (1970) films made of Gelatin with Dichromate (DCG) and dyes have been used. We describe some characteristics and applications of these two photosensitive materials. Also we describe examples where gelatin is used as Relative Humidity (RH) sensor and in the fabrication of optical elements based on gelatin. This article is intended to researchers outside the optics community.

In this paper, we scrutinize the axiomatic system of effect algebras which is given by D. J. Foulis and M.K. Bennett in the paper Effect Algebras and Unsharp Quantum Logics. We prove that this axiomatic system consists of independent axioms. To do this, we construct some models to indicate the indepence of each axiom. Therefore none of these axioms can be reduced when constructing any effect algebra. As a result, any algebra is an effect algebra if and only if it verifies (E1)-(E4) axioms.

We introduce optically clear and resilient free-form micro-optical of pure (non-photosensitized) organic-inorganic SZ2080 material made by femtosecond 3D laser lithography (3DLL). This is advantageous for rapid printing of 3D micro-/nanooptics, including their integration directly onto optical fibers. A systematic study on the fabrication peculiarities and quality of resultant structures is performed. Comparison of microlenses’ resiliency to CW and femtosecond pulsed exposure is determined. Experimental results prove that pure SZ2080 is ∼3 fold more resistant to high irradiance as compared with a standard photo-sensitized material and can sustain up to 1.91 GW/cm² intensity. 3DLL is a promising manufacturing approach for high-intensity micro-optics for emerging fields in astro-photonics and atto-second pulse generation. Additionally, pyrolysis is employed to shrink structures up to 40% by removing organic SZ2080 constituents. This opens a promising route towards downscaling photonic lattices and creation of mechanically robust glass-ceramic structures.

In this article, we first present and discuss eighteenth-century descriptions of minerals that contributed decisively to the development of crystallography. Remarkably, these old crystallographic descriptions included morphologies with symmetries incompatible with an internal periodic order of atoms, which, however, have been recognised to be characteristics of quasicrystals. Moreover, we also review a number of studies of minerals with aperiodic crystal structures, including recently reported natural quasicrystals of extra-terrestrial origin. Finally, we discuss the current investigations addressing the search for new quasicrystalline minerals in nature.

A multiscale model that enables quantitative understanding and prediction of the size effect on scattering properties of micro- and nanostructures is crucial for the design of LED surface textures optimized for high light extraction efficiency (LEE). In this paper, a hybrid process for combining full-wave finite-difference time-domain simulation and a ray-tracing technique based on a bidirectional scattering distribution function model is proposed. We apply this method to study the influence of different pattern sizes of a patterned sapphire substrate on GaN-based LED light extraction from the microscale to the nanoscale. The results show that near-wavelength–scaled patterns with strong diffraction are not expected to enhance LEE. By contrast, microscaled patterns with optical diffusion behavior have the highest LEE at a specific aspect ratio, and subwavelength-scaled patterns that have antireflection properties show marked enhancement of LEE for a wide range of aspect ratios.

Due to the increase in the emission of greenhouse gases, the hydrologic cycle is being altered on the daily basis. This has affected the variations in relations of intensity, duration, and frequency of rainfall events. Intensity Duration Frequency (IDF) curves describe the relationship between rainfall intensity, rainfall duration and return period. IDF curves are one of the most often applied implements in water resource engineering, in areas such as for operating, planning and designing of water resource projects, or for numerous engineering projects aimed at controlling floods. In particular, IDF curves for precipitation answer problems of improper drainage systems or conditions and extreme characters of precipitation which are the main cause of floods in Nyabugogo catchment. This study aims to establish Rainfall IDF empirical equations, curves and hydrological discharge (predicted peak rate of runoff (Qlogy)) equations for eight Districts that will be used for designing an appropriate and sustainable hydraulic structures for controlling flood to reduce potential loss of human and aquatic life, degradation of water, air and soil quality and property damage and economic lessen caused by flood in Nyabugogo catchment. However Goodness of Fit tests revealed that Gumbel’s Extreme-Value Distribution method appears to have the most appropriate fit compared with Pearson type III distribution for validating the Intensity-Duration-Frequency curves and equations through the use of daily annual for each meteorological station. The findings of the study show that the intensity of rainfall increases with a decrease in rainfall duration. Additionally, a rainfall of every known duration will have a higher intensity if its return period is high, while the predicted peak rate of runoff (Qlogy) increases also with an increase in the intensity of rainfall.

The main objective of this communication is to describe the ‘Global Salt Cycle’. Giant salt accumulations are commonly found along continental margins of former rifts. The first stage in the accumulation process is saturation of newly formed oceanic crust with seawater. Final mobilisation and accumulation of the salts occurs during rifting, localised in the vicinity of relict subduction zones. Oceanic crust is created along the spreading ridges in the deep oceans of the Earth. It exchanges mass and energy with seawater in hydrothermal circulation cells that penetrate deep into the new and fractured crust. Water-rock interactions include the formation of hydrated and hydroxylated minerals, e.g., serpentinites and clay minerals. By incorporating hydroxyl groups and water in their crystal lattices, the salinity of remaining brines increases. Subduction of oceanic crust and serpentinised lithosphere transports water, hydrated minerals, and marine salts deep into the crust and mantle. Upon pressurisation and heating of the subducting slab, different parts of this water are expelled at different depths/temperatures. The resulting fluids will contain salts brought in with the slab, as well as new salts formed by water-rock interaction. The combination of elevated pressures and temperatures, water, salinity, and CO2, create permeability in the normally impermeable, peridotitic mantle, by altering the fluid-rock dihedral angles of mineral grains. This P/T-determined intergranular permeability allows ascent of saline fluids, under lithostatic pressure, within the mantle wedge, or the slab itself. The fluids produce a mechanically weakened and buoyant zone within the mantle wedge due to high pore pressure between mineral grains and reduced mantle density. During the lifetime of a subduction zone, a substantial accumulation of saline fluids within the mantle wedge and crust, is evident. Deep, fluid reservoirs accumulate between the subduction trench and the volcanic front. They may exist for hundreds of millions of years, even after the extinction of the subduction zone. Saline fluids may escape to the surface along deep faults, due to overfilling of available pores/fractures. Fluids within the mantle wedge may form rock melts or exist as supercritical, mineral rich fluids. The combination of reduced pressure due to rifting, and a saline and buoyant mantle, creates a mantle circulation that brings the accumulated, saline fluids, to crustal levels. Salts will therefore accumulate during initial stages of rifting as a result of massive fluid expulsion, phase change and boiling of mantle fluids. No extra energy is required to produce phase change and boiling. The result is formation of solid salts or dense brines/slurries invading fractured crustal rocks, or escaping to the surface/seabed. This process may take place both before and after the sea has invaded a continental rift.

Research shows that in earthquakes the ground response changes in areas where there are underground cavities. Due to the fact that subways and underground tunnels pass from beneath buildings in urban areas, these changes in ground response have a direct impact on the seismic behavior of structures. In this study, first by model validity and reliability of the results, steel structures modeling was conducted and steel structure behavior was evaluated due to Tunnel-Soil-Structure seismic interaction. Parameters studied are number of stories, soil type, tunnel depth, horizontal tunnel-structural distance and dynamic loading. Considering that one of the most important parameters of structural control is drift and story displacement, so this important factor will be considered. The results show that tunneling has a direct effect on the rate of structural displacement and increases the structural response. Also, the behavior of the structure is affected by the position of the structure at the ground level and the position of the tunnel and this should be considered during the design phase of the structures.

Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Modern day construction is widely influenced using concrete-steel composite columns. A lot of research on concrete-steel composite columns is being carried out around the world. The rapid growth in concrete-steel composite construction has widely decreased the use of conventional reinforced cement concrete construction (R.C.C), and the steel construction practices. The concrete-steel composite construction has obtained an extensive receiving around the globe. As Pakistan is a developing country, so, it is relatively a new concept for its construction industry when compared with the developed countries around the globe. Although, the R.C.C construction is suitable and economical for construction of framing systems of low-rise buildings, however, the increased dead load, span restrictions, less stiffness and risky formwork makes it uneconomical and unviable when it comes across the construction of intermediate to high-rise buildings. This research is an effort to learn the cost effectiveness, increased or decreased stiffness, and change on the functionality of the composite construction for intermediate to high-rise buildings constructed in Pakistan. A Base + Ground + 11 storey commercial building is selected for this study. A comparison is made between conventional R.C.C columns structure and concrete-encased composite columns structure. The equivalent static nonlinear analysis is performed using ETABS 2017 software. Although, for Base + Ground + 11 storey building, the construction cost of concrete-encased composite structure is 7.7% more than the conventional R.C.C columns structure, but the concrete-encased composite structure will have 13.013% more constructed floor area. This increased floor area helps to settle the cost difference between the two structures.

A critical discussion on the computation of the dispersion diagram in periodic one-dimensional guiding structures is carried out. In particular, an analysis is presented of the pros and cons of combined methods that make use of full-wave simulations done with commercial software packages with further analytical post-processing based on simplifications brought by an equivalent circuit model of the structure. Some of the most common methods reported in the literature are reviewed and their advantanges and limitations highlighted. Our discussion is complemented with several selected numerical examples in order to discuss the most relevant aspects that a potential user of these methods should be aware of. Special attention is paid to the relevant role played by the high-order coupling between the two halves of a symmetric unit cell of the periodic structure.

The Grand Ethiopian Renaissance Dam (GERD), formerly known as the Millennium Dam, is currently under construction and has been filling at a fast rate without sufficient known analysis on possible impacts on the body of the structure. The filling of GERD not only has an impact on the Blue Nile Basin hydrology, water storages and flow but also pose massive risks in case of collapse. Rosaries Dam located in Sudan at only 116 km downstream of GERD, along with the 20 million Sudanese benefiting from that dam, would be seriously threatened in case of the collapse of GERD. In this study, through the analysis of Sentinal-1 satellite imagery we show concerning deformation patterns associated with different sections of the GERD’s Main Dam (structure RCC Dam type) and the Saddle Dam (Embankment Dam type). We processed 109 descending mode scenes from Sentinel-1 SAR imagery, from December 2016 to July 2021, using the Differential Synthetic Aperture Radar Interferometry technique to demonstrate the deformation trends of both - the GERD’s Main and Saddle Dams. The time-series generated from the analysis clearly indicates different displacement trends at various sections of the GERD as well as the Saddle Dam. Results of the multi temporal data analysis on and around the project area show inconsistent subsidence at the extremities of the GERD Main Dam, especially the west side of the dam where we recorded varying displacements in the range of 10 mm to 90 mm at the crest of the dam. We conducted the current analysis after masking the images with a coherence value of 0.9 and hence, the subsequent results are extremely reliable and accurate. Further decomposition of the subsiding rate has revealed higher vertical displacement over the west side of the GERD’s Main Dam as compared to the east side. The local geological structures consisting of weak zones under the GERD’s accompanying Saddle Dam adds further instability to its structure. We identified seven critical nodes on the Saddle Dam that match the tectonic faults lying underneath it, and which display a varying degree of vertical displacements. In fact, the nodes located next to each other displayed varying displacement trends: one or more nodes displayed subsidence since 2017 while the other node in the same section displayed uplift. The geological weak zones underneath and the weight of the Saddle Dam itself may somewhat explain this inconsistency and the non-uniform vertical displacements. For the most affected cells, we observed a total displacement value of ~90 mm during the whole study period (~20 mm/year) for the Main Dam while the value of the total displacement for the Saddle dam is ~380 mm during the same period (~85 mm/year). Analysis through CoastSat tool also suggested a non-uniformity in trends of surface water-edge at the two extremities of the Main Dam.

