Preprint
Review

This version is not peer-reviewed.

The Role of Amphibian AMPs Against Oxidative Stress and Related Diseases

A peer-reviewed version of this preprint was published in:
Antibiotics 2025, 14(2), 126. https://doi.org/10.3390/antibiotics14020126

Submitted:

12 December 2024

Posted:

12 December 2024

You are already at the latest version

Abstract
Amphibians use their skin as an efficient defense mechanism against predators and microorganisms. Within specialized glands, they produce antimicrobial peptides endowed with antioxidant properties that have demonstrated efficacy in reducing reactive oxygen species (ROS) levels. These peptides are considered promising candidates for treating diseases related to oxidative stress (OS). Neurodegenerative disorders (NDs) such as Alzheimer’s disease (AD), Parkinson’s disease (PD), Huntington’s disease (HD), and amyotrophic lateral sclerosis (ALS), along with age-related conditions like cardiovascular diseases and cancer, have been connected to redox imbalance and the associated ROS. This review explores the characteristics of antioxidant peptides (AOP) identified in amphibians, elucidates their mechanisms of action against molecular targets involved in the diseases above, and provides insights into future prospects.
Keywords: 
;  ;  ;  ;  

1. Introduction

Amphibians have developed a wide range of peptide compounds in their skin as responses to the survival conditions they experience, such as adaptation to the environment, the capture of their prey, and defense against their predators [1,2]. Studies have shown that during their metamorphosis process from egg to tadpole and finally to their adult form, they form peptides in response to changes in environmental conditions in their habitat [3,4]. The transition to adulthood involves a change of habitat from an aquatic to a terrestrial environment, with more significant challenges [5], such as high concentrations of O2 in the air, extreme temperature conditions, and the absence of an essential barrier to ultraviolet (UV) radiation, such as the water column [4,6]. This implies that amphibians must face a more oxidizing environment, which generates a more significant number of reactive oxygen species (ROS) in response to these conditions [7]. Amphibians exhibit a crucial response to oxidative stress-related damage via three defense mechanisms: 1) the production of antioxidant enzymes, including catalase (CAT), glutathione peroxidase (GPXs), superoxide dismutase (SOD), and peroxiredoxins, which primarily control endogenous antioxidant functions [8]; 2) low molecular weight antioxidants (LMWAs) that are not genetically encoded, such as NADH, lipoic acid, and glutathione (GSH) [9,10]; and 3) the development of antioxidant peptides (AOPs), which are canonically produced through the activation of endogenous antioxidant defense systems [11], that act as direct scavengers of free radicals, just as LMWAs do [9]. In the specific case of amphibians, many studies have demonstrated the presence of AOPs in their skin secretions, playing an essential role in controlling ROS levels [12].
Aerobic organisms naturally produce ROS as a product of their metabolism. Like exogenous sources, these act as signaling molecules in vital physiological processes. However, ROS levels are controlled by endogenous antioxidants in the redox metabolism, allowing ROS to exert their signaling functions without side effects [13]. When the balance is altered, excess ROS can cause irreversible oxidative damage to biomolecules (lipids, DNA, and proteins, among others), ultimately leading to oxidative stress [14,15]. Different studies on these alterations have been associated with the pathophysiology of many human diseases [13], including cancer [16,17], diabetes mellitus (DM) [18], cardiovascular diseases [19], and neurodegenerative diseases (NDs) [13,20], including Alzheimer’s disease (AD) [21], Parkinson’s disease (PD) [22], Huntington’s disease (HD) [23], and amyotrophic lateral sclerosis (ALS) [24], in addition to accelerating physiological processes such as aging [25,26,27]. Considering the mechanisms of action exerted by AOPs, they can be associated with effective treatments for various conditions associated with oxidative stress [8], also including antifungal, antiviral, antiparasitic, anticancer, and anti-inflammatory properties among others [28,29].
The identification of antimicrobial peptides (AMPs) has been the objective of research on amphibian skin since their functions, based on the innate immune response mechanisms exerted by their producers, were extrapolated to represent an alternative therapy to the use of traditional antibiotics [28]. Different studies have evaluated other characteristics attributed to these AMPs, in addition to antimicrobial properties [12,28,30]. In this context, some AMPs may act as AOPs by chelating metals, inhibiting oxidative processes, and leading to beneficial effects, thus constituting them as multifunctional molecules of interest for treating diseases linked to oxidative stress. However, the structural diversity of AOP and AMP groups in amphibians is quite remarkable, and it could be said that in practically no species are there peptides with an amino acid sequence identical to that found in another. Therefore, a considerable amount of information remains unavailable, and further studies are urgently needed to understand the structure and function of these peptide groups in amphibians, as research on their molecular mechanisms in vivo remains scarce [31].

2. AMPs from Amphibians with Antioxidant Properties

AOPs of amphibian origin currently totaling more than 100 [12,30], in addition to the more than 1900 AMPs reported in the skin of amphibians for 178 species belonging to 28 genera [4]. Antimicrobial properties have been vital in the search for peptides with significant antioxidant potential, based on the ability of many amphibian species to express peptides with defensive capacity [28], and protective capacity against oxidation [8,32], which regulate microbial infections and oxidative stress, respectively. Finding antioxidant properties in AMPs has been linked to other biological properties associated with free radical scavenging capacity [29]. In addition, there is evidence of rapid action kinetics of radical elimination in amphibians, which do everything possible to protect the skin from infections or oxidative stress. Unlike AMPs, which act solely as defenses against biological injuries, AOPs can participate in both biological and non-biological injuries, leading us to conclude that defensive peptides likely act in conjunction with oxidative and microbial defenses [8].
In addition, the relationship between AOPs and AMPs in amphibians reveals a fascinating evolutionary connection. A study on Rana pleuraden specimens highlights that highly divergent primary structures of AOPs share an N-terminal preproregion and standard defensive signal peptides with AMPs found in Ranidae amphibians. BLAST analysis shows a dibasic enzymatic processing site insertion (-Lys-Arg- or -Arg-Arg-) between the spacer and mature peptide. This aligns with other defensive peptide precursors in amphibians, such as AMPs, suggesting that these AOP precursors have a biosynthesis pathway similar to that of AMPs. Interestingly, antimicrobial assays performed on the eleven groups of AOPs from R. pleuraden showed that seven can be classified as AMPs based on their antimicrobial capabilities [8]. This allows their classification as bifunctional or multifunctional peptides essential for the innate defense of amphibians [33].
his leads to the exploration of the antioxidant properties of AMPs derived from amphibian skin secretions while generating information for developing new antioxidant formulations and future treatments for other oxidative stress-related diseases [4]. To date, the peptides with a high antioxidant potential that have been identified as being of amphibian origin have been evaluated through different in vitro [12,30,34] and in vivo methods [35], demonstrating a significant effect on diseases directly related to biomolecular damage caused by free radicals, such as premature aging [27], cancer [16], and neurological and cardiovascular diseases [36,37]. This increases the likelihood of finding in amphibians AOPs with tolerance to unpredictable environmental changes, as they possess a more complex array of innate eco-physiological, behavioral, and immunological traits [8], which may more effectively counterbalance the imbalance between ROS and antioxidants.
The antioxidant capacity of any substance, whether peptide or not, can be mediated through several mechanisms: 1) ROS scavenging capacity, 2) reducing capacity, 3) metal chelating capacity, 4) protection of biomarkers against oxidation, and 5) association with antioxidant enzymes [38]. Among the methods frequently used to determine the antioxidant capacity are in vitro methods that measure a peptide’s ability to scavenge free radicals such as DPPH and ABTS [8], which are the most common due to their relative stability, easy measurement, and good reproducibility [39], as well as the oxygen radical absorbance capacity (ORAC) and the reducing power in the transformation of Fe3+ to Fe2+ [40]. All these methods have made it possible to determine the antioxidant capacity of peptides identified in different amphibian species, preferably by determining the DPPH and ABTS∙+ radical scavenging capacity.
As already mentioned, other types of antioxidant assays that have been used to determine AOPs derived from amphibians include in vitro and in vivo assays based on the measurement of redox enzymes, which provide information on the degree of oxidative damage to cells [41]. Moreover, these assays assist in the clinical determination of pathological states. Detecting oxidative stress biomarkers is another method, along with elimination capacity, reduction capacity, and metal chelating capacity, that reflects factors related to systemic or tissue-specific oxidative stress. These molecules are modified or generate various reaction products when interacting with ROS in the surrounding environment [42]. Biomolecules such as lipids, DNA, and proteins exemplify molecules that can interact and be modified by excess ROS in vivo [43]. It is essential to highlight that antioxidant mechanisms and the results evaluated by different antioxidant tests can vary widely; therefore, comparing one method with another is difficult. Considering the wide variety of structural characteristics of AOPs, antioxidant tests should not be restricted to a single model. Thus, it is advisable to use different methods to evaluate their antioxidant properties and more accurately indicate their possible protective effects [12].
Otherwise, studies have shown that part of the effectiveness of AOPs is significantly influenced by the chemical properties of the amino acid residues, including reducibility, hydrophobicity, and electron transfer capacity, which not only promote their interaction with free radicals but also allow their participation in chemical reactions relevant to antioxidation [44,45]. In general, the more reducing residues there are in the sequence, the stronger the antioxidant properties of the AOPs will be [44]. Other researchers have highlighted that the effectiveness of AOPs is closely linked to the types of amino acids that constitute their primary structures. For example, aromatic amino acids such as Phe [46,47], Tyr [48] and Trp [20], which are common in the structures of AMPs and AOPs, have been shown to contribute significantly to the antioxidant properties of amphibian-derived peptides. Previous studies have shown that these aromatic residues can act as electron donors due to their electron-rich aromatic structure, and they may help stabilize ROS through interactions that involve direct electron transfer [45]. It has also been reported that Tyr and Trp could play an antioxidant role in cell protection, as they are highly effective in protecting cells. Their phenolic and indolyl groups can be converted into relatively stable phenoxy and indolyl radicals, which can directly capture free radicals as hydrogen donors, thus achieving the function of scavenging free radicals [49]. The transmembrane domains of integral membrane proteins exhibit substantial enrichment in Tyr and Trp residues, and data suggest that these residues are common and widespread in regions of higher lipid density [50]. These amino acid residues exert essential antioxidant functions within the lipid bilayer and protect cells from oxidative damage. They act as potent inhibitors of lipid peroxidation and oxidative cell death[51]. Histidine (His) exhibits strong antioxidant properties due to its imidazole rings acting as proton donors. In addition to His, Lys and Val can scavenge hydroxyl radicals by serving as electron donors, creating a hydrophobic microenvironment within the molecule that enhances the peptide’s antioxidant capacity [52].
Sulfur-containing amino acids such as Met and Cys have also been suggested to be important in the antioxidant function of peptides [20,48], since the unpaired thiol group of Cys is crucial for free radical scavenging, attributed to its ability to donate an electron to a radical [53]. Another study indicates that AOPs with a free Cys are the dominant components of highly antioxidant peptides in the species Odorrana andersonii [54], where the scavenging activity of such peptides would be mainly related to the disulfide bridge and, secondarily, to the hydroxyl groups present in the synthesized peptide sequence, thus contributing to their hydrogen donation capacity [55]. Additionally, other studies confirm that the antioxidant activity of some AOPs from pleurain, odorranain, and brevinin families are directly correlated with the number of Cys residues and disulfide bridges [56]. For example, in the study by Yang et al. (2012), the authors demonstrated that the antioxidant activity of cyclic peptides with cysteine residues forming a disulfide bridge was lower than that of linear peptides. This finding might imply that linear peptides with free cysteine residues play a more critical role in the antioxidant defense system of the skin [57].
This study gathers research on AMPs with antioxidant properties, focusing on their amino acid content across various amphibian families, especially in the Ranidae family [28,30], as listed in Table 1. These peptide families have demonstrated important physicochemical properties linked to mechanisms that protect the skin from free radicals, suggesting promising potential for other pharmacological applications [28,29,58,59,60,61].

Antioxidin Family

As the first peptide group with antioxidant potential reported, the antioxidins have demonstrated their capacity to eliminate free radicals in different studies, which has led to ongoing research on this peptide family to this day [35]. The first AOPs to be discovered were antioxidin-RP1 (AMRLTYNKPCLYGT) and antioxidin-RP2 (SMRLTYNKPCLYGT), 14-amino acid peptides derived from the Rana pleuraden species. Antioxidin-RP1 was shown to be the most potent peptide in scavenging free radicals of DPPH and ABTS∙+, capable of eliminating 100% of the radicals at a concentration of 80 μg.mL-1. It exhibited the highest capacity to reduce Fe3+ ions to Fe2+ compared to other AOPs and the highest release of nitric oxide (NO), produced by the sodium nitroprusside dihydrate (SNP) NO donor [8].
Another AOP belonging to this class is antioxidin-RL (AMRLTYNRPCIYAT), obtained from Odorrana livida, which was characterized by its potent free radical scavenging capacity, determined through ABTS•+ assays [62], and strong in vitro and in vivo UVB-induced response tests. It was observed that antioxidin-RL successfully penetrates the cell membrane and positively affects cell migration, increasing collagen deposition through in in vivo experiments [63]. Currently, only antioxidin-RL [8] and OA-VI12 (VIPFLACRPLGL) [11], isolated from O. livida and O. andersonii, respectively, have been described with possible protective effects on amphibian skin through in vivo assays [11,63], showing that they prevent UVB irradiation-induced photoaging in mice. However, the mechanisms of action of these two AOPs are still not fully understood [35].
Antioxidin-2 (YMRLTYNRPCIYAT) was designed as an analog of antioxidin-RL by replacing the N-terminal Ala with Tyr to improve free radical binding capacity. Antioxidant testing of this analog was performed using in-solution free radical scavenging assays, and the results showed that it scavenged free radicals faster than antioxidin-RL [64]. However, using PC-12 cell models (a mouse neuronal cell line derived pheochromocytoma), demonstrated that, although antioxidin-2 and antioxidin-RL inhibited the accumulation of intracellular free radicals induced by H2O2, they preserved mitochondrial morphology and reduced the expression of dynamin-related protein-1 in mitochondria. Antioxidant-RL was shown to be more effective in preventing the dissipation of the mitochondrial membrane potential [64].
Antioxidin-I (TWYFITPYIPDK), a 12-amino acid peptide identified in Physalaemus nattereri, were evaluated through in vitro free radical scavenging tests and showed poor performance in most free radical scavenging assays, except for the ORAC assay. However, when tested on murine fibroblasts, antioxidin-I exhibited low cytotoxicity by suppressing menadione-induced redox imbalance. Furthermore, it could substantially attenuate hypoxia-induced ROS production when tested on live microglial cells exposed to hypoxia, suggesting a possible neuroprotective role for this peptide. Antioxidin-I is found in the skin tissue of three additional tropical frog species Phyllomedusa tarsius, P. distincta, and Pithecopus rohdei [46].
In another study, antioxidin-NV (GWANTLKNVAGGLCKMTGAA), obtained from the frog Nanorana ventripunctata, was a protective peptide against skin photodamage. It reduced skin erythema, thickness, and wrinkle formation caused by UVB exposure in hairless mice. This AOP directly and rapidly scavenged excess ROS after UVB irradiation, alleviating UVB-induced DNA damage, cell apoptosis, and inflammatory response, thereby protecting against UVB-induced skin photoaging. The antioxidant activity was determined by the ABTS method, confirming that the properties of antioxidin-NV make it a promising candidate for the development of a novel antiphotoaging agent [35].
Studies identified the peptide antioxidin-PN (FLPSSPWNEGTYVLKKLKS) from the total RNA expression of Pelophylax nigromaculatus, also present in the same species but from different specimens distributed in two provinces of China: Yunnan and Guizhou. The peptide was evaluated for its antioxidant properties, demonstrating, like the other eight synthesized peptides, substantial elimination of ABTS∙+ free radicals in a dose-dependent manner, eliminating 30% of the ABTS∙+ radical at 15 seconds and 100% in 10 minutes at a low concentration (6.25 µg.mL-1, approximately 2.85 µM). The results of this study allowed us to determine that gene-environment interaction is an essential factor in the diversity of bioactive peptides within the same species. Nonetheless, additional research is required to elucidate its mechanisms of action further [65].
One study supports the notion that the antioxidant potential of peptides such as antioxidins may be due to the content of Pro residues, since all those found there presented at least one in their structure [8]. The study demonstrated that Pro protects cells against H2O2, butyl tert-hydroperoxide, and a carcinogenic inducer of oxidative stress [66].

Pleurain Family

Pleurain is another AMP group found in the skin of Rana pleuraden, where in addition to the antioxidin-RP1 and antioxidin-RP1, the identification of 13 new potential antioxidant peptide groups, comprising 36 members, was reported through a peptidomic and genomic approach [8]. In an earlier study, the antioxidant group pleurain-A had already been reported [3]. Of the total, 11 of the 14 groups exerted antioxidant activity (pleurain-A, -D, -E, -G, -J, -K, -M, -N, -P, -R, and antioxidin-RP). Some groups, such as pleurain-B and pleurain-N, exerted only antimicrobial and antioxidant activity, respectively, while others, such as pleurain-G, showed both antimicrobial and antioxidant activities. All peptide groups share the characteristic of containing Pro residues, suggesting that this amino acid may play an essential role in their antioxidant capacity. This conclusion is supported by the fact that the study emphasized the importance of the molecular basis of AOPs, taking into account that all amino acid residues related to antioxidant activity, such as Pro, Met, Cys, Tyr, and Trp in their free form, were replaced by Gly in the 11 peptide groups. The results showed that of substituting Pro, Met, free Cys, or Trp significantly decreased their antioxidant capacity, while substituting Trp had only a slight effect. It was also confirmed that replacing all these amino acid residues eliminated their antioxidant function [8].

Cathelicidin Family

Another of the first peptide groups reported for amphibians is the cathelicidins. Although many have been reported for mammals [67], very few have been identified for amphibians. Only eight cathelicidins have been reported in frogs [68,69]. In a recent study, cathelicidin-OA1 (IGRDPTWSHLAASCLKCIFDDLPKTHN, featuring a disulfide bridge) was identified from the skin of Odorrana andersonii, produced by post-translational processing of a 198-residue pre-propeptide [69]. Functional analysis showed that cathelicidin-OA1 did not generate direct microbial killing, acute toxicity, or hemolytic activity, but it exhibited antioxidant activity, evidenced by the radical scavenging activity of ABTS∙+ and DPPH. Compared with other odorous frog peptides, such as adersonine-AOP1 (FLPGLECVW), the antioxidant activity of cathelicidin-OA1 was slightly weaker. However, when the intramolecular disulfide bridge of cathelicidin-OA1 was broken, the antioxidant activities of linear cathelicidin-OA1 (containing two free Cys residues) and the mutant cathelicidin-OA1 (C14/A, containing one free Cys residue due to the change of Cys-14 by an Ala) were significantly enhanced. Research supports the idea that Cys enhances the antioxidant activities of a specific peptide; except for tylotoin (KCVRQNKRVCK), an amphibian cathelicidin that typically demonstrates direct microbe-killing effects [70]. Cathelicidin-OA1 was also shown to accelerate wound healing in human keratinocytes (HaCaT) and skin fibroblasts (HSF) by inducing cell proliferation [69].
In another study, cathelicidin-NV (ARGKKECKDDRCRLLMKRGSFSY), previously identified in the spot-bellied plateau frog Nanorana ventripunctata, was shown to alleviate UVB-induced skin photoaging in mice. Furthermore, the peptide effectively suppressed cytotoxicity, DNA fragmentation, and apoptosis. It reduced the protein expression levels of c-Jun N-terminal kinase (JNK), transcription factor Jun (c-Jun), and matrix metalloproteinase-1 (MMP-1), which are involved in regulating collagen degradation in HaCaT cells induced by UVB irradiation. Cathelicidin-NV directly scavenged excess intracellular ROS to protect HaCaT cells, thereby alleviating photoaging and positioning it as an excellent candidate for preventing and treating UV-induced skin photoaging [68].
Additionally, a novel peptide from the cathelicidin family, named Cath-KP (GCSGRFCNLFNNRRPGRLTLIHRPGGDKRTSTGLIYV), was identified from the skin of the Asian painted frog, Kaloula pulchra. Circular dichroism and homology modeling indicated an α-helix conformation for Cath-KP. The results demonstrated antioxidant properties through free radical scavenging and iron reduction analyses. Using 1-methyl-4-phenylpyridinium ion (MPP+) in a dopamine-induced cell line and PD mice induced by 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP), Cath-KP was found to penetrate cells and reach deep brain tissues, resulting in increased cell viability and reduced oxidative stress-induced damage by promoting the expression of antioxidant enzymes. It also alleviated the accumulation of mitochondrial and intracellular ROS through activation of the Sirtuin-1 (Sirt1)/nuclear factor erythroid 2-related factor 2 (Nrf2) pathway, with focal adhesion kinase (FAK) and p38 identified as regulatory elements. In MPTP-induced PD mice, administration of Cath-KP increased the number of tyrosine hydroxylase (TH)-positive neurons, restored TH content, and improved dyskinesia [71].

Spinosan Family

In the study of Paa spinosa skin, precursor cDNAs of four new AMPs were cloned, and their peptide sequencing revealed the presence of a new family of frog AMPs different from those already reported for other amphibians. The four peptides found were spinosan-A (DLGKASYPIAYS), spinosan-B (DYCKPEECDYYFSFPI), spinosan-C (DLSMMRKAGSNIVCGLNGLC) and spinosan-D (MEELYKEIDDCVNYGNCKTLKLM), which were chemically synthesized and evaluated against antimicrobial, antioxidant, hemolytic and cytotoxic activities [72]. The peptides showed a weak hemolytic effect against rabbit erythrocytes and, in turn, exhibited a strong antioxidant effect through free radical scavenging methods. In the DPPH free radical scavenging assay, spinosan-A, -B, -C, and D- peptides exhibited significant radical scavenging results at a concentration of 80 μg.mL-1. For example, spinosan-C showed a free radical scavenging percentage of 85%, while spinosan-A, -B, and -D showed respective scavenging values of 52%, 59%, and 49%. The study maintains that peptides with potential antioxidant activity always contain Cys, Pro, Met, Tyr, or Trp residues responsible for free radical scavenging activity [72].

Jindongenin and Palustrin Families

Jindongenin-1a (DSMGAVKLAKLLIDKMKCEVTKAC) is a 24-amino acid peptide from the jindongenin AMP peptide family reported from the Chinese torrent frog Amolops jingdongensis. The palustrin family was also identified as being of the same species. Palustrin-2AJ1 (GFMDTAKNVAKNVAVTLIDKLRCKVTGGC) and palustrin-2AJ2 (GFMDTAKQVAKNVAVTLIDKLRCKVTGGC) have similar structures to jindongenin-1a. These three peptides have high sequence similarity in the signal and propeptide regions (42 aa). These similarities suggest that these two families of AMPs may have arisen from an ancestral gene via genetic duplication and splicing or domain shuffling. Jindongenin-1a and Palustrin-2AJ1 were synthesized to analyze their antimicrobial, hemolytic, antioxidant, and cytotoxic activities. Both peptides showed broad-spectrum antimicrobial activity against standard and clinically isolated bacterial strains. However, DPPH free radical scavenging assays indicated that Jindongenin-1a and Palustrin-2AJ1 exhibited low antioxidant activity at doses up to 32 mM (8% inhibition) and 25 mM (6% inhibition). The results suggest that these peptides do not play a key role in the habituation of A. jingdongensis to intensive UV exposure; future studies may determine the factors contributing to this adaptation [34].
However, in a study carried out on three species of frogs from East Asia (Amolops lifanensis, Amolops granulosus and Hylarana taipehensis), a peptide group denominated palustrin-2GN was identified from A. granulosus along with other important groups of AOPs and AMPs such as temporin and brevinine. The peptides palustrin-2GN1 (GLWNTIKEAGKKFALNLLDKIRCGIAGGCKG), palustrin-2GN2 (GFMDTAKNVFKNVAVTLLDKLKCKIAGGC), and palustrin-2GN3 (GILDTLKQLGKAAAQSLLSKAACKLAKTC) showed antimicrobial activity against different Gram-positive strains such as Staphylococcus aureus (ATCC 25923), Enterococcus faecium 091299 (IS), and Gram-negative strains such as Pseudomonas aeruginosa (CGMCC 1.50), Klebsiella pneumoniae 08040724 (IS), Enterobacter cloacae (CGMCC 1.57) and Escherichia coli (ATCC 25922), among others. However, only palustrin-2GN1 exhibited a weak effect on scavenging free radicals ABTS•+ and DPPH [32]. In this study, as well as in previous research, it was shown that the presence of amino acid residues of Pro, Met, Cys, Tyr, or Trp contributes to the antioxidant function of peptides [8,48]. The structure of these AMPs contains one or more of the amino acids listed above; however, the study also indicated that peptides containing the aforementioned amino acids do not necessarily exhibit antioxidant activity. For example, palustrin-2GN2 did not show antioxidant activity in the free radical scavenging activity test, even though it contained one or more of these amino acids [32].