A finite-difference approach with non-uniform meshes was presented for simulating magnetotelluric responses in 2D structures. We presented the formulation of this scheme and gave some sights into its successful implementation, and compared finite-difference solution with known numerical results and simple analytical solutions. First, a homogeneous half-space model was tested and the finite-difference approach can provide very good accuracy for 2D magnetotelluric modeling. Then we compared to the analytical solutions for the two-layered model, the relative errors of the apparent resistivity and the impedance phase were both increased when the frequency was increased. In the end, we compare our finite-difference simulation results with COMMEMI 2D-0 model with the finite-element solutions. Both results are in close agreement to each other. These comparisons confirm the validity and reliability of our finite-difference algorithm.

Nine variants of regular lattice structures with different relative densities have been designed and successfully manufactured. The produced structures have been subjected to geometrical quality control, and the manufacturability of the implemented selective laser melting SLM technique has been assessed. It was found that the dimensions of the produced lattice struts differ from those of the designed struts. These deviations depend on the direction of geometrical evaluation. Additionally, the microstructures and phase compositions of the obtained structures were characterized and compared with those of conventionally produced 316L stainless steel. The microstructure analysis and X-Ray Diffraction XRD patterns revealed a single austenite phase in the SLM samples. Both a certain broadening and a displacement of the austenite peaks were observed due to residual stresses and a crystallographic texture induced by the SLM process. Furthermore, the mechanical behavior of the lattice structure material has been defined. It was demonstrated that under both quasi-static and dynamic testing, lattice structures with high relative densities are stretch-dominated, whereas those with low relative densities are bending-dominated. Moreover, the linear relationship between the energy absorption and relative density under dynamic loading conditions has been defined

The effects of the surface waves generated by the wind have a significant effect on the currents. A wave current coupled model plays an important role in the design of offshore structures. The interaction between fluids such as incompressible ocean waves and current and offshore structures is significant with many real-time applications in offshore engineering. These coupled models can be applied to Offshore Floating Production Operating and offloading (FPSO), Wind or current turbines and offshore pipelines. The complex issues related to the design are analyzed by using Computational Fluid Dynamics, which requires an investigation of the multiphase flow between wave and current and the structure which is considered restrictive due to the computational cost. If viscous effects are neglected then the single-phase flow models have been recommended, where wave-current interaction have been modelled successfully. Models have been developed where velocities and pressure are computed and the results can be verified with the experimental results available in the literature. In this study the existing numerical methods, mesh types are discussed along with their coupling methods. Here single-phase and multiphase models with small and medium movement are reviewed and their applications are highlighted.

The oil and gas sector has recognised structural integrity assessment of ageing platform for prospective life extension as a rising concern, particularly in encountering the randomness of the harsh ocean environments. This condition leads to uncertainty in wave-in-deck load estimates and a high load level being imposed on offshore structures. This emphasises the necessity of enhanced reliability, as failure might result in inaccessibility because of the uncertainties related to long-distance services, such as accuracy of predictions of loads and responses. Even though the established guidelines present a fundamental assessment, additionally, comprehensive rules are required. This paper performed a reliability analysis incorporating practical approaches that can more accurately represent time-dependent structural deterioration. The following two procedures have been adopted by a majority of significant oil and gas operators to monitor the safety and integrity of these structures: a) Ultimate Strength Assessment (USA) method and b) Reliability Design Assessment (ReDA) method. A comparison of these two reliability approaches was performed on selected ageing jacket structures in the region of the Malaysian sea. The comparative findings, namely, reserve strength ratio (RSR) at various years of the return period (RP) and ratio value for risk of failure regarding the probability of failure (POF), provided a check and balance in strengthening confidence in the results. The findings showed that the structural components might safely survive either using the USA and ReDA method in such conditions, as the reliability indexes were determined to be satisfactory compared to allowable values from ISO 19902 design specifications. Therefore, these evaluations were determined to control the risk level of the structure during the remaining of its lifetime and undertake cost-effective inspections or mitigation strategies when necessary.

Greenwater (splashing of water on the deck) loading is a classical problem faced by the designer of ship-shaped vessels, which becomes even worst when the vessel operates at harsh weather conditions for an extended period. Installation of breakwaters on the deck can play a crucial role in minimizing this impact. However, research on the design and optimization of the breakwater is still at its infancy, and this study aims at shedding further light on this area by proposing and analyzing the effectiveness of three breakwater designs on a fixed box-shaped vessel. Commercial CFD software is used for this investigation. However, the design model (without breakwater) was validated at first against experimental results of green water splashing, before performing the actual simulations with proposed breakwater design. A vertical plate is used as the deck structure, and greenwater pressure at several locations on that plate is measured to compare the effectiveness of various breakwater designs. Overall, breakwaters with openings (perforations, grillages etc.) found to be more effective in minimizing the pressure generated by the greenwater. Nevertheless, there are significant rooms for improvement on breakwater designs, and some topics for further research are also suggested in this regard.

A copula is a useful tool for constructing bivariate and/or multivariate distributions. In this article, we consider a new modified class of (Farlie-Gumbel-Morgenstern) FGM bivariate copula for constructing several dierent bivariate Kumaraswamy type copulas and discuss their structural properties, including dependence structures. It is established that construction of bivariate distributions by this method allows for greater flexibility in the values of Spearman's correlation coefficient rho,  and Kendall's tau . For illustrative purposes, one representative data set is utilized to exhibit the applicability of these proposed bivariate copula models.

Direct sizing criteria represent useful tools in the design of dissipative bracing systems for the advanced seismic protection of existing frame structures, especially when incorporated dampers feature a markedly non-linear behaviour. An energy-based procedure is proposed herein to this aim, focusing attention on systems including fluid viscous devices. The procedure starts by assuming prefixed reduction factors of the most critical response parameters in current conditions, which are evaluated by means of a conventional elastic finite element analysis. Simple formulas relating the reduction factors to the equivalent viscous damping ratio of the dissipaters, ξ_eq, are proposed. These formulas allow calculating the ξ_eq values that guarantee the achievement of target factors. Finally, the energy dissipation capacity of the devices is deduced from ξ_eq, finalizing their sizing process. A detailed description of the procedure is presented in the article, by distinguishing the cases where the prevailing structural deficiencies are represented by poor strength of the constituting members, from the cases having excessive horizontal displacements. A demonstrative application to the retrofit design of a reinforced concrete gym building is then offered to explicate the steps of the sizing criterion in practice, as well as to evaluate the enhancement of seismic response capacities generated by the installation of the dissipative system.

We consider a multitude of topics in mathematics where unification constructions play an important role: the Yang–Baxter equation and its modified version, Euler’s formula for dual numbers, means and their inequalities, topics in differential geometry, etc. It is interesting to observe that the idea of unification (unity and union) is also present in poetry. Moreover, Euler’s identity is a source of inspiration for the post-modern poets.

Temporary pavilions play an important role as experimental fields for architects, designers and engineers, apart from providing exhibition spaces. Novel structural and formal solutions applied in pavilions also can give them unusual appearance that attracts eyesight of spectators. In this article authors explore the possibility of combination of structural novelty, visual attractiveness and low-cost by a design and construction of a temporary pavilion. For that purpose, an innovative structural system and design approach was applied, i.e. membrane structure designed in Rhino and Grasshopper environments with the use of Kiwi!3D IsoGeometric analysis tool. The designed pavilion, named Obverse/Reverse, was built in Opole, Poland, for the occasion of World Architecture Day in July 2019. Design and construction was performed by the authors in cooperation with students’ organisation Humanisation of Urban Environment from the Faculty of Architecture Wroclaw University of Science and Technology. The Rresultant pavilion proved the possibility of obtaining a low-budgets but visually attractive architectural solution with the adaption of parametrical design tools and some scientific background with innovative structural systems.

Ultrafast laser 3D lithography based on non-linear light-matter interactions, widely known as multi-photon lithography (MPL), offers unrivaled precision rapid prototyping and flexible additive manufacturing options. 3D printing equipment based on MPL are already commercially available, yet there is still no comprehensive understanding of factors determining spatial resolution, accuracy, fabrication throughput, repeatability, and standardized metrology methods for the accurate characterization of the produced 3D objects and their functionalities. The photoexcitation mechanisms, spatial-control or photo-modified volumes, and the variety of processable materials are topics actively investigated. The complexity of the research field is underlined by limited understanding and fragmented knowledge of light-excitation and material response. Research to date has only provided case-specific findings on photoexcitation, chemical modification, and material characterization of the experimental data. In this review, we aim to provide a consistent and comprehensive summary of the existing literature on photopolymerization mechanisms under highly confined spatial and temporal conditions, where, besides the excitation and cross-linking, parameters such as diffusion, temperature accumulation, and the finite amount of monomer molecules start to become of critical importance. Key parameters such as, photoexcitation, polymerization kinetics, and the properties of the additively manufactured materials at the nanoscale in 3D are examined, whereas, the perspectives for future research and as well as emerging applications are outlined.

Novel bio-inspired materials have gained recently great attention, especially in medical applications. Applying sophisticated design and engineering methods, various polymer-polymer hybrid systems with outstanding performance have been developed in last decades. Hybrid systems composed of bioelastomers and hydrogels are very attractive due to their high biocompatibility and elastic nature for advanced biomaterials used in various medical applications such as drug delivery systems and scaffolds for tissue engineering. Herein, we describe the advances in current state-of-the-art design, properties and applications of polymer-polymer hybrid systems in medical applications. Bio-inspired functionalities, including bioadhesiveness, injectability, antibacterial properties and degradability applicable to advanced drug delivery systems and medical devices will be discussed in a context of future efforts towards development of bioinspired materials.

This work proposes a systematic topology optimization approach to simultaneously design the morphing functionality and actuation in three-dimensional wing structures. The actuation is assumed to be a linear strain-based expansion in the actuation material and a three-phase material model is employed to represent structural and actuating materials, and void. To ensure both structural stiffness with respect to aerodynamic loading and morphing capabilities, the optimization problem is formulated to minimize structural compliance while morphing functionality is enforced by constraining a morphing error between actual and target wing shape. Moreover, a feature mapping approach is utilized to constrain and simplify actuator geometries. A trailing edge wing section is designed to validate the proposed optimization approach. Numerical results demonstrate that three-dimensional optimized wing sections utilize a more advanced structural layout to enhance structural performance while keeping morphing functionality than two-dimensional wing ribs. The work presents the first step towards systematic design of three-dimensional morphing wing sections.

The role of energy and entropy in decomposition of turbulent velocity flow-fields is to be shown in the paper. The decomposition methods based on energy concept are taken into account, namely the Proper Orthogonal Decomposition (POD) and its extension Bi-Orthogonal Decomposition (BOD). Entropy motivated view on the decomposed modes could offer new possibilities in the modes physical interpretation and in Reduced Order Modelling (ROM) strategy efficiency evaluation.

Flooding and overflows are recurring problems in several Brazilian cities, which usually undergo disorderly development. Their causes vary from increased impervious surface areas, deficiency/inefficiency of drainage structures and their maintenance, siltation of rivers, channel obstructions, and climatic factors. This situation is aggravated in the major cities. The Anhangabau watershed lies in the central portion of the city of Sao Paulo – Brazil and covers a drainage area of 5.4 km². The region is highly urbanized and crossed by a major north-south road connection. During heavy rain events, portions of this interconnection passage become compromised, disrupting the flow of vehicles, creating a chaotic situation for the population, as well as losses to the national economy. Observed rainfall records and an existing IDF (intensity duration frequency) curve for the region are used to obtain design storms. To account for climate change, a well know procedure, the equidistance quantile matching method for updating IDF curves under climate change, was applied to the existing historical data. Several different global climate models (GCM) and one regional model were applied to obtain and update rainfall design storm. The GCMs and future scenarios used were from the IPCC Assessment Report 5 (AR5) and two future projections: RCP (representative concentration pathway) 4.5 and 8.5. Alternatives previously proposed to solve to flooding issue are briefly reviewed. On one of the latest studies [1], a few modern concepts of water resources management are presented, and the linear retention measure was found to offer higher potential to mitigate the flooding problem in the lower valley of the watershed. Therefore, this alternative was used to evaluate different design storms scenarios combined with return periods of 25 and 100-years as well as the updated IDF under climate change for RCP 4.5 and RCP 8.5. To model the complex network, representing both road and drainage systems and their interconnections, PCSWMM/SWMM software was applied. Results are presented as flooding maps and show the impacts of the proposed linear retention measure based on the existing IDF curves and the updated IDF curves under climate change for two different drainage system conditions, current and improved with the use of linear retention reservoirs. Results show that the prosed changes on the drainage system help reduce the risk and damage to flooding. The climate change scenarios, however, impose a significant threat and need immediate attention from city planners and stakeholders.

This research aims to study the ultimate limit state (ULS) behaviour of stiffened panel under longitudinal compression by non-linear finite element method (NLFEM). There are different types of stiffeners being used in shipbuilding i.e. T-bar, flat-bar and angle-bar. However, this research focuses on the ultimate compressive strength behaviour of flat-bar stiffened panel. A total of 420 of reliable scenarios of flat-bar stiffened panel are selected for numerical simulation by ANSYS NLFEM. The ultimate strength behaviours obtained were used as data for the development of closed form shape empirical formulation. Recently, Kim et al. [1] proposed for advanced empirical formulation for T-bar stiffened panel and the applicability of the proposed formulation to flat-bar stiffened panel will be confirmed by this study. The accuracy of the empirical formulation obtained for flat-bar stiffened panel has been validated by FE simulation results of statistical analysis (R2 = 0.9435). The outcome obtained will be useful for ship structural designers in predicting the ultimate strength performance of flat-bar type stiffened panel under longitudinal compression.

We introduce the Concept-Model-Graph-View Cycle (CMGVC). The CMGVC facilitates coherent architecture analysis, reasoning, insight, and decision-making based on conceptual models that are transformed into a generic, robust graph data structure (GDS). The GDS is then transformed into multiple views of the model, which inform stakeholders in various ways. This GDS-based approach decouples the view from the model and constitutes a powerful enhancement of model-based systems engineering (MBSE). The CMGVC applies the rigorous foundations of Category Theory, a mathematical framework of representations and transformations. We show that modeling languages are categories, drawing an analogy to programming languages. The CMGVC architecture is superior to direct transformations and language-coupled common representations. We demonstrate the CMGVC to transform a conceptual system architecture model built with the Object Process Modeling Language (OPM) into dual graphs and a stakeholder-informing matrix that stimulates system architecture insight.

The three-point bending behavior of a single Au nanowire deformed with an atomic force microscope was monitored by coherent X-ray diffraction using a sub-micrometer sized hard X-ray beam. While three-dimensional reciprocal-space maps were recorded before and after deformation by standard rocking curves, they were measured by scanning the energy of the incident X-ray beam during deformation at different loading stages. The mechanical behavior of the nanowire is visualized in reciprocal space and a complex deformation mechanism is described. In addition to the expected bending of the nanowire, torsion is detected. Bending and torsion angles are quantified from the high resolution diffraction data.

The article deals with auxetic structures made on the basis of suitably connected rigid rotating squares (from Grima and Evans), with axes of rotation on the squares’ surface. The geometric model and the resulting relationships that allow for the determination of Poisson’s ratio are considered in detail. It is demonstrated that changing the rotation axis position does not affect the negative Poisson’s ratio, equal to -1. The models built confirm the initial considerations and can offer new application possibilities.

Dampers provide safety by control of unwanted motion, due to conversion of mechanical work into another form of energy (e.g., heat). State of the art materials are elastomers including thermoplastic-elastomers. For polymer-appropriate replacement of multi-component shock absorbers comprising mounts, rods, hydraulic fluids, pneumatic devices, or electro-magnetic devices, among others, deep insights of the dynamic thermo-mechanical characteristics of damper materials have to be gained. The ultimate objective is to reduce complexity by utilizing inherent material damping rather than structural (multi-component) damping properties. The objective of this work was to compare the damping behavior of different elastomeric materials including thermoplastic poly(urethane) (TPU), and silicone rubber blends (mixtures of different poly(dimethylsiloxane) (PDMS)). Therefore, the materials were hyper- and viscoelastic characterized, a finite element calculation of a ball-drop test was performed, and for validation the rebound resilience was measured experimentally. In an attempt, the coil-over shock absorber of a model car was replaced by a damper made of the examined and modeled materials. The results revealed that the material parameter determination methodology is reliable, and the data applied for simulation lead to realistic predictions. Interestingly, the rebound resilience of the mixture of soft and hard PDMS (50:50)w% is the highest and the lowest values were measured for TPU.

As long as the non-contact digital printing is not a common standard in the corrugated packaging industry, corrugated board crushing is a real issue that affects the load capacity of the boxes. Crushing mainly occurs during the converting of corrugated board (e.g. analog flexographic printing or laminating) and is a process that cannot be avoided. However, as show in this study, it can be controlled. In this work, extended laboratory tests were carried out on the crushing of double-walled corrugated board. The influence of fully controlled crushing (with a precision: ±10 μm) in the range from 10 to 70 % on different laboratory measurements was checked. Most of the typical mechanical tests were performed e.g. edge crush test, four-point bending test, shear stiffness test, torsional stiffness test, etc. on reference and crushed specimens. The residual thickness reduction of the crushed samples was also controlled. All empirical observations and performed measurements were the basis for building an analytical model of crushed corrugated board. The proven and verified model was then used to study the crushing effect of the selected corrugated board on the efficiency of simple packages with various dimensions.

Optical fiber sensors have become a widely-used tool to perform life-long monitoring of large structures. Different set-ups of sensors can be used to obtain information at different scopes. In this paper, the application of a portable Brillouin optical time domain analysis sensor applied to reinforced concrete beams is presented. The sensor is made up of a single-mode optical fiber applied to the structure that enables the measurement of tensile and compressive axial strain along the beams. The fiber is embedded into a concrete casting and fixed along the reinforcement bars so that a complete correlation can be obtained regarding strain and displacements in linear and non-linear flexural response. The use of four sensing fibers positioned along the beam's length at different vertical positions makes it possible to read the strain variation within the cross-section. In accordance with Bernoulli’s hypothesis, this allows curvature diagrams to be obtained across the structure. The measured curvature is used to set up the moment–curvature relationship, which highlights the possibility of the sensor monitoring structures continuously in space and time.

Understanding the flow in urban environments is an increasingly relevant problem due to its significant impact on air quality and thermal effects in cities worldwide. In this review we provide an overview of efforts based on experiments and simulations to gain insight into this complex physical phenomenon. We highlight the relevance of coherent structures in urban flows, which are responsible for the pollutant-dispersion and thermal fields in the city. We also suggest a more widespread use of data-driven methods to characterize flow structures as a way to further understand the dynamics of urban flows, with the aim of tackling the important sustainability challenges associated to them.

Changes in the amount and the distribution of mean and turbulent quantities in the free shear layer wake of a 2D NACA 0012 airfoil and AR 4 NACA 0012 wing with passive segmented rigid trailing edge (TE) extensions was investigated at the University of Dayton Low Speed Wind Tunnel (UD-LSWT). The TE extensions were intentionally placed at zero degrees with respect to the chord line to study the effects of segmented extensions without changing the effective angle of attack. Force based experiments was used to determine the total lift coefficient variation of hte wing with seven segmented trailing edge extensions distributed across the span. The segmented trailing edge extensions had negligible effect of lift coefficient but showed measurable decrement in sectional and total drag coefficient. Investigation of turbulent quantities (obtained through Particle Image Velocimetry (PIV)) such as Reynolds stress, streamwise and transverse RMS in the wake, reveal a significant decrease in magnitude when compared to the baseline. The decrease in the magnitude of turbulent parameters was supported by the changes in coherent structures obtained through two-point correlations. Apart from the reduction in drag, the lower turbulent wake generated by the extensions has implications in reducing structural vibrations and acoustic tones.

The apparent metal-insulator transition (MIT) in two-dimension (2D) was discovered by Kravchenko et al. [1] more than two decades ago in strongly interacting 2D electrons residing in a Si-metal-oxide-semiconductor field-effect transistor (Si-MOSFET). Its origin remains unresolved. Recently, low magnetic field reentrant insulating phases (RIPs), which dwell between the zero-field (B=0) metallic state and the integer quantum Hall (QH) states where the Landau-level filling factor υ > 1, have been observed in strongly correlated 2D GaAs hole systems with large interaction parameter rs (~20-40) and high purity. A new complex phase diagram was proposed, which includes zero field MIT, low magnetic field RIPs, integer QH states, fractional QH states, high field RIPs and insulating phases (HFIPs) with υ < 1 in which the insulating phases are explained by the formation of Wigner crystal. Furthermore, evidences of new intermediate phases were reported. All contribute to the further understandings of the puzzle. This review article serves the purpose of summarizing those recent experimental findings and theoretical endeavors, to foster future research efforts.

Poly(vinylidene fluoride) nanocomposites processed with different morphologies, such as porous and non-porous films and fibres, have been prepared with silica nanoparticles (SiNPs) of varying diameter (17, 100, 160 and 300 nm) which in turn have encapsulated perylenediimide (PDI), a fluorescent molecule. Structural, morphological, optical, thermal, and mechanical properties of the nanocomposites, with SiNP filler concentration up to 16 wt% were evaluated. Further, cytotoxicity and cell proliferation studies were performed. All SiNPs are negatively charged independently of the pH and more stable from pH 5 upwards. The SiNPs introduction within the polymer matrix increases the contact angle independently of the nanoparticle diameters and the smallest ones (17 nm) improve the PVDF Young modulus from 0.94 ± 0.04 GPa for the pristine polymer film to 1.05 ± 0.06 GPa. Varying filler diameter, physico-chemical, thermal and mechanical properties of the polymer matrix were not significantly affected. Finally, the SiNPs inclusion does not induce cytotoxicity in murine myoblasts (C2C12) after 72 h of contact and proliferation studies reveal that the prepared composites represent a suitable platform for tissue engineering applications, as they allow to combine the biocompatibility and piezoelectricity of the polymer with the possible functionalization and drug encapsulation and release of the SiNP.

Within the task of replacing bronze journal bearings with aluminum the processes taking part on friction surface of high-alloyed aluminum alloys working with steel are investigated. The surface and subsurface layer of experimental aluminum bearings were studied before and after tribological tests by scanning electron microscopy including energy-dispersive analysis. Both structural and composition changes in surface layer are shown. It has been revealed that secondary structures are formed on the surface during friction process and include all the chemical elements of the tribosystem which is a consequence of its self-organization. The interaction behavior of some chemical elements of tribological system is discussed.

Both sand and fly ash were found to be promising for phosphorus removal in bioretention systems. However, nutrient removal in bioretention systems with sand, soil and fly ash was still uncertain due to a lack of data about the influence of layer structure and submerged zone. In this study, a mixture with sand, soil and fly ash (1:1:1) was selected as the base in bioretention systems with different packed layer structures and heights of submerged zone. The comparison of multi-layered structure with mixed structure implied that the used bioretention system with multi-layered structure was superior to that with mixed structure for nitrogen and phosphorus removal. The investigation of the influence of submerged zones on nutrient removal indicated that the submerged zone could significantly improve nitrate removal efficiency with 67.52%-86.32%, while sharply reduce the removal of ammonia nitrogen (from 95.15% to 51.81%) and TP (from 88.66% to 44.50%). Overall evaluation of the effect of packed layer structures and submerged zones suggested that the bioretention system with multi-layered structure at the height of submerged zone at 20-40cm was the most satisfactory, due to its microbial environment.