Taipehensin Family

From Hylarana taipehensis, a frog from East Asia, two AOPs denominated taipehensin-1TP1 (TLIWEFYHQILDEYNKENKG) and taipehensin-2TP1 (CLMARPNYRCKIFKQC) were identified. These AOPs exhibited a strong ABTS∙+ free radical scavenging capacity and efficient DPPH free radical scavenging kinetic activity, similar to other reported AOPs [8,62]. The free radical scavenging rates of ABTS•+ and DPPH were determined after 30 minutes. At a concentration of 200 mM, Taipehensin-1TP1 rapidly scavenged 34.1% of ABTS•+ in 1 minute, with a final scavenging rate of 65.4% after 30 minutes. Among these peptides, taipehensin-2TP1 (>50 mM) showed the highest scavenging ability and scavenged almost all ABTS•+ in 1 min. The ability of taipehensin-2TP1 to scavenge DPPH free radicals was lower than its ability to scavenge ABTS•+. At 50 mM, taipehensin-2TP1 scavenged only 85.4% of DPPH free radicals in 30 minutes. At a concentration of 200 mM, it showed scavenging solid ability for ABTS•+ and DPPH free radicals, with scavenging rates of 99.8% and 98.8%, respectively [32].

Brevinin Family

Brevinin-1TP1 (FLPGLIKAAVGVGSTILCKITKKC), brevinin-1TP2 (FLPGLIKAAVGIGSTIFCKISKKC), brevinin-1TP3 (FLPGLIKVAVGVGSTILCKITKKC), brevinin-1TP4 (FLPGLIKAAVGIGSTIFCKISRKC), brevinin-2TP1 (SILSTLKDVGISAIKSAGSGVLSTLLCKLNKNC), and brevinin-2TP2 (SILSTLKDVGISALKNAGSGVLKTLLCKLNKNCEK) from Hylarana taipehensis, as well as brevinin-1LF1 (FLPMLAGLAANFLPKIICKITKKC), brevinin-1LF2 (FLPIVASLAANFLPKIICKITKKC), brevinin-2LF1 (GFMDTAKNVAKNVAKNVAVTLLDKLRCKVTGGC), and brevinin-2LF2 (SIMSTLKQFGISAIKGAAQNVLGVLSCKIAKTC) from Amolops lifanensis, are examples belonging to this family. Some of these AMPs, as is the case with brevinin-1TP1, brevinin-1TP2, brevinin-1TP3, and brevinin-1LF, are active against a broad microbial spectrum, as well as having ABTS•+ or DPPH free radical scavenging capacity. Others, such as brevinin-2LF1, presented an MIC of 3.1 µM against the Gram-negative bacteria Psychrobacter faecalis X29. Additionally, brevinin-1TP1 showed both antioxidant and antimicrobial activity, with a free radical scavenging percentage of ABTS•+ of 26.5% at a concentration of 200 µM and suitable minimum inhibitory concentrations against different microbial strains such as Staphylococcus aureus (ATCC 25923) with MIC = 12.5 µM, Enterococcus faecalis 981 with MIC = 6.3 µM, Nocardia asteroides 201118 (IS) with MIC = 6.3 µM, Psychrobacter faecalis X29 with MIC = 6.3 µM, and Candida glabrata 090902 with MIC = 12.5 µM [32].
Another AOP identified in this family is brevinin-1FL (FWERCSRWLLN), derived from the skin of the frog Fejervarya limnocharis. Functional analysis demonstrated that brevinin-1FL could scavenge ABTS•+, DPPH, NO, and hydroxyl radicals in a concentration-dependent manner while reducing iron oxidation. Furthermore, brevinin-1FL was found to display neuroprotective activity by reducing malondialdehyde (MDA) and ROS levels, enhancing the activity of endogenous antioxidant enzymes, and inhibiting H2O2-induced death, apoptosis, and cell cycle arrest in PC-12 cells, which was associated with its regulation of the AKT/MAPK/NF-kB signaling pathways. Furthermore, brevinin-1FL decreased paw edema and lowered levels of TNF-alpha, IL-1β, IL-6, myeloperoxidase (MPO), and MDA, while restoring CAT and SOD activity, as well as GSH content in carrageenan-injected mice. The findings suggest that brevinin-1FL, holds significant therapeutic potential for diseases associated with oxidative damage [73].

Nigroain Family

In other studies, 50 peptides classified into 21 peptide families with antioxidant or antimicrobial activity were identified from the species Amolops daiyunensis, Hylarana maosuoensis, Pelophylax hubeiensis, and Nanorana pleskei, belonging to the Ranidae and Dicroglossidae families. From H. maosuoensis, peptides belonging to the nigroain family were identified, such as nigroain-B-MS1 (CVVSSGWKWNYKIRCKLTGNC), nigroain-C-MS1 (FKTWKNRPILSSCSGIIKG), nigroain-D-SN1 (CQWQFISPSRAGCIGP) and nigroain-K-SN1 (SLWETIKNAGKGFILNILDKIRCKVAGGCKT). Antioxidant and antimicrobial activity assays showed that some of these peptides exhibited significant results. For example, at a concentration of 50 μM, both nigroain-B-MS1 and nigroain-C-MS1 showed relatively strong ABTS•+ and DPPH free radical scavenging abilities, with scavenging rates of 99.7% and 68.3% for nigroain-B-MS1, and 99.8% and 58.3% for nigroain-C-MS1, respectively. Nigroain-B-MS1 also showed activity against Gram-positive bacteria such as Staphylococcus aureus (ATCC 25923) with MIC = 4.7 μM and Nocardia asteroides 201118 (IS) with MIC = 18.8 μM. Nigroain-C-MS1 only showed antimicrobial activity against the same strain of Nocardia with a MIC of 150 μM. Interestingly, these two peptides showed weak hemolytic activity [74].

Andersonin Family

From Odorrana andersonii, a Chinese odorous frog, 38 novel mature AMPs grouped into 25 different subfamilies were identified: andersonin-A, -B, -C, -E, -F, -J, -L, -M, -N, -O, -P, -R, -S, -T, -U, -X (all with only one peptide), andersonin-I, -K, -Q, -V, -Y (all with two peptides), and andersonin-D, -G, -H, -W (all with three peptides). Eight peptides were synthesized and assayed for antimicrobial, antioxidant, and other activities. Only andersonin-C1 (TSRCIFYRRKKCS) and andersonin-D1 (FIFPKKNIINSLFGR) showed killing effects against the tested strains (andersonin-C1 showed MICs of 30 µg.mL-1 against E. coli, C. albicans, as well as B. pyocyaneus, and MIC > 120 µg.mL-1 against S. aureus; while andersonin-D1 showed MIC > 126 µg.mL-1 against E. coli, but MICs of 16 µg.mL-1 against C. albicans, B. pyocyaneus, and S. aureus). Andersonin-C1, andersonin-N1 (ENMFNIKSSVESDSFWG), and andersonin-R1 (ENAEEDIVLMENLFCSYIVGSADSFWT) showed a scavenging rate percentage against ABTS•+ radicals greater than 70%. Interestingly, andersonin-C1 features a cyclic motif with a disulfide bond at the C-terminus, showing potent antioxidant activity. However, others such as andersonin-G1 (KEKLKLKCKAPKCYNDKLACT) and andersonin-H3 (VAIYGRDDRSDVCRQVQHNWLVCDTY), both with a cyclic motif as well, showed lower antioxidant activity, with scavenging rate percentages against ABTS•+ radicals greater than 20% and 30%, respectively. Only the peptides andersonin-D1, andersonin-Q1 (EMLKKKKEVKMERKT), and andersonin-S1 (DANVENGEDAEDLTDKFIGLMG) did not show detectable antioxidant activity [57]. The antioxidant activity of cyclic peptides was lower than that of linear peptides when compared with other families of AMPs with free Cys. Some studies support the proposition that peptides with potential antioxidant activity always contain a free Cys residue responsible for the free radical scavenging activity [62].
Considering that most studies on amphibians have been limited to the genetic mechanisms of adaptation to low oxygen levels and temperature in high-altitude areas, it was found that very few studies focused on the adaptation of amphibians to UV radiation according to altitude, which demonstrates the development of specialized molecules in response to such conditions. Therefore, in a study conducted on two species of frogs present in different altitudinal zones—specifically, the frog Odorrana andersonii, found in plateau areas (approximately 2,500 m) of Yunnan province in China, which is subject to long exposures to sunlight and intense UV radiation; and the cave frog O. wuchuanensis, distributed in a small number of caves that do not receive light throughout its life cycle at an altitude of 800 m in Guizhou province—it was found that the peptide families of these two species differ significantly in their antioxidant potential. The species O. andersonii exhibited peptides with greater diversity and free radical scavenging potential against UV radiation than those in O. wuchuanensis. Here, 26 new subfamilies belonging to the andersonin family were identified from high-altitude areas for O. andersonii. Most of these AOP subfamilies contained only one member, but others exhibited high diversity, such as andersonin-AOP8 and andersonin-AOP14, which included six and five members, respectively. Andersonin-AOP1 (FLPCLECVN) was the shortest AOP, while andersonin-AOP25 (ATALGIPPRGFLPIVNKFKDIILC) and andersonin-AOP26 (IPWKLPATLRPVENPFSKPLCRNY) were the longest AOPs (24 amino acids each). The antioxidant activity results for AOPs showed that AOPs from O. andersonii skin exhibited potential ABTS•+ scavenging activities more significant than 90% to 50 μM., except for andersonin-AOP9 (LKGFEMGMDMKRT, 51.33%), andersonin-AOP13 (APDRPRKFCGILG, 84.69%), andersonin-AOP17 (VTPPWARIYYGCAKA, 66.67%), and andersonin-AOP19a (GAGFWKMGKYGQKRRD, 60.00%). These results were further confirmed by determining DPPH free radical scavenging activity, as most of the AOPs from O. andersonii completely scavenged DPPH radicals, suggesting that O. andersonii has developed a much more complex and compelling skin AOP system to survive high-altitude UV radiation levels [54].

Odorranain Family

Odorrana has the most abundant and diversified AMPs among all studied amphibian genera. Even from a single frog, 46 cDNA sequences encoding precursors of 22 different AMPs were characterized from the skin of Odorrana tiannanensis. Ten peptides, grouped into six subfamilies, correspond to the odorranain family. Specifically, two AMPs, odorranain-C7HSa (SLLGTVKDLLIGAGKSAAQSVLKGLSCKLSKDC) and odorranain-G-OT (FVPAILCSILKTC), were purified from the skin secretions of O. tiannanensis, and their amino acid sequences matched the deduced sequences of the cDNAs. Odorranain-A-OT (VVKCSFRPGSPAPRCK), identified from the cDNA sequences, has the most potent antioxidant activity, scavenging 89.24% of the DPPH radicals, followed by odorranain-G-OT, which exhibited a scavenging rate of 70.41% at a concentration of 80 mg.mL-1. The study argues that the scavenging activity of the peptides is mainly related to the disulfide bridge, as well as the hydroxyl groups from the main chain of residues such as Ser and Thr, which possibly contribute to their hydrogen-donating capacity [56].

Hainanenin Family

From the skin secretions of the frog Amolops hainanensis, two new AMPs belonging to this family were identified from the cloning of 31 cDNA sequences encoding ten new AMPs across four peptide families. These two new peptides are hainanenin-1 (FALGAVTKLLPSLLCMITRKC) and hainanenin-5 (FALGAVTKRLPSLFCLITRKC), each consisting of 21 amino acid residues with a 7-residue C-terminal disulfide loop between Cys-15 and Cys-21. Hainanenin-1 and hainanenin-5 were synthesized and tested in vitro for antimicrobial, antioxidant, and hemolytic activities. The results showed that hainanenin-1 and hainanenin-5 possessed robust and broad-spectrum antimicrobial activities against Gram-positive and Gram-negative bacteria and fungi, including many clinically isolated drug-resistant pathogenic microorganisms. However, they exhibited slight antioxidant activity and undesirable hemolytic responses in human erythrocytes [53]. Although one aim of the study was to demonstrate that most of the peptides display multiple functions, such as antioxidant and antimicrobial activitie [8,33,62], it was observed that at concentrations up to 160 µg.mL-1, hainanenin-1 and hainanenin-5 showed no apparent antioxidant activity against DPPH free radicals, with free radical scavenging percentages of 3.60% and 1.52%, respectively. The thiol groups of cysteines are considered crucial for the free radical scavenging activity of peptides, as they can donate electrons to a free radical [48,62]. However, it is concluded that the thiol groups of the two cysteines in hainanenin-1 and hainanenin-5 are oxidized and form a disulfide bridge, which may cause the absence of their antioxidant activities [53].

FW Family

Another peptide family is FW, found in the tree frog Hyla annectansis, inhabiting the southwestern plateau area of China, where there is intense UV radiation and long periods of sunlight. This indicates that its bare skin may contain chemical defense components that protect it from acute photodamage [75]. However, to date, no peptide demonstrating this effect has been identified. In this work, two novel peptides, FW-1 (FWPLI-NH2) and FW-2 (FWPMI-NH2), were identified, which showed potential antioxidant effects in the epidermis by attenuating UVB-induced ROS production through an unknown mechanism. The study tested the effects of FW-1 and FW-2 on UVB-induced ROS accumulation, demonstrating that ROS production was significantly increased when HaCat cells were irradiated with UVB, and the peptides significantly attenuated UVB-induced ROS production. FW-1 and FW-2 inhibited UVB-induced ROS production remarkably at a concentration of 12 mg.mL-1, showing effects comparable to the positive control, N-acetylcysteine (NAC). Considering the ease of production, storage, and potential photoprotective activity of these two small peptides, FW-1 or FW-2 could be used as exciting lead compounds or templates for developing new pharmacological agents to suppress UVB-induced skin inflammation. Furthermore, this study could expand our understanding of the defensive mechanisms of tree frog skin against UVB irradiation [75].

OM Family

From the OM family, obtained from skin secretions of odorous frogs Odorrana margaretae, a novel peptide was identified, produced by post-translational processing of a 71-residue prepropeptide. This peptide, OM-LV20 (LVGKLLKGAVGDVCGLLPIC), contains an intramolecular disulfide bridge at the C-terminus and exhibits weak antioxidant activity. Although it had no direct antimicrobial effects, hemolytic activity, or acute toxicity, OM-LV20 effectively promoted wound healing in human keratinocytes (HaCaT) and human skin fibroblasts (HSF) in both a time- and dose-dependent manner. For that, OM-LV20 provides a new template for bioactive peptides in the development of novel wound healing agents and drugs [76].
A novel AOP produced by post-translational processing of a 61-residue prepropeptide was also discovered from the skin secretions of Odorrana margaretae and was named OM-GF17 (GFFKWHPRCGEEHSMWT). OM-GF17 did not exhibit direct antimicrobial activity but could scavenge free radicals like ABTS•+, DPPH, and NO, as well as reduce oxidized Fe3+ ions. However, these activities were slightly weaker than other peptides identified in the odorous frog, such as adersonine-AOP1 [54]. The results also demonstrated that five amino acid residues, including Cys, Pro, Met, Trp, and Phe, are related to the antioxidant activity of OM-GF17. There was no apparent influence on ABTS•+ radical scavenging activity when all five amino acids were mutated individually; however, the antioxidant activity was abolished when all five amino acids were mutated together. When Met-15 and Trp-16 were replaced, the new mutant showed a decrease in scavenging rate to approximately 50 seconds, and when Trp-5 and Cys-9 were replaced, the scavenging rate decreased to approximately 60 seconds. OM-GF17 reached a maximum scavenging rate in 10 seconds. These five amino acids influence ABTS•+ scavenging efficiency; specifically, Phe-2, Phe-3, and Pro-7 showed greater responsibility for the scavenging efficiency of OM-GF17. Additionally, it was observed that the Cys-9 mutant of OM-GF17 resulted in eliminated Fe3+-reducing power, while for (Phe-2/Ala), (Phe-3/Ala), (Trp-5/Ala), (Pro-7/Ala), (Met-15/Ala), and (Trp-16/Ala), mutants of OM-GF17 showed similar activity to the natural parental peptide. This demonstrates that Cys-9 is responsible for the peptide’s Fe3+-reducing power. Thus, the antioxidant activity of amphibian peptides might be related to their amino acid composition and sequence. Although free Cys, Pro, Met, Trp, and Phe residues are considered responsible for the general antioxidant activity of OM-GF17, it does not necessarily mean that they all directly participate in the quenching of free radicals. On the other hand, this novel gene-encoded antioxidant peptide may help in the development of new antioxidant agents [77].
In another study, a novel antioxidant peptide named OM-GL15 (GLLSGHYGRASPVAC) was identified from the skin of the green odorous frog Odorrana margaritae. Its antioxidant activity was demonstrated by evaluating its ability to scavenge ABTS•+ and DPPH free radicals and its power to reduce Fe3+ to Fe2+. Exploration of the underlying mechanisms further demonstrated that OM-GL15 exerts significant antioxidant potential by reducing lipid peroxidation and malondialdehyde levels, protecting epidermal cells from UVB-induced apoptosis. It inhibits DNA damage by downregulating p53, caspase-3, caspase-9, and Bax and upregulating Bcl-2. Additionally, the topical application of OM-GL15 significantly reduced UVB-induced skin photodamage in mice. These results emphasize the potential use of amphibian skin-derived peptides for protection against UVB-induced photodamage and present a new candidate peptide for the development of anti-photodamage agents [31].

OA Family

In a previous study of the skin secretions of the frog Odorrana andersonii, coding a short gene led to the peptide OA-VI12 (VIPFLACRPLGL) expression. This peptide was shown to exert a direct scavenging capacity for free radicals, suggesting a possible role in protecting the skin from photodamage due to its high-altitude habitat [69]. OA-VI12 was analyzed in models of oxidative stress induced by UVB irradiation and hydrogen peroxide in immortalized human keratinocytes. The results showed that OA-VI12 preserved cell viability, enhanced the release of CAT, and reduced levels of lactate dehydrogenase and ROS. Furthermore, the peptide stimulated the production of SOD and GSH, reduced the thickness of the epidermis and dermis, and minimized the formation of light spots and collagen fibers in the skin of the photoinjured mouse model. These findings highlight the beneficial role of the AOPs encoded by gene and its potential application as a protective agent against photodamage [11].
In another study conducted on the skin secretions of Odorrana andersonii, a peptide named OA-GL21 (GLLSGHYGRVVSTQSGHYGRG) was identified, which demonstrated weak antioxidant activity through ABTS•+ and DPPH free radical scavenging methods, although it exhibited high stability. However, this peptide significantly enhanced wound healing in human keratinocytes and fibroblasts in a dose- and time-dependent manner. In conclusion, this research demonstrated the effects of OA-GL21 on cellular and animal wounds and provided a novel template peptide for the development of wound repair drugs [78].

Temporin Family

From a large group of AOP and AMP families present in three East Asian frog species (Amolops lifanensis, Hylarana taipehensis and Amolops granulosus), the peptides temporin-TP1 (FLPVLGKVIKLVGGLL-NH2), temporin-TP2 (FLPLLVGAISSILPKIF-NH2) and temporin-TP3 (FLPLLFGALSTLLPKIF-NH2) were found from H. taipehensis; temporin-LF1(FLPFVGKLLSGLL-NH2) and temporin-LF2 (FLPIVTGLLTSLL-NH2) from A. lifanensis; temporin-1P (FLPIVGKLLSGLL-NH2) and temporin-MT1 (FLPIVTGLLSSLL-NH2) from the species A. lifanensis and A. granulosus; and temporin-CG3 (FLPIVGKLLSGLF-NH2) only from the species A. granulosus. Temporin-TP1 peptide exhibited the ability to scavenge ABTS•+ and/or DPPH radicals [8,62]. Although temporin-TP1 did not show obvious antimicrobial activity against some microorganisms, it had strong antimicrobial activity (with MIC=3.1mM) against Gram-positive bacteria: Staphylococcus aureus (ATCC 25923), Enterococcus faecalis 981 (IS), and Nocardia asteroides 201118 (IS) [32].
In a study that identified 50 peptides grouped into 21 peptide families exhibiting antioxidant and antimicrobial activity from Amolops daiyunensis, Hylarana maosuoensis, Pelophylax hubeiensis, and Nanorana pleskei, the AMPs temporin-DY1, temporin-HB1, temporin-HB2, temporin-MS1, and temporin-MS4 were found, varying significantly in their activities due to the great variety of peptide structures they present. Of the peptides found, temporin-MS1 (FLTGLIGGLMKALGK) was synthesized and showed a slight ABTS•+ free radical scavenging capacity, with 21.4 ± 2.2% eradication rates. In the antimicrobial activity results, temporin-MS1 showed activity against different Gram-positive strains such as Staphylococcus aureus (ATCC 25923), Enterococcus faecalis 981 (IS), and Nocardia asteroides 201118 (IS), as well as Gram-negative strains such as Pseudomonas aeruginosa (CGMCC 1.50), Klebsiella pneumoniae 08040724 (IS), and Escherichia coli (ATCC 25922). However, peptides temporin-MS1 and temporin-MS4 showed the most muscular hemolytic activity, which presents an undesirable effect associated with these peptides [74].

Daiyunin and Pleskein Families

The daiyunin family is a group of peptides found in Amolops daiyunensis, an East Asian frog species from China. Here were identified daiyunin-1 (CGYKYGCMVKVDR), daiyunin-2 (FFGTKGIFSKVEPIFCKISHSC), and daiyunin-3 (IVRPPIRCKAAFC). Among these, daiyunin-1 exhibited significant results in the antioxidant and antimicrobial assays. At a concentration of 50 μM, the scavenging ability of daiyunin-1 against ABTS•+ and DPPH radicals within 30 minutes of the reaction was low, but its scavenging rate against ABTS•+ reached 77.1% when the reaction time was prolonged to 14 hours. In the same study, from Nanorana pleskei, an East Asian frog species from China, pleskein-1 (FFPLIPGVRCKILRTC), pleskein-2 (FFLLPIPNDVKCKVLGICKS), and pleskein-3 (ILPSKLCRLLGNC) were reported. Antioxidant and antimicrobial activity assays showed that pleskein-1 and pleskein-2 have relatively weak antimicrobial activities, and only pleskein-2 has specific antioxidant activity (11.3% in an ABTS assay after 30 minutes at 50 μM). Pleskein-3 did not show any antimicrobial or antioxidant activity; however, it is inferred that pleskein-3, by sharing the same precursors with AMP or AOP, may possess other functions that help frogs adapt to their living environments [74].

Jindongenin Family

This family was reported about the Chinese torrent frog Amolops jingdongensis. One of its components is a 24-amino-acid peptide, jindongenin-1a (DSMGAVKLAKLLIDKMKCEVTKAC), tested for various activities, including antioxidant activity. Jindongenin-1a showed broad-spectrum antimicrobial activity against standard and clinically isolated bacterial strains. However, DPPH free radical scavenging assays indicated that jindongenin-1a exhibited low antioxidant activity at doses up to 32 mM (8% inhibition). The results suggest that these peptides do not play a key role in the habituation of A. jingdongensis to intense UV exposure [34].