The need for a relatively quick solution to the problem of providing highways with roadside service facilities necessitates the development of a series of appropriate standard projects. To increase the efficiency of these series, it is advisable to carry out the interconnection of space-planning solutions based on a particular module. Taking into account the variety of planning and landscape characteristics of the sites for the placement of objects of the mainline service, it seems advisable to choose as a module not a square or rectangular, but a triangular configuration, which allows in most cases to harmoniously block the modules. The proposed roof module in the form of a "regular" triangle facing the tetrahedron has a structural basis in the form of a single-tier rod spatial plate. The principal space-planning solutions of all four dozen objects from the approved nomenclature of the mainline service performed in the process of analyzing the possibilities show the real possibility of solving the development tasks on the basis of this system. The use of the proposed modular system makes it possible to successfully solve a number of tasks to reduce the harmful impact on the environment and effectively use renewable energy sources.

Abnormal connections in brain networks of healthy people always bring the problems of cognitive impairments and degeneration of specific brain circuits, which may finally result in Alzheimer’s disease (AD). Exploring the development of the brain from normal controls (NC) to AD is an essential part of human research. Although connections changes have been found in the development, the connection mechanism that drives these changes remain incompletely understood. The purpose of this study is to explore the connection changes in brain networks in the process from NC to AD, and uncover the underlying connection mechanism that shapes the topologies of AD brain networks. In particular, we propose a model named MINM from the perspective of topology-based mutual information to achieve our aim. MINM concerns the question of estimating the connection probability between two cortical regions with the consideration of both the mutual information of their observed network topologies and their Euclidean distance in anatomical space. In addition, MINM considers establishing and deleting connections, simultaneously, during the networks modeling from the stage of NC to AD. Experiment results show that MINM is sufficient to capture an impressive range of topological properties of real brain networks such as characteristic path length, network efficiency, and transitivity, and it also provides an excellent fit to the real brain networks in degree distribution compared to experiential models. Thus, we anticipate that MINM may explain the connection mechanism for the formation of the brain network organization in AD patients.

Laser powder bed fusion (L-PBF) is a type of additive manufacturing technology that processes metal powders into a component. Support structures are an essential part of the L- PBF process as they transfer the laser-induced heat during and shortly after the process to the substrate, sustaining positional accuracy of downward facing surfaces of the component. Since the use of support structures is inevitable, optimized designs for them are crucial in realizing more sustainable production process. In a serial production setup, reducing the lead time and cost of a non-value-added process step like support structure removal is of significance when improving the overall business case and competitiveness.The goal of this study was to verify the applicability of lattice-based support structures for L-PBF. To achieve this, different lattice types as support structures were designed. They were tested, compared and verified for a Siemens gas turbine component. The results showed that the generated lattice-based support structures could be suitable for L-PBF. The supports had to be designed appropriately such that they could preserve the geometry of the part. Furthermore, they had to have a short fabrication time and to be removable easily, preferably without machining or sawing.

Transparent and high-hardness materials have become the object of wide interest. Most notably, it concerns technical glasses and crystals. A notable example is a sapphire – one of the most rigid materials having impressive mechanical stability and good optical properties. Nonetheless, using this material for 3D micro-fabrication is not straightforward due to its brittle nature. On the microscale, selective laser etching (SLE) technology is an appropriate approach for such media. Therefore, we present our research on c-cut crystalline sapphire microprocessing by using femtosecond radiation-induced SLE. Here we demonstrate a comparison between different wavelength radiation (1030 nm, 515 nm, 343 nm) usage for modification inscription and various etchants (Hydrofloridic acid, Sodium Hydroxide, Potassium Hydroxide and Sulphuric and Phosphoric acid mixture) comparison. We show that regular SLE etchants such as Hydrofluoric acid or Potassium Hydroxide are unsuitable materials for selective sapphire laser etching. Meanwhile, a 78% sulphuric and 22% phosphoric acid mixture at 270°C temperature is a good alternative for this process. We present the changes in the material after the separate processing steps. Finally, a protocol for advanced sapphire structure formation and a few exemplary structures are presented.

The nondestructive testing of reinforced concrete chimneys, especially the high ones, is an important element of the assessment of their condition, making it possible to forecast their safe service lifespan. Industrial chimneys are often exposed to the strong action of acidic substances – they are adversely affected by the flue gas condensate on the inside and by acid precipitation on the outside. Initially, this results in the corrosion of the shell concrete and then in the corrosion of the reinforcing steel. During the service life of such chimneys their condition should monitored in order to prevent structural failures and indicate the most endangered parts of the structure. Owing to thermographic surveys one can monitor the hazards leading to the degradation of the chimney structure, which is particularly vital when due to the character of the production process the chimney cannot be put out of operation. The methods for the interpretation of results from thermovision studies to determine the safety and durability of industrial chimneys are shown.

Despite all their advantages, load-bearing concrete shell structures with double curvatures are not frequently in use. The main reason is the complexity of their construction. In such a context, this article starts with a brief, critical review of existing technologies while their pros and cons are highlighted. Against that background the authors then propose a new approach for the highly automated fabrication of gridshell structures from variable modules. To demonstrate the feasibility of such a new technology, a demonstrator called ConDIT 1.0, a sphere-like shell structure composed of several frames was designed and built. The frame modules were fabricated automatically using extrusion-based 3D printing and a printable, strain-hardening cement-based composite (SHCC). This article presents the design of ConDIT 1.0, the mechanical material characterization of printed SHCC, the technology of module production, the results of geometry verification for print modules using 3D scanning, and the procedure for the demonstrator’s assembly.

The present paper deals with the stochastic modeling of bio-colonization for the computation of stochastic hydrodynamic loading on jacket-type offshore structures. It relies on a multidisciplinary study gathering biological and physical research fields that accounts of uncertainties at all the levels. Indeed, bio-colonization of offshore structures is a complex phenomenon with two major but distinct domains (i) marine biology whose processes are modeled with biomathematics methods and (ii) hydrodynamic processes. This paper aims to connect these two domains. It proposes a stochastic model for the marine organism’s growth and then continues with transfers for assessment of drag coefficient and forces probability density functions that accounts for marine growth evolution. A case study relies on the characteristics (growth and shape) of the blue mussel (Mytilus edulis) in northeastern Atlantic.

Heat shock transcription factors (HSFs) participate in regulating many environmental stress responses and biological processes in plants. Maize (Zea mays L.) is a major cash crop that is grown worldwide. However, the growth and yield of maize are affected by several adverse environmental inputs. Therefore, investigating the factors that regulate maize growth and development and resistance to abiotic stress is an essential task for developing stress-resilient maize varieties. Thus, a comprehensive genome-wide identification analysis was performed to identify HSFs in the maize genome. The current study identified 25 ZmHSFs, randomly distributed throughout the maize genome. Phylogenetic analysis revealed that ZmHSFs are divided into three classes and 13 sub-classes. Gene structure and protein motif analysis supported the results obtained through the phylogenetic analysis. Domain analysis showed the DNA-binding domain to be the most conserved region of ZmHSFs. Segmental duplication is shown to be responsible for the expansion of ZmHSFs. Most of the ZmHSFs are localized inside the nucleus, and the ZmHSFs which belong to the same group show similar physio-chemical properties. The 3D structures revealed comparable conserved ZmHSFs protein structures. RNA-seq analysis revealed a major role of class A HSFs including, ZmHSFA-1a and ZmHSFA-2a in all the maize growth stages, i.e., seed, vegetative, and reproductive development. Furthermore, ZmHSFs displayed an obvious spatiotemporal expression. Under abiotic stress conditions (heat, drought, cold, UV, and salinity), members of class A and B ZmHSFs are induced. Gene ontology (GO) annotation analysis indicated a major role of ZmHSFs in resistance to environmental stress and regulation of primary metabolism. Further, the protein-protein interaction analysis showed that ZmHSFs interact with several molecular chaperons and major stress-responsive proteins. To summarize, this study provides novel insights for functional studies on the ZmHSFs in maize breeding programs.

In this paper, the modification of two synthetic steps to obtain EMICORON, with respect to the usual protocol, is reported. EMICORON is a benzo[ghi]perylen-diimmide which was synthesized the first time in our laboratory in 2012 and showed to have in-vivo antitumor activities interfering with tumor growth and development by a multi-target mechanism of action. The provided modifications regarded the reaction times and the reaction conditions as well as the work-up procedures and allowed to increase the global yield of the process from 28% to about 40%. Thus, this new procedure may be more suitable in order to get larger amounts of EMICORON for further preclinical studies.

This paper proposes a radiation pattern synthesis of the almost periodic antenna arrays including mutual coupling effects (that extracted by the Floquet analysis according to our previous work), which principally has a high directivity and large bandwidth. For modeling the given structures, the moment method combined with the Generalized Equivalent Circuit (MoM-GEC) is proposed. The artificial neural network (ANN) as a powerful computational model has been successfully applied to the antenna array pattern synthesis. The results showed that the multilayer feedforward neural networks are rugged and can successfully and efficiently resolve various distinctive complex almost periodic antenna patterns (with different source amplitudes) (in particular, both periodic and randomly aperiodic structures are taken into account). However, the artificial neural network (ANN) is capable of quickly producing the synthesis results using generalization with the early stopping (ES) method. A significant time gain and memory consumption are achieved by using this given method to improve the generalization (called early stopping). To justify this work, several examples are developed and discussed.

Shell-like, double curved and thus above-average performance structures, are usually produced monolithically on site. For industrial advancement, however, they must be divided into transportable modules which can be assembled on the construction site (design for assembly). Models are lattice shells made of steel and glass, in which predominantly flat sub-surfaces (modules) are used. Therefore, the main question is: Which modularizations are suitable for flow production with mineral building materials? In this paper designed free-form surface is going to be discretized as PQ circular mesh system, suitable modules for 3D concrete printing. Moreover, the multi-criteria optimization is done with Response Surface Methodology (RSM) in order to get optimal final shape. The goal is to start from the arbitrary shape, that can be generated from two curves, with possible two-way division into modules and compare it with the resulted discretized PQ circular mesh system, realized with new algorithm. The comparison can be defined through two main criteria: geometrical and structural.

We present an overview over eight brightly luminescent Cu(I) dimers of the type Cu2X2(PN)3 with X = Cl, Br, I and P^N = 2-diphenylphosphino-pyridine (Ph2Ppy), 2-diphenylphosphino-pyrimidine (Ph2Ppym), 1-diphenylphosphino-isoquinoline (Ph2Piqn) including three new crystal structures (Cu2Br2(Ph2Ppy)3, 1-Br, Cu2I2(Ph2Ppym)3, 2-I, and Cu2I2(Ph2Piqn)3, 3-I). However, we mainly focus on their photo-luminescence properties. All compounds exhibit combined thermally activated delayed fluorescence (TADF) and phosphorescence at ambient temperature. Emission color, decay time, and quantum yield varies over large ranges. For deeper characterization, we select Cu2I2(Ph2Ppy)3, 1-I, showing a quantum yield of 81 %. DFT and SOC-TDDFT calculations provide insight into the electronic structures of the singlet S1 and triplet T1 states. Both stem from metal+iodide-to-ligand charge transfer transitions. Evaluation of the emission decay dynamics, measured from 1.2 ≤ T ≤ 300 K, gives ∆E(S1-T1) = 380 cm-1 (47 meV), a transition rate of k(S1→S0) = 2.25×106 s-1 (445 ns), T1 zero-field splittings, transition rates from the triplet substates, and spin-lattice relaxation times. We also discuss the interplay of S1-TADF and T1-phosphorescence. The combined emission paths shorten the overall decay time. For OLED applications, utilization of both singlet and triplet harvesting can be highly favorable for improvement of the device performance.