Tryptophilins Family

As for tryptophilins, they are one of the first peptides identified in amphibians’ skin secretions. They are characterized as a heterogeneous group of peptides that were recently reclassified according to their structures into the following groups: T-1 (C-amidated heptapeptides and non-amidated octapeptides that have an N-terminus formed by Lys and Pro residues, a Trp residue at position 5, and a Pro residue at position 7), T-2 (four to seven amino acid residues, which have an internal Pro-Trp), and T-3 (tridecapeptides with five conserved Pro residues and the absence of Trp) [58]. Tryptophilins have been commonly associated with myoactive and vasorelaxation/vasoconstriction properties [58,60], opioid-like biological activities [59], antiproliferative effects [60], and antimicrobial actions [40,79].
Recent studies have found tryptophilin-like peptides with antioxidant potential in frogs of the species Pithecopus azureus [46] and Pelophylax perezi [80]. For P. azureus, the amidated antioxidant peptide PaT-2 (FPPWL-NH2) and its respective analogs PaT-2a1 (FPLPW-NH2) and PaT-2a2 (PWLFP-NH2) were reported [46] . For P. perezi, the also amidated antioxidant peptide PpT-2 (FPWLLS-NH2) was reported, which demonstrated significant antioxidant potential for tryptophilin-like peptides [80]. The results of the analysis of peptides PaT-2 and its analogs (PaT-2a1 and PaT-2a2) showed antioxidant activity and low cytotoxicity in mammalian central nervous system cells such as mouse BV2 microglia and human neuroblastoma cells SK-N-BE(2), which were stimulated with the diester phorbol 12-myristate 13-acetate (PMA) and treated simultaneously with PaT-2, PaT-2a1, or PaT-2a2 at concentrations of 50 µM and 100 µM. ROS and RNS were detected before and after flow cytometry analysis for these cells, showed significant differences compared to control cells treated only in DMEM medium. Additionally, morphological and histological analyses of the skin to identify the glands of P. azureus, as well as the results of the in silico and in vitro radical scavenging tests, allowed verification of the possible relationship between PaT-2 and oxidative protection, leading the authors to conclude that they had identified, for the first time, a tryptophilin-like peptide with antioxidant potential [46].
On the other hand, the results from analysis of the antioxidant peptide PpT-2 were measured based on the mechanism of action of these compounds, as it generally involves a series of complex processes for deactivating and trapping free radicals. These processes include the transfer of relevant charges and the antioxidant activities of biological systems. Therefore, the possible antioxidant properties of PpT-2 were measured through its ability to eliminate ABTS and DPPH radicals in vitro, using Trolox and GSH as a reference compound and as a reference antioxidant peptide, respectively. The results showed that PpT-2 had an ABTS scavenging activity of 0.269 mg.trolox-eq.mg-1 of peptide, which is comparable to that of other amphibian-derived peptides such as salamandrin-I (FAVWGCADYRGY-NH2) with values of 0.285 mg.trolox-eq.mg-1 of peptide, and antioxidin-RP1 (AMRLTYNKPCLYGT) with values of 0.300 mg.trolox-eq.mg-1 of peptide. These values are higher than the activity of antioxidant-I (TWYFITPYIPDK) with values of 0.010 mg.trolox-eq.mg-1 of peptide [47] but much lower than that of glutathione (1.911 mg.trolox-eq.mg-1 of peptide). These results indicate that PpT-2 has free radical scavenging activities, with the most robust and potent activity against ABTS radicals. The neuroprotective activity of PpT-2 was also evaluated in mammalian cells, specifically mouse (Mus musculus) microglia, which respond to tissue damage and infection by producing and releasing ROS and RNS into the surrounding central nervous system (CNS) environment. Mouse microglial cells (BV-2) were stimulated with PMA, a chemical known to induce ROS and RNS production, either in the presence or absence of PpT-2 at the two different concentrations. PMA activates protein kinase C, phosphorylating p47phox to activate NADPH oxidase (NOX), ultimately leading to increased ROS generation. The results indicated that at the tested concentrations, PpT-2 effectively inhibits oxidative stress in BV-2 cells during the 30 minutes of simultaneous incubation with PMA, occurring right at the onset of treatment. Furthermore, PpT-2 inhibits RNS generation even in cells not stimulated by PMA, suggesting that this inhibition occurs under basal conditions. The results showed that PpT-2 regulates the steady-state levels of both ROS and RNS through its antioxidant effects. Thus, this tryptophilin shows promise as a therapeutic agent for treating or preventing neurodegenerative disorders due to its antioxidant activity in microglia and the role of redox imbalance in the onset and progression of diseases such as Alzheimer’s, Parkinson’s, and Huntington’s. Despite the number of tryptophilins known, this is the first study to verify this bioactivity and therapeutic potential for PpT-2 [80].

4. Concluding Remarks and Prospects

Amphibian AMPs, particularly those called AOPs, due to their antioxidant activity, show significant promise for addressing diseases related to oxidative stress, such as cancer, neurodegenerative disorders, cardiovascular disorders, and other diseases. These peptides can act as direct scavengers of ROS and RNS species, which, together with their antimicrobial properties, positions them as valuable multifunctional molecules. Although some of these peptides present amino acids in common, which are attributed to the ability to stabilize free radicals, such as Trp, Tyr, Pro, and Phe, the structural diversity of these peptides poses challenges, as the lack of identical sequences in all families emphasizes the need for extensive research to decode their unique structures and functions.
The studies highlight the complex mechanisms through which amphibian peptides mitigate oxidative stress, regulating the levels of reactive species associated with oxidative stress through enzymatic and non-enzymatic pathways, which are still unclear. Elucidating such mechanisms is particularly relevant because it allows us to understand in part how these diseases work and will allow us to design analogous peptides for the treatment of pathologies such as cancer, neurodegenerative disorders, and cardiovascular diseases, where oxidative stress is a common underlying factor.
Investigating the molecular dynamics of amphibian peptides not only broadens our understanding of their biological functions but also paves the way for the development of effective, nature-inspired therapeutic agents. Future research directions should focus on comprehensive characterization involving systematic studies to characterize the structures and functions of various amphibian AOPs and AMPs in different species; mechanistic studies with in-depth investigations into the molecular mechanisms of action of these peptides, especially in vivo models, to validate their therapeutic potential; and translational research exploring the clinical applications of these peptides, including their integration into current treatment regimens for oxidative stress-related diseases. Through a multidisciplinary approach leveraging advances in biochemistry, pharmacology, and molecular biology, the potential of amphibian-derived peptides could be harnessed to create innovative therapeutic solutions that address some of the most pressing health challenges related to oxidative stress and inflammation.

Author Contributions

Conceptualization, J.F.B.V. and O.L.F.; Original Draft Preparation, J.F.B.V. and O.L.F.; Writing—Review and Editing, Y.L.S.O., T.C.d.S., N.E.K., J.F.B.V., M.H.S.R. and O.L.F.; Supervision, and funding acquisition, O.L.F. All authors have read and agreed to the published version of the manuscript. The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Acknowledgments

Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq), Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES), Fundação de Apoio à Pesquisa do Distrito Federal (FAPDF) and Fundação de Apoio ao Desenvolvimento do Ensino, Ciência e Tecnologia do Estado de Mato Grosso do Sul (FUNDECT). Y.L.S.O. would like to thank the Vicerrectoría de Investigación e Innovación of la Universidad de la Amazonia -Colombia, and the Convocatoria No. 933-2023, “Formación en doctorados nacionales con enfoque territorial, étnico y de género en el marco de la política orientada por misiones-2023” of the Ministerio de Ciencia, Tecnología e Innovación de Colombia Innovación de Colombia (MINCIENCIAS).

Conflicts of Interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

References

  1. Marenah, L.; Flatt, P.R.; Orr, D.F.; Shaw, C.; Abdel-Wahab, Y.H.A. Skin Secretions of Rana Saharica Frogs Reveal Antimicrobial Peptides Esculentins-1 and -1B and Brevinins-1E and -2EC with Novel Insulin Releasing Activity. Journal of Endocrinology 2006, 188, 1–9. [Google Scholar] [CrossRef]
  2. Arcanjo, D.D.R.; Vasconcelos, A.G.; Comerma-Steffensen, S.G.; Jesus, J.R.; Silva, L.P.; Pires, O.R.; Costa-Neto, C.M.; Oliveira, E.B.; Migliolo, L.; Franco, O.L.; et al. A Novel Vasoactive Proline-Rich Oligopeptide from the Skin Secretion of the Frog Brachycephalus Ephippium. PLoS One 2015, 10. [Google Scholar] [CrossRef] [PubMed]
  3. Wang, X.; Song, Y.; Li, J.; Liu, H.; Xu, X.; Lai, R.; Zhang, K. A New Family of Antimicrobial Peptides from Skin Secretions of Rana Pleuraden. Peptides (N.Y.) 2007, 28, 2069–2074. [Google Scholar] [CrossRef] [PubMed]
  4. Feng, G.; Wu, J.; Yang, H.-L.; Mu, L. Discovery of Antioxidant Peptides from Amphibians: A Review. Protein Pept Lett 2021, 28, 1220–1229. [Google Scholar] [CrossRef]
  5. Kirk, J.T.O. Light and Photosynthesis in Aquatic Ecosystems; Cambridge University Press, 2010; ISBN 9780521151757.
  6. Clarke, B.T. THE NATURAL HISTORY OF AMPHIBIAN SKIN SECRETIONS, THEIR NORMAL FUNCTIONING AND POTENTIAL MEDICAL APPLICATIONS. Biological Reviews 1997, 72, 365–379. [Google Scholar] [CrossRef]
  7. Geihs, M.A.; Moreira, D.C.; López-Martínez, G.; Minari, M.; Ferreira-Cravo, M.; Carvajalino-Fernández, J.M.; Hermes-Lima, M. Commentary: Ultraviolet Radiation Triggers “Preparation for Oxidative Stress” Antioxidant Response in Animals: Similarities and Interplay with Other Stressors. Comp Biochem Physiol A Mol Integr Physiol 2020, 239. [Google Scholar] [CrossRef]
  8. Yang, H.; Wang, X.; Liu, X.; Wu, J.; Liu, C.; Gong, W.; Zhao, Z.; Hong, J.; Lin, D.; Wang, Y.; et al. Antioxidant Peptidomics Reveals Novel Skin Antioxidant System. Molecular and Cellular Proteomics 2009, 8, 571–583. [Google Scholar] [CrossRef] [PubMed]
  9. Chevion, S.; Berry, E.M.; Kitrossky, N.; Kohen, R. Evaluation of Plasma Low Molecular Weight Antioxidant Capacity by Cyclic Voltammetry. Free Radic Biol Med 1997, 22, 411–421. [Google Scholar] [CrossRef]
  10. Shindo, Y.; Witt, E.; Packer, L. Antioxidant Defense Mechanisms in Murine Epidermis and Dermis and Their Responses to Ultraviolet Light. Journal of Investigative Dermatology 1993, 100, 260–265. [Google Scholar] [CrossRef] [PubMed]
  11. Yin, S.; Wang, Y.; Liu, N.; Yang, M.; Hu, Y.; Li, X.; Fu, Y.; Luo, M.; Sun, J.; Yang, X. Potential Skin Protective Effects after UVB Irradiation Afforded by an Antioxidant Peptide from Odorrana Andersonii. Biomedicine and Pharmacotherapy 2019, 120. [Google Scholar] [CrossRef]
  12. Zhu, Y.; Wang, K.; Jia, X.; Fu, C.; Yu, H.; Wang, Y. Antioxidant Peptides, the Guardian of Life from Oxidative Stress. Med Res Rev 2024, 44, 275–364. [Google Scholar] [CrossRef]
  13. Xie, H.; Hou, S.; Jiang, J.; Sekutowicz, M.; Kelly, J.; Bacskai, B.J. Rapid Cell Death Is Preceded by Amyloid Plaque-Mediated Oxidative Stress. Proc Natl Acad Sci U S A 2013, 110, 7904–7909. [Google Scholar] [CrossRef]
  14. van der Vliet, A.; Janssen-Heininger, Y.M.W. Hydrogen Peroxide as a Damage Signal in Tissue Injury and Inflammation: Murderer, Mediator, or Messenger? J Cell Biochem 2014, 115, 427–435. [Google Scholar] [CrossRef]
  15. Di Meo, S.; Reed, T.T.; Venditti, P.; Victor, V.M. Role of ROS and RNS Sources in Physiological and Pathological Conditions. Oxid Med Cell Longev 2016, 2016. [Google Scholar] [CrossRef] [PubMed]
  16. Nieborowska-Skorska, M.; Kopinski, P.K.; Ray, R.; Hoser, G.; Ngaba, D.; Flis, S.; Cramer, K.; Reddy, M.M.; Koptyra, M.; Penserga, T.; et al. Rac2-MRC-CIII–Generated ROS Cause Genomic Instability in Chronic Myeloid Leukemia Stem Cells and Primitive Progenitors. Blood 2012, 119, 4253–4263. [Google Scholar] [CrossRef] [PubMed]
  17. Radisky, D.C.; Levy, D.D.; Littlepage, L.E.; Liu, H.; Nelson, C.M.; Fata, J.E.; Leake, D.; Godden, E.L.; Albertson, D.G.; Nieto, M.A.; et al. Rac1b and Reactive Oxygen Species Mediate MMP-3-Induced EMT and Genomic Instability. Nature 2005, 436, 123–127. [Google Scholar] [CrossRef]
  18. Deng, L.; Du, C.; Song, P.; Chen, T.; Rui, S.; Armstrong, D.G.; Deng, W. The Role of Oxidative Stress and Antioxidants in Diabetic Wound Healing. Oxid Med Cell Longev 2021, 2021. [Google Scholar] [CrossRef] [PubMed]
  19. Senoner, T.; Dichtl, W. Oxidative Stress in Cardiovascular Diseases: Still a Therapeutic Target? Nutrients 2019, 11. [Google Scholar] [CrossRef]
  20. Bourdon, E.; Blache, D. The Importance of Proteins in Defense Against Oxidation. Antioxid Redox Signal 2001, 3, 293–311. [Google Scholar] [CrossRef] [PubMed]
  21. Hardas, S.S.; Sultana, R.; Clark, A.M.; Beckett, T.L.; Szweda, L.I.; Paul Murphy, M.; Butterfield, D.A. Oxidative Modification of Lipoic Acid by HNE in Alzheimer Disease Brain. Redox Biol 2013, 1, 80–85. [Google Scholar] [CrossRef]
  22. Hou, L.; Zhou, X.; Zhang, C.; Wang, K.; Liu, X.; Che, Y.; Sun, F.; Li, H.; Wang, Q.; Zhang, D.; et al. NADPH Oxidase-Derived H2O2 Mediates the Regulatory Effects of Microglia on Astrogliosis in Experimental Models of Parkinson’s Disease. Redox Biol 2017, 12, 162–170. [Google Scholar] [CrossRef] [PubMed]
  23. Berggren, K.L.; Chen, J.; Fox, J.; Miller, J.; Dodds, L.; Dugas, B.; Vargas, L.; Lothian, A.; McAllum, E.; Volitakis, I.; et al. Neonatal Iron Supplementation Potentiates Oxidative Stress, Energetic Dysfunction and Neurodegeneration in the R6/2 Mouse Model of Huntington’s Disease. Redox Biol 2015, 4, 363–374. [Google Scholar] [CrossRef]
  24. Martins, D.; English, A.M. SOD1 Oxidation and Formation of Soluble Aggregates in Yeast: Relevance to Sporadic ALS Development. Redox Biol 2014, 2, 632–639. [Google Scholar] [CrossRef]
  25. Dimri, G.P.; Leet, X.; Basile, G.; Acosta, M.; Scorrt, G.; Roskelley, C.; Medrano, E.E.; Linskensi, M.; Rubeljii, I.; Pereira-Smithii, O.; et al. A Biomarker That Identifies Senescent Human Cells in Culture and in Aging Skin in Vivo (Replicative Senescence/Tumor Suppression/18-Galactosidase) Communicated by Arthur; 1995; Vol. 92;
  26. Millis,’ Marianhoyle, A.J.T.; Mccue, H.M. Differential Expression of Metalloproteinase and Tissue Inhibitor of Metalloproteinase Genes in Aged Human Fibroblasts’, 1992.
  27. Gu, Y.; Han, J.; Jiang, C.; Zhang, Y. Biomarkers, Oxidative Stress and Autophagy in Skin Aging. Ageing Res Rev 2020, 59, 101036. [Google Scholar] [CrossRef]
  28. Mookherjee, N.; Anderson, M.A.; Haagsman, H.P.; Davidson, D.J. Antimicrobial Host Defence Peptides: Functions and Clinical Potential. Nat Rev Drug Discov 2020, 19, 311–332. [Google Scholar] [CrossRef] [PubMed]
  29. Wang, J.; Dou, X.; Song, J.; Lyu, Y.; Zhu, X.; Xu, L.; Li, W.; Shan, A. Antimicrobial Peptides: Promising Alternatives in the Post Feeding Antibiotic Era. Med Res Rev 2019, 39, 831–859. [Google Scholar] [CrossRef] [PubMed]
  30. Xu, X.; Lai, R. The Chemistry and Biological Activities of Peptides from Amphibian Skin Secretions. Chem Rev 2015, 115, 1760–1846. [Google Scholar] [CrossRef]
  31. Zhang, X.; Feng, C.; Wang, S.; Wang, Y.; Fu, Z.; Zhang, Y.; Sun, H.; Xie, C.; Fu, Y.; Tao, J.; et al. A Novel Amphibian-Derived Peptide Alleviated Ultraviolet B-Induced Photodamage in Mice. Biomedicine and Pharmacotherapy 2021, 136, 111258. [Google Scholar] [CrossRef]
  32. Guo, C.; Hu, Y.; Li, J.; Liu, Y.; Li, S.; Yan, K.; Wang, X.; Liu, J.; Wang, H. Identification of Multiple Peptides with Antioxidant and Antimicrobial Activities from Skin and Its Secretions of Hylarana Taipehensis, Amolops Lifanensis, and Amolops Granulosus. Biochimie 2014, 105, 192–201. [Google Scholar] [CrossRef] [PubMed]
  33. Lu, Z.; Zhai, L.; Wang, H.; Che, Q.; Wang, D.; Feng, F.; Zhao, Z.; Yu, H. Novel Families of Antimicrobial Peptides with Multiple Functions from Skin of Xizang Plateau Frog, Nanorana Parkeri. Biochimie 2010, 92, 475–481. [Google Scholar] [CrossRef]
  34. Chen, Z.; Yang, X.; Liu, Z.; Zeng, L.; Lee, W.; Zhang, Y. Two Novel Families of Antimicrobial Peptides from Skin Secretions of the Chinese Torrent Frog, Amolops Jingdongensis. Biochimie 2012, 94, 328–334. [Google Scholar] [CrossRef] [PubMed]
  35. Feng, G.; Wei, L.; Che, H.; Shen, Y.; Yang, J.; Mi, K.; Liu, J.; Wu, J.; Yang, H.; Mu, L. A Frog Peptide Ameliorates Skin Photoaging Through Scavenging Reactive Oxygen Species. Front Pharmacol 2022, 12. [Google Scholar] [CrossRef]
  36. Sousa, N.A.; Oliveira, G.A.L.; de Oliveira, A.P.; Lopes, A.L.F.; Iles, B.; Nogueira, K.M.; Araújo, T.S.L.; Souza, L.K.M.; Araújo, A.R.; Ramos-Jesus, J.; et al. Novel Ocellatin Peptides Mitigate LPS-Induced ROS Formation and NF-KB Activation in Microglia and Hippocampal Neurons. Sci Rep 2020, 10, 1–16. [Google Scholar] [CrossRef] [PubMed]
  37. Rong, M.; Liu, J.; Liao, Q.; Lin, Z.; Wen, B.; Ren, Y.; Lai, R. The Defensive System of Tree Frog Skin Identified by Peptidomics and RNA Sequencing Analysis. Amino Acids 2019, 51, 345–353. [Google Scholar] [CrossRef] [PubMed]
  38. Magalhães, L.M.; Segundo, M.A.; Reis, S.; Lima, J.L.F.C. Methodological Aspects about in Vitro Evaluation of Antioxidant Properties. Anal Chim Acta 2008, 613, 1–19. [Google Scholar] [CrossRef]
  39. Jung, H.A.; Jeong, D.-M.; Chung, H.Y.; Lim, H.A.; Kim, J.Y.; Yoon, N.Y.; Choi, J.S. Re-Evaluation of the Antioxidant Prenylated Flavonoids from the Roots of Sophora Flavescens. Biol Pharm Bull 2008, 31, 908–915. [Google Scholar] [CrossRef]
  40. Xu, X.; Yang, H.; Ma, D.; Wu, J.; Wang, Y.; Song, Y.; Wang, X.; Lu, Y.; Yang, J.; Lai, R. Toward an Understanding of the Molecular Mechanism for Successful Blood Feeding by Coupling Proteomics Analysis with Pharmacological Testing of Horsefly Salivary Glands. Molecular and Cellular Proteomics 2008, 7, 582–590. [Google Scholar] [CrossRef] [PubMed]
  41. Peskin, A. V.; Winterbourn, C.C. Assay of Superoxide Dismutase Activity in a Plate Assay Using WST-1. Free Radic Biol Med 2017, 103, 188–191. [Google Scholar] [CrossRef]
  42. Radak, Z.; Zhao, Z.; Goto, S.; Koltai, E. Age-Associated Neurodegeneration and Oxidative Damage to Lipids, Proteins and DNA. Mol Aspects Med 2011, 32, 305–315. [Google Scholar] [CrossRef]
  43. Pisoschi, A.M.; Pop, A.; Cimpeanu, C.; Predoi, G. Antioxidant Capacity Determination in Plants and Plant-Derived Products: A Review. Oxid Med Cell Longev 2016, 2016. [Google Scholar] [CrossRef]
  44. Yu, H.; Qiao, X.; Gao, J.; Wang, C.; Cai, S.; Feng, L.; Wang, H.; Wang, Y.-P. Send Orders for Reprints to Reprints@benthamscience.Ae Identification and Characterization of Novel Antioxidant Peptides Involved in Redox Homeostasis of Frog: Limnonectes Fragilis; 2015; Vol. 22.
  45. Qian, Z.J.; Jung, W.K.; Kim, S.K. Free Radical Scavenging Activity of a Novel Antioxidative Peptide Purified from Hydrolysate of Bullfrog Skin, Rana Catesbeiana Shaw. Bioresour Technol 2008, 99, 1690–1698. [Google Scholar] [CrossRef] [PubMed]
  46. Barbosa, E.A.; Plácido, A.; Moreira, D.C.; Albuquerque, L.; Dematei, A.; Silva-Carvalho, A.; Cabral, W.F.; Báo, S.N.; Saldanha-Araújo, F.; Kuckelhaus, S.A.S.; et al. The Peptide Secreted at the Water to Land Transition in a Model Amphibian Has Antioxidant Effects. Proceedings of the Royal Society B: Biological Sciences 2021, 288. [Google Scholar] [CrossRef] [PubMed]