This paper reports on the production and mechanical properties of Ti6Al4V micro-lattice structures, with strut thickness nearing the single-track width of the laser-based powder bed fusion (LPBF) system used. Besides providing new information on the mechanical properties and manufacturability of such thin-strut lattices, this paper also reports on the in-situ deformation imaging of micro-lattice structures with 6 unit cells in every direction. LPBF lattices are of interest for medical implants, due to the possibility of creating structures with an elastic modulus close to that of the bones and small pore sizes which allow effective osseointegration. In this work four different cubes were produced by laser powder bed fusion and subsequently analyzed using microCT, compression testing and one selected lattice was subjected to in-situ microCT imaging during compression. The in-situ imaging was performed at 4 steps during yielding. The results indicate that mechanical performance (elastic modulus and strength) correlate well with actual density and that this performance is remarkably good, despite the high roughness and irregularity of the struts at this scale. In-situ yielding is visually illustrated.

At present, the world is now passing a very far different time than normal situation due to the COVID-19 pandemic crisis. The global life-style and human civilization is currently progressing with down-stream that affecting almost every sectors necessary for human civilizations except the current environmental situation. To control the COVID-19 spreading, most of the countries are following lockdown process that reduces human mobility, thus reducing the CO2 emission to the environment. Though the COVID-19 pandemic is a blessing for the present environment, however, the post-COVID world will face a massive thrust of energy and only conventional energy resources may not be enough to mitigate the energy demands. Solar power generation technology mainly the photovoltaic (PV) systems and their advancement can be the leading possibilities to minimize the gap between the power demand and generation. It is now time to think how we can improve the PV power generation in future and the post-COVID world. In this encyclopaedia communication, we report on Nano-technological approach to improve the conversion efficiency of GaAs solar cells. We have designed and optimized several types of nano-structured assemblies that can be implemented to reduce the front surface incident light reflection losses thus can assist to improve the conversion efficiency of GaAs solar cells.

Bayesian formulations of learning imply that whenever the evidence for a correlation between events in an animal’s habitat is sufficient, the correlation is learned. This implies that regularities can be learnt rapidly, from small numbers of learning examples. This speed of learning gives maximum possible fitness, and no faster learning is possible. There is evidence in many domains that animals and people can learn at nearly Bayesian optimal speeds. These domains include associative conditioning, and the more complex domains of navigation and language. There are computational models of learning which learn at near-Bayesian speeds in complex domains, and which can scale well – to learn thousands of pieces of knowledge (i.e., relations and associations). These are not neural net models. They can be defined in computational terms, as algorithms and data structures at David Marr’s [1] Level Two. Their key data structures are composite feature structures, which are graphs of multiple linked nodes. This leads to the hypothesis that animal learning results not from deep neural nets (which typically require thousands of training exam-ples), but from neural implementations of the Level Two models of fast learning; and that neu-rons provide the facilities needed to implement those models at Marr’s Level Three. The required facilities include feature structures, dynamic binding, one-shot memory for many feature struc-tures, pattern-based associative retrieval, unification and generalization of feature structures. These may be supported by multiplexing of data and metadata in the same neural fibres.

Branching patterns are ubiquitous in nature, consequently over the years many researchers have tried to characterize the complexity of their structures. Due to their hierarchical nature and resemblance to fractal trees, they are often thought to have fractal properties, however their non-homogeneity (i.e., lack of strict self-similarity) is often ignored. In this paper we review and examine the use of the box-counting and sandbox methods to estimate the fractal dimensions of branching structures. We highlight the fact that these methods rely on an assumption of self-similarity that is not present in branching structures due to their non-homogeneous nature. Looking at the local slopes of the log-log plots used by these methods reveals the problems caused by the non-homogeneity. Finally, we examine the role of the canopies (endpoints or limit points) of branching structures in the estimation of their fractal dimensions.

The prevalence of algorithms and computational tools in the modern-day has intersected with nearly every field. Generative design, specifically those using genetic algorithms, is an increasingly effective, yet cost efficient way to generate architectural designs in modern engineering. Thus, we adopt a genetic algorithm model in pursuit of maximizing the durability of a structure when it is stressed while minimizing the material cost. After the model is formulated, the algorithm is able to approximate with high accuracy the load a small-scale structure is able to bear, as well as iterate upon its designs to maximize a fitness function.

Deformation behavior of MXene based polymer composites with bioinspired brick and mortar structures is analyzed. MXene/Polymer nanocomposites are modeled at microscale using bioinspired configurations of nacre-mimetic brick-and-mortar assembly structure. MXenes (brick) with polymer matrix (mortar) are modeled using classical analytical methods and numerical methods based on Finite Elements (FE). The analytical methods provide less accurate estimation of elastic properties compared to numerical one. MXene nanocomposite models analyzed with FE method provide estimates of elastic constants in the same order of magnitude as literature reported experimental results with good consistency. Bioinspired design of MXene nanocomposites results in the effective Young’s modulus of the nanocomposite increase by 25.1 % and the strength (maximum stress capacity within elastic limits) increase by 42.3 %. The brick and mortar structure of the nanocomposites leads to interlocking mechanism between MXene fillers in polymer matrix, resulting in effective load transfer, good strength, and damage resistance. This is demonstrated in this paper by numerical analysis of MXene nanocomposites subjected to quasi-static loads.

Large-area nanostructuring of glasses using intense laser beam remains a difficult task due to the extreme non-linear absorption of the laser energy by the material. Precise optimization of the process parameters is essential for fabricating nanostructures with large area coverage. In this study, we report the findings on creating high spatial frequency LIPSS (HSFL) on borosilicate glass through direct laser writing, using a femtosecond laser with a wavelength λ = 800 nm, pulse duration τ = 35 fs, and repetition frequency frep = 1 kHz. The orientation of the HSFL was found to be parallel to the electric field vector. We measured the single pulse ablation threshold (Fth=3.87±0.26 J/cm2) and incubation factor (S=0.68±0.03) of Borosilicate glasses for precise control for large area surface structuring. Single-spot experiments indicate that uniform LIPSS formation is limited by melt formation inside the irradiated area for higher fluence and a larger number of irradiated laser pulses. The orientation of the scan axis with the laser beam polarization is found to be significantly influencing the uniformity of the large area processing. We found that the orientation of the scan axis with the laser beam polarization significantly affects the uniformity of large-area processing, with redeposition and melt formation being higher when the scan axis is perpendicular to the laser beam polarization. Large-area processing of the borosilicate glass surface is done by line-by-line scanning over the surface with a scan orientation parallel to the laser beam polarization. The optical characterization reveals that the transmittance and reflectance of the borosilicate glass decreased significantly after processing. Also, the wettability of the surface has been changed from hydrophilic to super hydrophilic after processing. These chemical contamination-free and uniformly distributed structures have potential applications in optics, microfluidics, photovoltaics, and biomaterials.

The non-linear analysis of hollow-core concrete slabs requires the use of advanced numerical techniques, proper constitutive models both for concrete and steel as well as particular computational skills. If prestressing, cracking, crack opening, material softening, etc. are also to be taken into account, then the computational task can far exceed the capabilities of an ordinary engineer. In order for the calculations to be carried out in a traditional design office, simplified calculation methods are needed. Preferably based on the linear finite element (FE) method with a simple approach that takes into account material nonlinearities. In this paper the simplified analysis of hollow-core slabs based on the generalized nonlinear constitutive law is presented. In the proposed method a simple decomposition of the traditional iterative linear finite element analysis and the non-linear algebraic analysis of the plate cross-section is used. Through independent analysis of the plate cross-section in different deformation states, a degraded plate stiffness can be obtained, which allows iterative update of displacements and rotations in the nodes of the FE model. Which in turn allows to update the deformation state and then correct translations and rotations in the nodes again. The results obtained from the full detailed 3D nonlinear FEM model and from the proposed approach are compared for different slab cross-sections. The obtained results from both models are consistent.

As shown earlier, the algorithmic complexity, like Shannon information and Boltzmann entropy, tends to increase in accordance with the general law of complification. However, the algorithmic complexity of most material systems does not reach its maximum, i.e. chaotic state, due to the various laws of nature that create certain structures. The complexity of such structures is very different from the algorithmic complexity, and we intuitively feel that its maximal value should be somewhere between order and chaos. I propose a formula for calculation such structural complexity, which can be called - structuredness. The structuredness of any material system is determined by structures of three main types: stable, dissipative, and post-dissipative. The latter are defined as stable structures created by dissipative ones, directly or indirectly. Post-dissipative structures, as well as stable, can exist for an unlimited time, but at the micro level only, without energy influx. The appearance of such structures leads to the “ratchet” process, which determines the structuregenesis in non-living and, especially, in living systems. This process allows systems with post-dissipative structures to develop in the direction of maximum structuring due to the gradual accumulation of these structures, even when such structuring contradicts the general law of complification.

In Lagrangian dynamics, the detection of coherent clusters can help understand the organization of transport by identifying regions with coherent trajectory patterns. Many clustering algorithms, however, rely on user-input parameters, requiring a priori knowledge about the flow and making the outcome subjective. Building on the conventional spectral clustering method of Hadjighasem et al (2016), a new parameter-free spectral clustering approach is developed that automatically identifies parameters and does not require any user-input choices. A noise-based metric for quantifying the coherence of the resulting coherent clusters is also introduced. The parameter-free spectral clustering is applied to two benchmark analytical flows, the Bickley Jet and the asymmetric Duffing oscillator, and to a realistic, numerically-generated oceanic coastal flow. In the latter case, the identified model-based clusters are tested using observed trajectories of real drifters. In all examples, our approach succeeded in performing the partition of the domain into coherent clusters with minimal inter-cluster similarity and maximum intra-cluster similarity. For the coastal flow, the resulting coherent clusters are qualitatively similar over the same phase of the tide on different days and even different years, whereas coherent clusters for the opposite tidal phase are qualitatively different.

Joints between walls are very important for structural analysis of each masonry building at the global and local level. This issue was often neglected in case of traditional joints and relatively squat walls. Nowadays the issue of wall joints is becoming particularly important due to the continuous strive for simplifying structures, introducing new technologies and materials. Eurocode 6 and other standards (USA, Canadian, Chinese, and Japanese) recommend inspecting joints between walls, but no detail procedures have been specified. This paper presents our own tests on joints between walls made of autoclaved aerated concrete (AAC) masonry units. Tests included reference models composed of two wall panels joined perpendicularly with a masonry bond (6 models), traditional steel and modified connectors (12 models). A shape and size of test models and structure of a test stand were determined on the basis of the analysis of the current knowledge, pilot studies and numerical analyses of FEM. The analysis referred to the morphology and failure mechanism of models. Load-displacement relationships for different types of joints were compared and obtained results were referred to results for reference models. A mechanism of cracking and failure was found to vary, and clear differences in behaviour and load capacity of each type of joints were observed. Individual working phases of joints were determined and defined, and the empirical approach was suggested to determine forces and displacement of wall joints.

Coastal areas are influenced by natural coastal hazards such as hurricanes, storm surges and tsunamis. For centuries coastal structures such as seawalls, detached breakwaters, groins, and revetments have been constructed to protect coastal properties. However, their effectiveness diminishes with time, and they are not adaptable to changing coastal conditions. Ecosystem-based approaches offer protection against erosion and the creation or restoration of coastal habitats. However, the protection properties and the sustainability provided by these systems are not well understood. Salt marshes have been known as one of the ecosystem-based protection systems. They protect coasts and lands by dissipating energy, stabilizing sediments and producing organic matter through blow ground production. Stems of plants dissipate waves propagating over salt marsh and plant roots stabilize soils and sediments. The dissipation rate varies with wave frequency; the low-frequency swell wave is dissipated less on the edge of the marsh than wind-sea waves. Salt and wetlands can also be used for reducing coastal flooding and storm surges, but a wetland is required to successfully attenuate storm surges. A salt marsh can be resilient to sea-level rise in certain conditions. Large sediment supply and gentle upland slope increase salt marsh resiliency to relative sea-level rise. Connecticut marshes, like other marshes in the world, are vulnerable to anthropogenic and climate change effects. However, an assessment of current sea level rise and average marsh accretion rates in Connecticut demonstrates sea level rise is not the main vulnerable factor for salt marshes loss. The study on the feasibility of developing an ecosystem based on two coastlines in Connecticut, Guilford and Stratford, shows that both coastlines, like other coastlines in Connecticut, have limited wave energy, which is a positive factor for marsh growth. The available data assessment represents that sediment supply is the most important parameter to guarantee the resilience and sustainability of a newly developed salt marsh system in Connecticut. In Stratford, conditions for establishing a new ecosystem seem to be better, as the fetch length is pretty small, and there is some sediment supply for the ecosystem. In Guilford, wave energy is limited, but it is more than in Stratford case. In addition, sediment availability is low and the coastline experienced a large erosion during Hurricane Sandy and has not recovered yet.

With the increasing demand for energy worldwide, researchers from different fields have been striving to improve the sustainability and proper utilization of energy resources. Passive radiative cooling, as a natural energy transport method, can achieve cooling without additional external energy input. This review provides a comprehensive examination of passive radiative cooling, including its fundamental theories and latest development. A particular emphasis is placed on the diverse range of fields where passive radiative cooling has been applied, notably including but not limited to construction and architecture. The current state of applications, potential challenges that may arise with wider adaption and promising research directions for each field are thoroughly discussed. This review underscores the universal applicability and feasibility of passive radiative cooling and contributes to its future development by identifying promising areas for further exploration.

Nowadays, we use social networks such as Twitter, Facebook, WeChat and Weibo as means to communicate with each other and get to know others. Gradually social networks has become indispensable in our everyday life, and we cannot absolutely imagine what the daily life would be like without social networks. Through social networks, we can access friends' opinions and behaviors easily and are influenced by them in turn. Thus, an effective algorithm to find the top-K influential nodes (the problem of influence maximization) in the social network is critical for various downstream tasks such as viral marketing, anticipating natural hazards, reducing gang violence, public opinion supervision etc. Solving the problem of influence maximization in real-world propagation scenarios often involves estimating influence strength (influence probability between two nodes), which cannot directly observed. To estimate influence strength, conventional approaches propose various humanly-devised rules to extract features of user interactions, the effectiveness of which heavily depends on domain expert knowledge. Besides, they are often applicable for special scenarios or specific diffusion models. Consequently, they are difficult to be generalized into different scenarios, diffusion models and even domains. Inspired by the powerful ability of neural networks in the field of representation learning, we design a deep hierarchical network embedding model HGE to map nodes (with attributes) into latent space automatically. In general, HGE takes an attributed social network as the input for learning latent network representation of each node, incorporating hierarchical community structure, node attributes and general network structure into a unified deep generative framework. Then, with the leaned latent representation of each node, we propose a HGE-GA algorithm to predict influence strength and compute the top-K influential nodes through a greedy-based maximization algorithm. Extensive experiments on real-world attributed networks demonstrate the outstanding superiority of the proposed HGE model and HGE-GA algorithm compared with the state-of-the-art methods, verifying the effectiveness of the proposed model and algorithm.

The work presents an approach to instrument the load sensing bearings for automotive applications for estimation of the loads acting on the wheels. The system comprises fiber-optic sensors based on addressed fiber Bragg structures (AFBS) with two symmetrical phase shifts. A mathematical model for load-deformation relation is presented, and the AFBS interrogation principle is described. The simulation includes (i) modeling of vehicle dynamics in a split-mu braking test, during which the longitudinal wheel loads are obtained, (ii) the subsequent estimation of bearing outer ring deformation using a beam model with simply supported boundary conditions, (iii) the conversion of strain into central wavelength shift of AFBS, and (iv) modeling of the beating signal at the photodetector. The simulation results show that the estimation error of the longitudinal wheel force from the strain data acquired from a single measurement point was 5.44% with root-mean-square error of 113.64 N. A prototype load sensing bearing was instrumented with a single AFBS sensor and mounted in a front right wheel hub of an experimental vehicle. The experimental setup demonstrated comparable results with the simulation during the braking test. The proposed system with load-sensing bearings is aimed at estimation of the loads acting on the wheels, which serve as input parameters for active safety systems, such as automatic braking, adaptive cruise control, or fully automated driving, in order to enhance their effectiveness and safety of the vehicle.

Corrugated cardboard is an ecological material, mainly because, in addition to virgin cellulose fibers also the fibers recovered during recycling process are used in its production. However, the use of recycled fibers causes slight deterioration of the mechanical properties of the corrugated board. In addition, converting processes such as printing, die-cutting, lamination, etc. cause micro-damage in the corrugated cardboard layers. In this work, the focus is precisely on the crushing of corrugated cardboard. A series of laboratory experiments were conducted, in which the different types of single-walled corrugated cardboards were pressed in a fully controlled manner to check the impact of the crush on the basic material parameters. The amount of crushing (with a precision of 10 micrometers) was controlled by a precise FEMat device, for crushing the corrugated board in the range from 10 to 70 % of its original thickness. In this study, the influence of crushing on bending, twisting and shear stiffness as well as a residual thickness and edge crush resistance of corrugated board was investigated. Then, a procedure based on a numerical homogenization, taking into account a partial delamination in the corrugated layers to determine the degraded material stiffness was proposed. Finally, using the empirical-numerical method, a simplified calculation model of corrugated cardboard was derived, which satisfactorily reflects the experimental results.

This paper is a continuation of previous papers on unification theories publishes in AXIOMS. We present results about the (modified) Yang-Baxter equation, Euler’s formula, dual numbers, coalgebra structures, non-associative structures, differential geometry, and (mean) inequalities. We will also attempt to relate our discussion to some Brain Studies and Machine Learnig.

The structure of wound dressing materials presents one of the most relevant characteristics for effective skin tissue repair. Electrospinning is a common technique used to produce polymeric fibres that can mimic fibrillar disposition of skin extracellular matrix, favouring cell migration, and thus regeneration of the damaged tissue. Moreover, beads, also known as by-products of electrospinning, have potential as reservoirs for sustained drug release. Processing parameters, such as molecular weight and viscosity of the polymer solution, can affect the desirable morphologies of electrospun films. Thereby, this work had the purpose of producing and characterized electrospun polycaprolactone (PCL) mats loaded with propolis, a popular extract in traditional medicine with potential for skin repair aid. Films with different morphologies were obtained depending on the storage period of the solution prior to the lectrospinning, probably due to the PCL hydrolysis. FTIR analyses of the extract confirmed propolis composition. GPC and viscosity analyses demonstrated that the decrease in molar mass over the storage period was responsible for nanostructure diversity. Propolis acts as a lubricant agent, affecting the spun solutions' viscosity and the thermal properties and hydrophilicity of the films. All films are within the value range of the water vapour transpiration rate of the commercial products. The presence of beads did not affect the propolis release pattern. However, "in vitro" wound healing assay showed that propolis-loaded films composed by beaded fibres increased the cell migration process. Thus, it can be inferred that these films presented the potential for wound dressing application.

In light of climate changes, technological development and the use of renewable energy sources are considered very important nowadays, both in newly-designed structures and reconstructed historic building, resulting in the reduction of the commercial energy consumption and CO₂ environmental emissions. This paper explores the possibilities of improving the energy efficiency of heritage sacred buildings by utilizing photovoltaic systems. As an exceptionally significant cultural good, the Cathedral of St. Michael the Archangel in Belgrade shall serve as a case study, with the aim of examining the methods of mounting photovoltaic (PV) panels, by taking into account the fact that the authenticity and the aesthetic value of this cultural monument must remain intact. A comparative analysis of the two options for installing PV panels on the southwestern roof of the church was performed using simulations in PVgis and PVsist V6.84 software, with the aim of establishing the most efficient option in terms of power generation. The simulation results show that photovoltaic panels can produce 151650 kWh (Option 1) and 150894 kWh (Option 2) per year, while the required amount of energy is 42726.77 kWh. The electricity produced exceeds the electricity requirements for the decorative lighting of the Cathedral Church, so it can be used for other purposes in the sacral complex.

Supramolecular structures are of great interest due to their applicability in various scientific and industrial fields. These fields of scientific action include promising applications i biomedical areas, in sensing, and in conductive and electrical phases. The sensible definition of supramolecular molecules is being set by investigators, who, because of the different sensitivities of their methods and observational timescales, may have different views as to what constitute these supramolecular structures. Besides, diverse polymers can be found to offer unique avenues for multifunctional systems with properties in medicine industrial applications. Aspects of this review provide different conceptual strategies to address molecular design, properties, and potential applications of self-assembly materials and the use of metal coordination as a feasible and useful strategy for constructing complex supramolecular structures. In this order of appreciations and ideas order, it is that this review report involves classic topics such as hydrogels that range from their relationship with drug delivery systems, to metallo-supramolecular materials, through applications in ophthalmic systems, in applications that require adhesiveness and electrically conductive hydrogels. This review also addresses systems that are largely based on hydrogel chemistry and the enormous opportunities to design very specific structures for applications that demand enormous specificity.

As a part of the European Green Deal, the Corporate Sustainable Reporting Directive will apply to over 50,000 companies in Europe, meant to advance the quality of sustainability reporting in the EU, and reduce global emissions and emission distribution inequality. Part of the requirements centre around organisational emission quantification, which will bring much attention to the methodological aspects and resulting decision support capability, which calls for synthesis and argues for clarity. Currently, quantifying the emissions embedded in global transactions mostly focus on direct value-chain attributes, and do not consider unintended consequences beyond the scope of assessment. To achieve genuine reductions, estimated emissions must be considered from a systems perspective to accurately reflect their true impact. While emission inventories serve several purposes, incorrect application limits their potential. The CSRD aligns itself with the GHG Protocol, which does not explicitly facilitate this distinction, although new Land Sector and Removals Guidance draft does, in part. With first CSRD reports expected in 2025, and the GHG protocol entering a revisions period, it presents an opportunity to marry systems thinking with carbon literacy, thereby equipping the expected surge of activity with the sufficient tools for an accelerated transition.

The area of Central and Eastern Europe, and thus Poland, is not exposed to effects of seismic actions. Any possible tremors can be caused by coal or copper mining. Wind, rheological effects, the impact of other objects or a non-uniform substrate are the predominant types of loading included in calculations for stiffening walls. The majority of buildings in Poland, as in most other European countries, are low, medium-high brick buildings. Some traditional materials, like solid brick (>10% of construction materials market) are still used. But autoclaved aerated concrete (AAC) and cement-sand calcium-silicate (Ca-Si) elements with thin joints are prevailing (>70% of the market) on the Polish market. Adding reinforcement only to bed joints in a wall is a satisfactory solution (in addition to confining) for seismic actions occurring in Poland that improves ULS and SLS. This paper presents results from our own tests on testing horizontal shear walls without reinforcement and with different types of reinforcement. This discussion includes 51 walls made of solid brick (CB) reinforced with steel bars and steel trusses, results from tests on 15 walls made of calcium-silicate (Ca-Si) and AAC masonry units reinforced with steel trusses and plastic meshes. Taking into account our own tests and those conducted by other authors, empirical relationships were determined on the basis of more than 90 walls. They are applicable to design and construction phase to determine the likely effect of reinforcement on cracking stress that damage shear deformation and wall stiffness.