  47. Barbosa, E.A.; Oliveira, A.; Plácido, A.; Socodato, R.; Portugal, C.C.; Mafud, A.C.; Ombredane, A.S.; Moreira, D.C.; Vale, N.; Bessa, L.J.; et al. Structure and Function of a Novel Antioxidant Peptide from the Skin of Tropical Frogs. Free Radic Biol Med 2018, 115, 68–79. [Google Scholar] [CrossRef] [PubMed]
  48. Åkerström, B.; Maghzal, G.J.; Winterbourn, C.C.; Kettle, A.J. The Lipocalin A1-Microglobulin Has Radical Scavenging Activity. Journal of Biological Chemistry 2007, 282, 31493–31503. [Google Scholar] [CrossRef] [PubMed]
  49. Wen, C.; Zhang, J.; Zhang, H.; Duan, Y.; Ma, H. Plant Protein-Derived Antioxidant Peptides: Isolation, Identification, Mechanism of Action and Application in Food Systems: A Review. Trends Food Sci Technol 2020, 105, 308–322. [Google Scholar] [CrossRef]
  50. Von Heijne, G. MEMBRANE PROTEINS: From Sequence to Structure, PROTEINS, 1994.
  51. Mosmann, T. Rapid Colorimetric Assay for Cellular Growth and Survival: Application to Proliferation and Cytotoxicity Assays. J Immunol Methods 1983, 65, 55–63. [Google Scholar] [CrossRef] [PubMed]
  52. López-García, G.; Dublan-García, O.; Arizmendi-Cotero, D.; Gómez Oliván, L.M. Antioxidant and Antimicrobial Peptides Derived from Food Proteins. Molecules 2022, 27, 1343. [Google Scholar] [CrossRef]
  53. Zhang, S.; Guo, H.; Shi, F.; Wang, H.; Li, L.; Jiao, X.; Wang, Y.; Yu, H. Hainanenins: A Novel Family of Antimicrobial Peptides with Strong Activity from Hainan Cascade-Frog, Amolops Hainanensis. Peptides (N.Y.) 2012, 33, 251–257. [Google Scholar] [CrossRef]
  54. Yang, X.; Wang, Y.; Zhang, Y.; Lee, W.H.; Zhang, Y. Rich Diversity and Potency of Skin Antioxidant Peptides Revealed a Novel Molecular Basis for High-Altitude Adaptation of Amphibians. Sci Rep 2016, 6, 1–11. [Google Scholar] [CrossRef]
  55. Brand-Williams, W.; Cuvelier, M.E.; Berset, C. Use of a Free Radical Method to Evaluate Antioxidant Activity; 1995; Vol. 28.
  56. He, W.; Feng, F.; Huang, Y.; Guo, H.; Zhang, S.; Li, Z.; Liu, J.; Wang, Y.; Yu, H. Host Defense Peptides in Skin Secretions of Odorrana Tiannanensis: Proof for Other Survival Strategy of the Frog than Merely Anti-Microbial. Biochimie 2012, 94, 649–655. [Google Scholar] [CrossRef]
  57. Yang, X.; Lee, W.H.; Zhang, Y. Extremely Abundant Antimicrobial Peptides Existed in the Skins of Nine Kinds of Chinese Odorous Frogs. J Proteome Res 2012, 11, 306–319. [Google Scholar] [CrossRef]
  58. Chen, T.; Orr, D.F.; O’Rourke, M.; McLynn, C.; Bjourson, A.J.; McClean, S.; Hirst, D.; Rao, P.; Shaw, C. Pachymedusa Dacnicolor Tryptophyllin-1: Structural Characterization, Pharmacological Activity and Cloning of Precursor CDNA. Regul Pept 2004, 117, 25–32. [Google Scholar] [CrossRef] [PubMed]
  59. Ellis-Steinborner, S.T.; Scanlon, D.; Musgrave, I.F.; Tran, T.T.N.; Hack, S.; Wang, T.; Abell, A.D.; Tyler, M.J.; Bowie, J.H. An Unusual Kynurenine-Containing Opioid Tetrapeptide from the Skin Gland Secretion of the Australian Red Tree Frog Litoria Rubella. Sequence Determination by Electrospray Mass Spectrometry. Rapid Communications in Mass Spectrometry 2011, 25, 1735–1740. [Google Scholar] [CrossRef] [PubMed]
  60. Wang, R.; Chen, T.; Zhou, M.; Wang, L.; Shaw, C. PsT-1: A New Tryptophyllin Peptide from the Skin Secretion of Waxy Monkey Leaf Frog, Phyllomedusa Sauvagei. Regul Pept 2013, 184, 14–21. [Google Scholar] [CrossRef] [PubMed]
  61. Zasloff, M. Magainins, a Class of Antimicrobial Peptides from Xenopus Skin: Isolation, Characterization of Two Active Forms, and Partial CDNA Sequence of a Precursor (Vertebrate Peptide Antibiotics); 1987; Vol. 84.
  62. Liu, C.; Hong, J.; Yang, H.; Wu, J.; Ma, D.; Li, D.; Lin, D.; Lai, R. Frog Skins Keep Redox Homeostasis by Antioxidant Peptides with Rapid Radical Scavenging Ability. Free Radic Biol Med 2010, 48, 1173–1181. [Google Scholar] [CrossRef] [PubMed]
  63. Qin, D.; Lee, W.H.; Gao, Z.; Zhang, W.; Peng, M.; Sun, T.; Gao, Y. Protective Effects of Antioxidin-RL from Odorrana Livida against Ultraviolet B-Irradiated Skin Photoaging. Peptides (N.Y.) 2018, 101, 124–134. [Google Scholar] [CrossRef] [PubMed]
  64. Zhang, C.; Zhou, Y.; Yang, G.Y.; Li, S. Biomimetic Peptides Protect Cells from Oxidative Stress. Am J Transl Res 2017, 9, 5518–5527. [Google Scholar]
  65. Song, Y.; Ji, S.; Liu, W.; Yu, X.; Meng, Q.; Lai, R. Different Expression Profiles of Bioactive Peptides in Pelophylax Nigromaculatus from Distinct Regions. Biosci Biotechnol Biochem 2013, 77, 1075–1079. [Google Scholar] [CrossRef] [PubMed]
  66. Krishnan, N.; Dickman, M.B.; Becker, D.F. Proline Modulates the Intracellular Redox Environment and Protects Mammalian Cells against Oxidative Stress. Free Radic Biol Med 2008, 44, 671–681. [Google Scholar] [CrossRef] [PubMed]
  67. Kościuczuk, E.M.; Lisowski, P.; Jarczak, J.; Strzałkowska, N.; Jóźwik, A.; Horbańczuk, J.; Krzyżewski, J.; Zwierzchowski, L.; Bagnicka, E. Cathelicidins: Family of Antimicrobial Peptides. A Review. Mol Biol Rep 2012, 39, 10957–10970. [Google Scholar] [CrossRef]
  68. Feng, G.; Wei, L.; Che, H.; Shen, Y.; Mi, K.; Bian, H.; Yang, H.; Wu, J.; Mu, L. Cathelicidin-NV from Nanorana Ventripunctata Effectively Protects HaCaT Cells, Ameliorating Ultraviolet B-Induced Skin Photoaging. Peptides (N.Y.) 2022, 150. [Google Scholar] [CrossRef] [PubMed]
  69. Cao, X.; Wang, Y.; Wu, C.; Li, X.; Fu, Z.; Yang, M.; Bian, W.; Wang, S.; Song, Y.; Tang, J.; et al. Cathelicidin-OA1, a Novel Antioxidant Peptide Identified from an Amphibian, Accelerates Skin Wound Healing. Sci Rep 2018, 8. [Google Scholar] [CrossRef]
  70. Mu, L.; Tang, J.; Liu, H.; Shen, C.; Rong, M.; Zhang, Z.; Lai, R. A Potential Wound-Healing-Promoting Peptide from Salamander Skin. FASEB Journal 2014, 28, 3919–3929. [Google Scholar] [CrossRef]
  71. Lu, H.; Chai, J.; Xu, Z.; Wu, J.; He, S.; Liao, H.; Huang, P.; Huang, X.; Chen, X.; Jiang, H.; et al. Cath-KP, a Novel Peptide Derived from Frog Skin, Prevents Oxidative Stress Damage in a Parkinson’s Disease Model. Zool Res 2024, 45, 108–124. [Google Scholar] [CrossRef] [PubMed]
  72. Dong, B.J.; Zhan, Z.G.; Zheng, R.Q.; Chen, W.; Min, J.J. CDNA Cloning and Functional Characterisation of Four Antimicrobial Peptides from Paa Spinosa. Zeitschrift fur Naturforschung - Section C Journal of Biosciences 2015, 70, 251–256. [Google Scholar] [CrossRef]
  73. Chai, J.; Liu, J.; Tian, M.; Liao, H.; Wu, J.; Xie, J.; Lai, S.; Mo, G.; Chen, X.; Xu, X. Multiple Mechanistic Action of Brevinin-1FL Peptide against Oxidative Stress Effects in an Acute Inflammatory Model of Carrageenan-Induced Damage. Oxid Med Cell Longev 2022, 2022. [Google Scholar] [CrossRef] [PubMed]
  74. Wang, X.; Ren, S.; Guo, C.; Zhang, W.; Zhang, X.; Zhang, B.; Li, S.; Ren, J.; Hu, Y.; Wang, H. Identification and Functional Analyses of Novel Antioxidant Peptides and Antimicrobial Peptides from Skin Secretions of Four East Asian Frog Species. Acta Biochim Biophys Sin (Shanghai) 2017, 49, 550–559. [Google Scholar] [CrossRef] [PubMed]
  75. Liu, H.; Guo, X.; Yi, T.; Zhu, Y.; Ren, X.; Guo, R.; Dai, Y.; Liang, S. Frog Skin Derived Peptides With Potential Protective Effects on Ultraviolet B–Induced Cutaneous Photodamage. Front Immunol 2021, 12. [Google Scholar] [CrossRef]
  76. Li, X.; Wang, Y.; Zou, Z.; Yang, M.; Wu, C.; Su, Y.; Tang, J.; Yang, X. OM-LV20, a Novel Peptide from Odorous Frog Skin, Accelerates Wound Healing in Vitro and in Vivo. Chem Biol Drug Des 2018, 91, 126–136. [Google Scholar] [CrossRef] [PubMed]
  77. Wang, Y.; Cao, X.; Fu, Z.; Wang, S.; Li, X.; Liu, N.; Feng, Z.; Yang, M.; Tang, J.; Yang, X. Identification and Characterization of a Novel Gene-Encoded Antioxidant Peptide Obtained from Amphibian Skin Secretions. Nat Prod Res 2020, 34, 754–758. [Google Scholar] [CrossRef]
  78. Bian, W.; Meng, B.; Li, X.; Wang, S.; Cao, X.; Liu, N.; Yang, M.; Tang, J.; Wang, Y.; Yang, X. OA-GL21, a Novel Bioactive Peptide from Odorrana Andersonii, Accelerated the Healing of Skin Wounds. Biosci Rep 2018, 38. [Google Scholar] [CrossRef] [PubMed]
  79. Ge, L.; Lyu, P.; Zhou, M.; Zhang, H.; Wan, Y.; Li, B.; Li, R.; Wang, L.; Chen, T.; Shaw, C. AcT-2: A Novel Myotropic and Antimicrobial Type 2 Tryptophyllin from the Skin Secretion of the Central American Red-Eyed Leaf Frog, Agalychnis Callidryas. The Scientific World Journal 2014, 2014. [Google Scholar] [CrossRef]
  80. Plácido, A.; do Pais do Amaral, C.; Teixeira, C.; Nogueira, A.; Brango-Vanegas, J.; Alves Barbosa, E.; C. Moreira, D.; Silva-Carvalho, A.; da Silva, M. da G.; do Nascimento Dias, J.; et al. Neuroprotective Effects on Microglia and Insights into the Structure–Activity Relationship of an Antioxidant Peptide Isolated from Pelophylax Perezi. J Cell Mol Med 2022, 26, 2793–2807. [Google Scholar] [CrossRef]
  81. Tossi, A.; Sandri, L.; Giangaspero, A. Amphipathic,-Helical Antimicrobial Peptides; 2000; Vol. 55.
  82. Chaudhary, M.R.; Chaudhary, S.; Sharma, Y.; Singh, T.A.; Mishra, A.K.; Sharma, S.; Mehdi, M.M. Aging, Oxidative Stress and Degenerative Diseases: Mechanisms, Complications and Emerging Therapeutic Strategies. Biogerontology 2023, 24, 609–662. [Google Scholar] [CrossRef] [PubMed]
  83. Schieber, M.; Chandel, N.S. ROS Function in Redox Signaling and Oxidative Stress. Current Biology 2014, 24. [Google Scholar] [CrossRef] [PubMed]
  84. Kowalczyk, P.; Sulejczak, D.; Kleczkowska, P.; Bukowska-Ośko, I.; Kucia, M.; Popiel, M.; Wietrak, E.; Kramkowski, K.; Wrzosek, K.; Kaczyńska, K. Mitochondrial Oxidative Stress—a Causative Factor and Therapeutic Target in Many Diseases. Int J Mol Sci 2021, 22. [Google Scholar] [CrossRef] [PubMed]
  85. Bai, R.; Guo, J.; Ye, X.Y.; Xie, Y.; Xie, T. Oxidative Stress: The Core Pathogenesis and Mechanism of Alzheimer’s Disease. Ageing Res Rev 2022, 77. [Google Scholar] [CrossRef]
  86. Arfin, S.; Jha, N.K.; Jha, S.K.; Kesari, K.K.; Ruokolainen, J.; Roychoudhury, S.; Rathi, B.; Kumar, D. Oxidative Stress in Cancer Cell Metabolism. Antioxidants 2021, 10. [Google Scholar] [CrossRef]
  87. Dhapola, R.; Beura, S.K.; Sharma, P.; Singh, S.K.; HariKrishnaReddy, D. Oxidative Stress in Alzheimer’s Disease: Current Knowledge of Signaling Pathways and Therapeutics. Mol Biol Rep 2024, 51. [Google Scholar] [CrossRef] [PubMed]
  88. Gao, C.; Jiang, J.; Tan, Y.; Chen, S. Microglia in Neurodegenerative Diseases: Mechanism and Potential Therapeutic Targets. Signal Transduct Target Ther 2023, 8. [Google Scholar] [CrossRef] [PubMed]
  89. Dash, U.C.; Bhol, N.K.; Swain, S.K.; Samal, R.R.; Nayak, P.K.; Raina, V.; Panda, S.K.; Kerry, R.G.; Duttaroy, A.K.; Jena, A.B. Oxidative Stress and Inflammation in the Pathogenesis of Neurological Disorders: Mechanisms and Implications. Acta Pharm Sin B 2024. [CrossRef]
  90. Marucci, G.; Buccioni, M.; Ben, D.D.; Lambertucci, C.; Volpini, R.; Amenta, F. Efficacy of Acetylcholinesterase Inhibitors in Alzheimer’s Disease. Neuropharmacology 2021, 190. [Google Scholar] [CrossRef] [PubMed]
  91. Spinelli, R.; Aimaretti, F.M.; López, J.A.; Siano, A.S. Amphibian Skin Extracts as Source of Bioactive Multi-Target Agents against Different Pathways of Alzheimer’s Disease. Nat Prod Res 2021, 35, 686–689. [Google Scholar] [CrossRef]
  92. Spinelli, R.; Humpola, M.V.; Sanchís, I.; de los Angeles Méndez, E.; Siano, A. Biological Characterization of Natural Peptide BcI-1003 from Boana Cordobae (Anura): Role in Alzheimer’s Disease and Microbial Infections. Int J Pept Res Ther 2023, 29. [Google Scholar] [CrossRef]
  93. Sanchis, I.; Spinelli, R.; Aschemacher, N.; Humpola, M.V.; Siano, A. Acetylcholinesterase Inhibitory Activity of a Naturally Occurring Peptide Isolated from Boana Pulchella (Anura: Hylidae) and Its Analogs. Amino Acids 2020, 52, 387–396. [Google Scholar] [CrossRef] [PubMed]
  94. Sanchis, I.; Spinelli, R.; Aschemacher, N.; Siano, A.S. Rational Design and Synthesis of Modified Natural Peptides from Boana Pulchella (Anura) as Acetylcholinesterase Inhibitors and Antioxidants. Amino Acids 2022, 54, 181–192. [Google Scholar] [CrossRef] [PubMed]
  95. Jenner, P.; Olanow, C.W. Oxidative Stress and the Pathogenesis of Parkinson’s Disease. Neurology 1996, 47. [Google Scholar] [CrossRef]
  96. Dias, V.; Junn, E.; Mouradian, M.M. The Role of Oxidative Stress in Parkinson’s Disease. J Parkinsons Dis 2013, 3, 461–491. [Google Scholar] [CrossRef] [PubMed]
  97. Dorszewska, J.; Kowalska, M.; Prendecki, M.; Piekut, T.; Kozłowska, J.; Kozubski, W. Oxidative Stress Factors in Parkinson’s Disease. Neural Regen Res 2021, 16, 1383–1391. [Google Scholar] [CrossRef]
  98. Orfali, R.; Alwatban, A.Z.; Orfali, R.S.; Lau, L.; Chea, N.; Alotaibi, A.M.; Nam, Y.W.; Zhang, M. Oxidative Stress and Ion Channels in Neurodegenerative Diseases. Front Physiol 2024, 15. [Google Scholar] [CrossRef]
  99. Krueger, J.S.; Keshamouni, V.G.; Atanaskova, N.; Reddy, K.B. Temporal and Quantitative Regulation of Mitogen-Activated Protein Kinase (MAPK) Modulates Cell Motility and Invasion. Oncogene 2001, 20, 4209–4218. [Google Scholar] [CrossRef]
  100. Singh, R.; Letai, A.; Sarosiek, K. Regulation of Apoptosis in Health and Disease: The Balancing Act of BCL-2 Family Proteins. Nat Rev Mol Cell Biol 2019, 20, 175–193. [Google Scholar] [CrossRef] [PubMed]
  101. Chen, Q.; Wu, J.; Li, X.; Ye, Z.; Yang, H.; Mu, L. Amphibian-Derived Natural Anticancer Peptides and Proteins: Mechanism of Action, Application Strategies, and Prospects. Int J Mol Sci 2023, 24. [Google Scholar] [CrossRef]
  102. Glorieux, C.; Liu, S.; Trachootham, D.; Huang, P. Targeting ROS in Cancer: Rationale and Strategies. Nat Rev Drug Discov 2024, 23, 583–606. [Google Scholar] [CrossRef]
  103. Rezatabar, S.; Karimian, A.; Rameshknia, V.; Parsian, H.; Majidinia, M.; Kopi, T.A.; Bishayee, A.; Sadeghinia, A.; Yousefi, M.; Monirialamdari, M.; et al. RAS/MAPK Signaling Functions in Oxidative Stress, DNA Damage Response and Cancer Progression. J Cell Physiol 2019, 234, 14951–14965. [Google Scholar] [CrossRef] [PubMed]
  104. Hayes, J.D.; Dinkova-Kostova, A.T.; Tew, K.D. Oxidative Stress in Cancer. Cancer Cell 2020, 38, 167–197. [Google Scholar] [CrossRef] [PubMed]
  105. Najafi, M.; Goradel, N.H.; Farhood, B.; Salehi, E.; Solhjoo, S.; Toolee, H.; Kharazinejad, E.; Mortezaee, K. Tumor Microenvironment: Interactions and Therapy. J Cell Physiol 2019, 234, 5700–5721. [Google Scholar] [CrossRef]
  106. Acevedo-León, D.; Monzó-Beltrán, L.; Pérez-Sánchez, L.; Naranjo-Morillo, E.; Gómez-Abril, S.Á.; Estañ-Capell, N.; Bañuls, C.; Sáez, G. Oxidative Stress and DNA Damage Markers in Colorectal Cancer. Int J Mol Sci 2022, 23. [Google Scholar] [CrossRef]
  107. Mahalingaiah, P.K.S.; Singh, K.P. Chronic Oxidative Stress Increases Growth and Tumorigenic Potential of MCF-7 Breast Cancer Cells. PLoS One 2014, 9. [Google Scholar] [CrossRef]
  108. Luo, M.; Zhou, L.; Huang, Z.; Li, B.; Nice, E.C.; Xu, J.; Huang, C. Antioxidant Therapy in Cancer: Rationale and Progress. Antioxidants 2022, 11. [Google Scholar] [CrossRef]
  109. Schalka, S.; Silva, M.S.; Lopes, L.F.; de Freitas, L.M.; Baptista, M.S. The Skin Redoxome. Journal of the European Academy of Dermatology and Venereology 2022, 36, 181–195. [Google Scholar] [CrossRef] [PubMed]
  110. Emanuelli, M.; Sartini, D.; Molinelli, E.; Campagna, R.; Pozzi, V.; Salvolini, E.; Simonetti, O.; Campanati, A.; Offidani, A. The Double-Edged Sword of Oxidative Stress in Skin Damage and Melanoma: From Physiopathology to Therapeutical Approaches. Antioxidants 2022, 11. [Google Scholar] [CrossRef] [PubMed]
  111. Tang, X.; Yang, T.; Yu, D.; Xiong, H.; Zhang, S. Current Insights and Future Perspectives of Ultraviolet Radiation (UV) Exposure: Friends and Foes to the Skin and beyond the Skin. Environ Int 2024, 185. [Google Scholar] [CrossRef]
  112. Wang, S.; Yang, M.; Yin, S.; Zhang, Y.; Zhang, Y.; Sun, H.; Shu, L.; Liu, Y.; Kang, Z.; Liu, N.; et al. A New Peptide Originated from Amphibian Skin Alleviates the Ultraviolet B-Induced Skin Photodamage. Biomedicine and Pharmacotherapy 2022, 150. [Google Scholar] [CrossRef]
  113. Xie, C.; Fan, Y.; Yin, S.; Li, Y.; Liu, N.; Liu, Y.; Shu, L.; Fu, Z.; Wang, Y.; Zhang, Y.; et al. Novel Amphibian-Derived Antioxidant Peptide Protects Skin against Ultraviolet Irradiation Damage. J Photochem Photobiol B 2021, 224. [Google Scholar] [CrossRef] [PubMed]
  114. Yin, S.; Li, S.; Bian, W.; Yang, M.; Liu, N.; Hu, Y.; Li, X.; Wang, Y.; Li, Z.; Sun, J.; et al. Antioxidant Peptide AOP-P1 Derived from Odorous Frog Showed Protective Effects Against UVB-Induced Skin Damages. Int J Pept Res Ther 2020, 26, 557–565. [Google Scholar] [CrossRef]
  115. Yin, S.; Wang, Y.; Yang, X. Amphibian-Derived Wound Healing Peptides: Chemical Molecular Treasure Trove for Skin Wound Treatment. Front Pharmacol 2023, 14. [Google Scholar] [CrossRef]
  116. Lammi, C.; Aiello, G.; Boschin, G.; Arnoldi, A. Multifunctional Peptides for the Prevention of Cardiovascular Disease: A New Concept in the Area of Bioactive Food-Derived Peptides. J Funct Foods 2019, 55, 135–145. [Google Scholar] [CrossRef]
  117. Kim, M.J.; Chilakala, R.; Jo, H.G.; Lee, S.J.; Lee, D.S.; Cheong, S.H. Anti-Obesity and Anti-Hyperglycemic Effects of Meretrix Lusoria Protamex Hydrolysate in Ob/Ob Mice. Int J Mol Sci 2022, 23. [Google Scholar] [CrossRef]
Figure 1. Overview of how AOPs relate to reactive oxygen species (ROS), as well as neurodegenerative diseases and age-related conditions (cardiovascular disease and cancer). A. AOPs are predominantly free radical scavengers and therefore inhibitors of free radicals. This property is attributed to some amino acids such as Trp, Tyr, Phe, Pro, His, and Pro, which are constituents within their sequences. However, other AMPs may present different mechanisms of action. B. Free radical scavenging is an important feature, as excess ROS can lead to detrimental consequences at the level of organelles, biomolecules, and signaling pathways, such as: a. Mitochondrial dysfunctions, b. Unregulated MAPK signaling pathways, c. DNA damage and apoptosis, d. Protein modifications, e. Overwhelmed antioxidant systems, f. Oxidative cell death, g. Lipid peroxidation, but also other unmentioned alterations causing an imbalance in cellular homeostasis. C. These perturbations and alterations are directly involved in the development of human diseases (Alzheimer’s disease (AD), Parkinson’s disease (PD), Huntington’s disease (HD), amyotrophic lateral sclerosis (ALS), UV skin damage and wound healing, cardiovascular diseases, and cancer). Preventing such consequences is therefore important for the treatment or prevention of diseases related to oxidative stress. AD, PD, and UV skin damage and wound healing are conditions for which some amphibian AOPs have already been tested. HD, ALS, and cardiovascular diseases are some medically important oxidative stress-related diseases for which amphibian AOPs could have the potential to act. Cancer is a disease for which antioxidants could theoretically be an adjuvant treatment, and although those described so far do not show any importance as a therapy, it is crucial to evaluate the potential of new molecules that could lead to different results.
Figure 1. Overview of how AOPs relate to reactive oxygen species (ROS), as well as neurodegenerative diseases and age-related conditions (cardiovascular disease and cancer). A. AOPs are predominantly free radical scavengers and therefore inhibitors of free radicals. This property is attributed to some amino acids such as Trp, Tyr, Phe, Pro, His, and Pro, which are constituents within their sequences. However, other AMPs may present different mechanisms of action. B. Free radical scavenging is an important feature, as excess ROS can lead to detrimental consequences at the level of organelles, biomolecules, and signaling pathways, such as: a. Mitochondrial dysfunctions, b. Unregulated MAPK signaling pathways, c. DNA damage and apoptosis, d. Protein modifications, e. Overwhelmed antioxidant systems, f. Oxidative cell death, g. Lipid peroxidation, but also other unmentioned alterations causing an imbalance in cellular homeostasis. C. These perturbations and alterations are directly involved in the development of human diseases (Alzheimer’s disease (AD), Parkinson’s disease (PD), Huntington’s disease (HD), amyotrophic lateral sclerosis (ALS), UV skin damage and wound healing, cardiovascular diseases, and cancer). Preventing such consequences is therefore important for the treatment or prevention of diseases related to oxidative stress. AD, PD, and UV skin damage and wound healing are conditions for which some amphibian AOPs have already been tested. HD, ALS, and cardiovascular diseases are some medically important oxidative stress-related diseases for which amphibian AOPs could have the potential to act. Cancer is a disease for which antioxidants could theoretically be an adjuvant treatment, and although those described so far do not show any importance as a therapy, it is crucial to evaluate the potential of new molecules that could lead to different results.
Preprints 142656 g001
Figure 2. Molecular inhibition mechanism of peptide W3 against acetylcholinesterase (AChE). Peptide W3 is a potent inhibitor of AChE and an analogue of peptide LL, identified from the frog Boana pulchella (amphibian). Molecular docking shows that the Trp-3 residue at the N-terminus of peptide W3 generates π–π stacking interactions with the aromatic residues (Tyr-121, Trp-279, and Tyr-334) of the peripheral anionic site (PAS) of AChE.
Figure 2. Molecular inhibition mechanism of peptide W3 against acetylcholinesterase (AChE). Peptide W3 is a potent inhibitor of AChE and an analogue of peptide LL, identified from the frog Boana pulchella (amphibian). Molecular docking shows that the Trp-3 residue at the N-terminus of peptide W3 generates π–π stacking interactions with the aromatic residues (Tyr-121, Trp-279, and Tyr-334) of the peripheral anionic site (PAS) of AChE.
Preprints 142656 g002
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
Copyright: This open access article is published under a Creative Commons CC BY 4.0 license, which permit the free download, distribution, and reuse, provided that the author and preprint are cited in any reuse.
Prerpints.org logo

Preprints.org is a free preprint server supported by MDPI in Basel, Switzerland.

Subscribe

© 2026 MDPI (Basel, Switzerland) unless otherwise stated

Accessibility

Disclaimer

Terms of Use

Privacy Policy

Privacy Settings