Zika virus (ZIKV), without a vaccine or no effective treatment approved as yet, have globally spread since the past century. The infection caused by ZIKV in humans has changed progressively from mild to subclinical in the last years, causing epidemics with greater infectivity, tropism towards new tissues, and other related symptoms as a product of various emergent ZIKV-host cell interactions. However, it is still unknown why or how the RNA genome structure impacts those interactions in differential evolutionary origin strains. Moreover, genomic comparison of ZIKV strains from the sequence-based phylogenetic analysis is well known, but differences from RNA structure comparisons are less known. Thus, in order to understand the RNA genome variability of lineages of various geographic distributions better, 412 complete genomes in a phylogenomic scanning were used for studying the conservation of structured RNAs. We found specific genomic regions, which highlight their patterns of conserved RNA structures at the level of inter-geographical comparisons. We have proposed these structures as candidates for further experimental validation to establish their potential role in vital functions of the viral cycle of ZIKV and their possible associations with the singularities of different outbreaks that occurred in specific geographic regions.

For a hierarchy of large scale structures, like galaxies, galaxy clusters, super-clusters, etc. the requirement that their gravitational (binding) self-energy density must at least equal or exceed the background repulsive dark energy density implies a universal mass-radius relation given by M/R² ~ 1g/cm². Here we point out that this mass-radius relation also holds for important individual biological structures, and even various organisms as a whole such as humans, trees, and to behemoths like whales, even though the physics is different. Here we try to understand this universality from two different physical considerations. We also point out the coincidence that the densities of most biological entities are close to that of water, and that the average density of main-sequence stars and giant planets are close to this density. We give a physical basis for the same.

To prevent CO2 leakage and ensure the safety of long-term CO2 storage, it is essential to investigate the flow mechanism of CO2 in complex pore structures at the pore scale. This study focuses on reviewing the experimental, theoretical, and numerical simulation studies on the microscopic flow of CO2 in complex pore structures during the last decade. For example, advanced imaging techniques, such as X-ray computed tomography (CT) and nuclear magnetic resonance (NMR), are used to reconstruct the complex pore structures of rocks. Mathematical methods, such as Darcy's law, Young–Laplace’s law, and the Navier-Stokes equation, are used to describe the microscopic flow of CO2. Numerical methods, such as the lattice Boltzmann method (LBM) and pore network (PN) model, are used for numerical simulation. The application of these experimental and theoretical models and numerical simulation studies is discussed, considering the effect of complex pore structures. Finally, future research is suggested to focus on: (1) Conducting real-time CT scanning experiments of CO2 displacement combined with the developed real-time CT scanning clamping device to realize real-time visualization and provide quantitative description of the flow behavior of CO2 in complex pore structures; (2) The effect of pore structures change on the CO2 flow mechanism caused by the chemical reaction between CO2 and the pore surface, the flow theory of CO2 considering wettability and damage theory in a complex pore structures; (3) The flow mechanism of multi-phase CO2 in complex pore structures; (4) The flow mechanism of CO2 in the pore structures at multiscale and the scale upgrade from microscopic to mesoscopic to macroscopic. Generally, this study focuses on reviewing the research progress of CO2 flow mechanisms in complex pore structures at the pore scale and affords an overview of potential advanced developments to enhance the current understanding of CO2 microscopic flow mechanisms.

The structures of a number of dimers of sulphur dioxide and ozone have been optimized by means of a series of ab initio calculations. The dimer species have been classified as either genuine energy minima or transition states of first or higher order, and the most probable structures consistent with the experimental data have been confirmed. The molecular orbitals engaged in the interactions resulting in adduct formation have been identified and relations between the orbitals of the dimers of the valence isoelectronic monomer species examined. The vibrational spectra of the most probable structures have been computed, and compared with those reported in the literature, particularly with spectra observed in cryogenic matrices. The calculations have been extended to predict the properties of a number of possible heterodimers formed between sulphur dioxide and ozone.

Wood-borer extermination by a dry heat clean-up is the essential method from the point of view of sustainability of historical wooden structures like trusses and ceilings in heritage-listed buildings. The wooden components are heated by a hot air of temperature about 100°C until the temperature in the centre of the wooden structures reaches 55°C to kill the wood-borers. In this article we review the method and present solution of the heat equation for structural wooden components. We also suggest an approximate formula that enables to estimate the necessary heating time for different cross sections of wooden components and can be used in technical application of the method.

For the purpose of this paper, the actual air temperature and air humidity values were monitored in the Visitor Centre of the Archaeological site 1a Imperial Palace Sirmium, designated cultural heritage of exceptional importance. The contamination level of archaeological finds in the site was microbiologically analysed. The findings showed that during the phase of microclimatic monitoring (February–April 2021), air humidity was almost constantly above the levels set by standards and recommendations for museum collections (&gt;60%). The highest levels of air humidity, amounting to 93%, were recorded in February, with daily oscillations of up to 30%; the lowest recorded temperature was 0.3°C, with the maximum daily oscillations of 6°C. Microbiological analysis revealed great diversity in the deterioration level of the finds, which can be attributed to the time lapse between the last conservation and the present. The comparative analysis of microclimatic monitoring and microbiological analysis results identified high levels of relative air humidity as the dominant factor in the increased microbiological contamination of the finds. The findings also pointed to the necessity of continuous microclimatic monitoring during the actual usage of the facility in order to provide the sustainable display and preservation of the finds on the premises.

For orthopaedic applications, additive manufactured (AM) porous scaffolds made of absorbable metals like magnesium, zinc or iron are of particular interest. They do not only offer the potential to design and fabricate bio-mimetic or rather bone equivalent mechanical properties, they also do not need to be removed in further surgery. Located in a physiological environment, scaffolds made of absorbable metals show a decreasing Young’s modulus over time, due to product dissolution. For WE43 scaffolds, during the first days an increase of the smeared Young's modulus can be observed, which is mainly attributed to a forming substrate layer of degradation products on the struts surfaces. In this study the influence of degradation products on the stiffness properties of metallic scaffolds is investigated. For this, analytical calculations and finite element simulations are performed to study the influence of the substrate layer thickness and Young's modulus for single struts and for a new scaffold geometry with adapted polar f2cc,z unit cells. The finite element model is further validated by compression tests on AM scaffolds made from Zn1Mg. The results show, that even low thicknesses and Young's moduli of the substrate layer increases significantly the smeared Young's modulus under axial compression.

Fixed offshore wind turbines continue to be developed for high latitude areas where not only wind and wave loads need to be considered, but also moving sea ice. Current rules and regulations for the design of fixed offshore structures in ice-covered waters do not adequately consider effects of ice loading and its stochastic nature on fatigue life of the structure. Ice crushing on such structures results in ice-induced vibrations, which can be represented by loading the structure using a variable-amplitude loading (VAL) sequence. Typical offshore load spectra are developed for wave and wind loading. Thus, a combined VAL spectrum is developed for wind, wave, and ice action. To this goal, numerical models are used to simulate the dynamic ice-, wind-, and wave-structure interaction. The stress time-history at an exemplarily selected critical point in an offshore wind energy monopile support structure is extracted from the model and translated into a VAL sequence, which can then be used as a loading sequence for the fatigue assessment or fatigue testing of welded joints of offshore wind turbine support structures. This study presents the approach to determine combined load spectra and standardized time series for wind, wave, and ice action.

In recent years, laser engraving has received widespread attention as a convenient, efficient, and programmable method, which has enabled the obtaining of high-quality porous graphene from various precursors. Laser engraving is often used to fabricate the dielectric layer with micro-structure for capacitive pressure sensors, however, the usual choice of electrodes remains poorly flexible metal electrodes, which greatly limits the overall flexibility of the sensors. In this work, we propose a flexible capacitive pressure sensor made entirely of thermoplastic polyurethane (TPU) and laser-induced graphene (LIG) derived from wood. The capacitive pressure sensor consisted of a flexible LIG/TPU electrode (LTE), a LIG/TPU electrode with micro hole array, and dielectric layer of TPU with micro-cone array molded from laser-engraved hole array on wood, which provided high sensitivity (0.11 kPa-1), ultra-wide pressure detection range (100Pa to 1.4MPa), fast response (~300 ms) and good stability (&gt;4000 cycles, at 0-35 kPa). We believe that our research makes a significant contribution to the literature because the easily available materials derived from wood and overall consistent flexibility meet the requirements of flexible electronic devices.

This study aimed on evaluating the potential diagnostic value of a novel, sonographic, B-Flow Imaging (BFI)-based sign (“flashlight sign”, FLS) for the detection of wall-adherent, floating arterial structures (WAFAS). The FLS, characterized by a fast moving, very bright, intraluminal signal was detected in 28 patients with WAFAS. We divided this cohort into three subgroups, depending on the affected vascular segments: (1) peripheral arteries (n = 10), (2) native abdominal aorta (n = 8), and (3) abdominal aorta after endovascular aortic repair (EVAR; n = 10). Clinical characteristics were analyzed and BFI-findings were compared with contrast enhanced ultrasound (CEUS) and computed tomography angiography (CTA). Seven patients (25%) suffered from arterial embolism downstream to the FLS (EVAR, n = 4; native abdominal aorta, n = 1; peripheral arteries, n = 2). WAFAS of the abdominal aorta (native or after EVAR), as indicated by the FLS, were visible by CEUS and CTA in 60% and 93.3%, respectively. Based on the so far largest cohort of patients with WAFAS, we propose a clinically useful, BFI-based sonographic sign for detection of these so far underrated arterial pathologies in the abdominal aorta and the peripheral arteries.

Ultrasonic measurements are used in civil engineering for structural health monitoring of concrete infrastructures. The late portion of the ultrasonic wavefield, the coda, is sensitive to small changes in the elastic moduli of the material. Coda Wave Interferometry (CWI) correlates these small changes in the coda with the wavefield recorded in intact, or unperturbed, concrete specimen to reveal the amount of velocity change that occurred. CWI has the potential to detect localised damages and global velocity reductions alike. In this study, the sensitivity of CWI to different types of concrete mesostructures and their damage levels is investigated numerically. Realistic numerical concrete models of concrete specimen are generated and damage evolution is simulated using the discrete element method. In the virtual concrete lab, the simulated ultrasonic wavefield is propagated from one transducer using a realistic source signal and recorded at a second transducer. Different damage scenarios reveal a different slope in the decorrelation of waveforms with the observed reduction in velocities in the material. Finally, the impact and possible generalizations of the findings are discussed and recommendations are given for a potential application of CWI in concrete at structural scale.

The advent of graphene opens up the research into two-dimensional (2D) material, which is considered as a revolutionary material in the future. Due to its unique geometric structure, graphene exhibits a series of exotic physical and chemical properties. Besides, single-element-based 2D materials (Xenes) have garnered tremendous interest. At present, 16 kinds of Xenes (silicene, borophene, germanene, phosphorene, tellurene, etc.) have been explored, mainly distributed in the third, fourth, fifth and sixth main groups. The current methods to prepare monolayer or few-layer 2D materials include epitaxy growth, mechanical exfoliation, and liquid phase exfoliation. Although two Xenes (aluminene and indiene) have not been synthesized due to the limitations of synthetic methods or stability of Xenes, other Xenes have been successfully realized by elaborately artificial design and synthesis. Focusing on elemental 2D materials, this review mainly summarizes the recently reported work about tuning the electronic, optical, mechanical, or chemical properties of Xenes via surface modifications achieved by controllable approaches (doping, adsorption, strain, intercalation, phase transition, etc.) to broaden the applications in various fields, including spintronics, electronics, optoelectronics, superconducting, photovoltaics, sensors, catalysis, and biomedicines. These advances in surface modification of Xenes have laid a theoretical and experimental foundation for the development of 2D materials and their practical applications in diverse fields.

This paper presents a novel approach to demonstrate the Collatz Conjecture, an unsolved problem in mathematics stating that all positive integers will eventually converge to 1 when subjected to a recursive sequence of operations. We introduce Algebraic Inverse Trees (AITs), innovative data structures that characterize relationships within the Collatz sequence by tracing inverse transformations back to the origin. Leveraging properties unveiled through this inverted representation, including absence of non-trivial cycles and guaranteed convergence of paths, we construct a topological framework to formally prove that all trajectories invariably lead to 1 under the Collatz iterative process. This modern technique provides not only the machinery to manifest a rigorous proof, but also grants intuitive insights into the deep complexity of this notorious yet elementary conjecture.

In light of climate changes, technological development and the use of renewable energy sources are considered very important nowadays, both in newly-designed structures and reconstructed historic building, resulting in the reduction of the commercial energy consumption and CO2 environmental emissions. This paper explores the possibilities of improving the energy efficiency of heritage sacred buildings by utilizing photovoltaic systems. As an exceptionally significant cultural good, the Cathedral of St. Michael the Archangel in Belgrade shall serve as a case study, with the aim of examining the methods of mounting photovoltaic (PV) panels, by taking into account the fact that the authenticity and the aesthetic value of this cultural monument must remain intact. A comparative analysis of the two options for installing PV panels on the southwestern roof of the church was performed using simulations in PVgis and PVsist V6.84 software, with the aim of establishing the most efficient option in terms of power generation. The simulation results show that photovoltaic panels can produce 151650 kWh (Option 1) and 150894 kWh (Option 2) per year, while the required amount of energy is 42726.77 kWh. The electricity produced exceeds the electricity requirements for the decorative lighting of the Cathedral Church, so it can be used for other purposes in the sacral complex.

The intrinsic dynamic and static nature of the non-covalent Br-*-Br interactions in the neutral polybromine clusters is elucidated for Br4–Br12, applying QTAIM dual functional analysis (QTAIM-DFA). The asterisk (*) emphasizes the existence of the bond critical point (BCP) on the interaction in question. Data from the fully optimized structures correspond to the static nature of interactions. The intrinsic dynamic nature is originated from those of the perturbed structures generated using the coordinates derived from the compliance constants for the interactions and the fully optimized structures. The non-covalent Br-*-Br interactions in the L-shaped clusters of the Cs symmetry are predicted to have the typical hydrogen bond nature without covalency, although the first ones in the sequences have the vdW nature. The L-shaped clusters are stabilized by the n(Br)->σ*(Br–Br) interactions. The compliance constants for the corresponding non-covalent interactions are strongly correlated to the E(2) values based on NBO. Indeed, the MO energies seem not contribute to stabilize Br4 (C2h) and Br4 (D2d), but the core potentials stabilize them, relative to the case of 2Br2, maybe due to the reduced nuclear-electron distances in the average for the dimmers.

We explore 3D printing modules for self-assembling spacecraft and robots – structure, actuators, electrics. Self-assembly has long been viewed as a highly desirable capability for autonomous construction of large space structures. We review self-assembly in space which focusses on the self-assembly of modules that demonstrate the range of applications. However, self-assembly may be synergised with 3D printing to offer an automated capability from raw material to modules for assembling new spacecraft or habitats. One application of 3D printing is using space debris on-orbit as an in-situ resource - defunct spacecraft may be salvaged as raw material for in-situ construction on demand. The common features of all self-assembling modules are that the modules constitute a structure housing a computer-controlled actuator internally and a reversible latching mechanism externally. We have demonstrated a 3D printed DC electric motor in which the only components that were not 3D printed are the wire coils. We have married our 3D printed motor prototype as an actuated joint between two 3D printed trigon-type panels developed as part of a trigon self-assembling system concept. The trigon concept underlies a modular approach to self-assembling and self-deploying structures. The 3D printed motorised panel system demonstrates that the motor aspect and structural aspects of robotic self-assembling machines are amenable to 3D printing. This has implications for self-assembling systems into modular satellites as a solution to space debris.

In a previous paper, the authors dealt with the current showstoppers for morphing systems and with the reasons that have inhibited their commercial applicability. In this work, the authors ex-press a critical vision of the current status of the proposed architectures and the needs that should be accomplished to make them viable for installation onboard of commercial aircraft. The distinc-tion is essential because military and civil issues and necessities are very different, and both the solutions and difficulties to be overcome are widely diverse. Yet, still remaining in the civil seg-ment, there can be other differences, depending on the size of the aircraft, from large jets to com-muters or general aviation, in turn classifiable in tourism, acrobatic, ultralight and so on, each with their own peculiarities. Therefore, the paper wants to try to trace a common technology de-nominator, if possible, and envisage a future perspective of actual applications.

Space-time evolution is briefly explained by using the 3-dimensional quantized space model (TQSM) based on the 4-dimensional (4-D) Euclidean space. The energy (E=cDtDV), charges (|q|= cDt) and absolute time (ct) are newly defined based on the 4-D Euclidean space. The big bang is understood by the space-time evolution of the 4-D Euclidean space but not by the sudden 4-D Minkowski space-time creation. The big bang process created the matter universe with the positive energy and the partner anti-matter universe with the negative energy from the CPT symmetry. Our universe is the matter universe with the negative charges of electric charge (EC), lepton charge (LC) and color charge (CC). This first universe is made of three dark matter -, lepton -, and quark - primary black holes with the huge negative charges which cause the Coulomb repulsive forces much bigger than the gravitational forces. The huge Coulomb forces induce the inflation of the primary black holes, that decay to the super-massive black holes. The dark matter super-massive black holes surrounded by the normal matters and dark matters make the galaxies and galaxy clusters. The spiral arms of galaxies are closely related to the decay of the 3-D charged normal matter black holes to the 1-D charged normal matter black holes. The elementary leptons and quarks are created by the decay of the normal matter charged black holes, that is caused by the Coulomb forces much stronger than the gravitational forces. The Coulomb forces are very weak with the very small Coulomb constants (k₁(EC) = k_dd(EC) ) for the dark matters and very strong with the very big Coulomb constants (k₂(EC) = k_nn(EC)) for the normal matters because of the non-communication of the photons between the dark matters and normal matters. The photons are charge dependent and mass independent. But the dark matters and normal matters have the similar and very weak gravitational forces because of the communication of the gravitons between the dark matters and normal matters. The gravitons are charge independent and mass dependent. Note that the three kinds of charges (EC, LC and CC) and one kind of mass (m) exist in our matter universe. The dark matters, leptons and quarks have the charge configurations of (EC), (EC,LC) and (EC,LC,CC), respectively. Partial masses of elementary fermions are calculated, and the proton spin crisis is explained. The charged black holes are not the singularities.

Powerful emitters of the ultraviolet C (UVC) light in the wavelength range of 230-280nm are necessary for the development of effective and safe optical disinfection technologies, high-sensitive optical spectroscopy and non-line-of-sight optical communication. This review considers such UVC-emitters with electron-beam pumping of heterostructures with quantum wells in the (Al,Ga)N material system. The important advantages of these emitters include the absence of the critical problem of p-type doping and the possibility of achieving record (up to several tens of watts for peak values) output optical power values in the UVC range. The review consistently considers about a decade of world experience in the implementation of various UV emitters with various types of thermionic, field-emission, and plasma-cathode electron guns (sources) used to excite various designs of active (light-emitting) regions in heterostructures with quantum wells AlxGa1-xN/AlyGa1-yN (x = 0 − 0.5, y = 0.6 − 1) fabricated either by metal-organic chemical vapor deposition or by plasma-activated molecular beam epitaxy. Special attention is paid to the production of heterostructures with multiple quantum wells/two-dimensional(2D) quantum disks GaN/AlN with a monolayer (1ML ~ 0.25nm) thickness, which ensures a high internal quantum efficiency of radiative recombination in the UVC range, low elastic stresses in heterostructures, and a high output UVC-optical powers.

The analysis concerned a thin-walled plate with a circular central hole made of CFRP (Carbon Fiber Reinforced Polymer) material. The test object was subjected to a tensile test to investigate the cracking mechanism of the composite structure. The tests were performed using two independent test methods experimentally and numerically. In the experiment, the force was recorded as a function of elongation of the tensile plate and the elongation of the plate was investigated using an Aramis non-contact optical measurement system. As part of the numerical analysis, an FEM model adequate to the experimental conditions was performed in the Abaqus system. The fracture process was modeled using the extended finite element method XFEM. This approach enabled the structure of the composite to be investigated over the full range of tensile loading. The behaviour of the circular hole plate before the damage symptoms was investigated, the damage initiation force was determined, then the initial cracking and delamination of the layers were analysed, as well as the crack propagation process leading to the complete failure of the composite structure (cracking of all laminate layers).

Native reactive electrophile species (RES) are long-recognized regulators of pathophysiology; yet, knowledge surrounding how RES regulate context-specific biology remains limited. The latest technological advances in profiling and precision decoding of RES sensing and signaling have begun to bring about improved understanding of localized RES regulatory paradigms. However, studies in purified systems—prerequisites for gaining structure/function insights—prove challenging. We here introduce emerging chemical biology tools available to probe RES signaling, and the new knowledge that these tools have brought to the field. We next discuss existing structural data of RES-sensor proteins complexed with electrophilic metabolites or small molecule drugs (limited to < 300 Da), including challenges faced in acquiring homogenous RES-bound proteins. We further offer considerations that could promote enhanced understanding of RES regulation derived from three-dimensional structures of RES-modified proteins.

A reliable finite element procedure to simulate shear-dominated ductile fracture in large-scale, thin-walled steel structures is still evolving due primarily to the challenges in determining the fracture criterion of steel materials under complex stress states. This paper aims to examine the accuracy of the modified Gurson-Tvergaard-Needleman (GTN) model considering the shear failure in simulating ductile fracture of steel plate structures under quasi-static punch loading. The modified GTN damage models are performed by ABAQUS user defined material subroutine (VUMAT). The void related parameters and shear damage parameters of Xue’s and N-H modified GTN models are calibrated from test specimens with various geometries corresponding to different stress triaxiality and shearing conditions. The damage evolution associated with the shearing of voids in the modified GTN models has strong influences on the stress triaxiality versus equivalent plastic strain under complex stress states, especially for the shear dominated loading conditions. Based on the original GTN model, Xue’s model, and N-H modified GTN model with calibrated material parameters, a numerical comparative study examines the ductile fracture of steel non-stiffened plate and stiffened plate under punch loading. Benchmarked against the experimental studies, the numerical simulations demonstrate that the shear driven void evolution in the modified GTN model imposes significant effects on the load-displacement responses, as well as the onset and extension of ductile fracture in steel plates under punch actions. The N-H modified model with calibrated shear damage parameters shows a better correlation with the ductile fractures in steel plates observed in the experiment, than the original GTN model and Xue’s modified GTN model. As a result of this study, the modified GTN model considering the shear failure can be applied for practical applications in the crashworthiness assessment of ship collision and grounding.