Preprint
Article

This version is not peer-reviewed.

Systems Biology of Recombinant 2G12 and 353/11 mAb Production in CHO-K1 Cell Lines at Phosphoproteome Level

A peer-reviewed version of this preprint was published in:
Proteomes 2025, 13(1), 9. https://doi.org/10.3390/proteomes13010009

Submitted:

11 November 2024

Posted:

12 November 2024

You are already at the latest version

Abstract
Chinese hamster ovary (CHO) cells are extensively used in the pharmaceutical industry for producing complex proteins, primarily because of their ability to perform human-like post-translational modifications. However, the efficiency of high-quality protein production can vary significantly for mAb producing cell lines, within the CHO host cell lines or by extrinsic factors. To investigate the complex cellular mechanisms underlying this variability, a comprehensive phosphoproteomics analysis was performed using label-free quantitative liquid chromatography after a phospho-peptide enrichment of recombinant CHO-cells producing two different antibodies and a tunicamycin treatment experiment. Using MaxQuant and Perseus for data analysis, we identified 2109 proteins and quantified 4059 phosphosites. Significant phosphorylation dynamics were observed in nuclear proteins of cells producing the difficult-to-produce 2G12 mAb. It suggests that the expression of 2G12 regulates nuclear pathways based on up- and down-regulation of phosphorylation sites. Furthermore, a substantial number of changes in the phosphorylation pattern related to tunicamycin treatment has been detected.TM treatment affects, among other phosphoproteins, the eukaryotic elongation factor 2 kinase (Eef2k). It alters the phosphorylation landscape of key proteins involved in cellular processes including DNA methylation, highlighting the mechanisms behind stress-induced cellular responses.
Keywords: 
;  ;  ;  ;  

1. Introduction

Chinese hamster ovary (CHO) cells are the leading mammalian cell culture system in biomanufacturing, used in 95 of 107 distinct biopharmaceutical products, making up about 89% of all mammalian cell-derived products [1]. The analysis of the cellular proteome has enabled researchers to precisely identify, study, and quantify thousands of proteins from complex samples [2]. This approach bridges the gap to genomic data, offering insights into how genes translate into protein expression and will elucidate the activity within biological systems [2]. The first proteome study in CHO-K1 cells, identified over 6000 expressed proteins [3] and since then we have profoundly enhanced our understanding of protein expression dynamics in CHO cells [4,5,6,7,8,9,10,11,12,13,14,15,16,17] Furthermore, the analysis of the cellular phosphoproteome will provide essential information on protein regulation, signaling pathways, and cellular responses to various stimuli through the analysis of phosphorylation sites [18].
Given the importance of CHO cells, a deeper understanding of their molecular mechanisms is essential, particularly in analyzing phosphoproteome alterations caused by production of complex biomolecules like monoclonal human antibodies, which remains inadequately explored. To our knowledge, there are a limited number of published studies on phosphoproteomics approaches in CHO cells [10,13,19,20,21,22].
Protein phosphorylation is a key posttranslational modification (PTM) and plays a cardinal role in regulating, switching on/off, and modulating most biological processes [23,24]. It is projected that approximately 30% of all proteins expressed in eukaryotic cells are phosphorylated at some point during their existence [25,26]. Nevertheless, only about 2-3% of all eukaryotic genes are believed to encode protein kinases [27,28].
The identification of the phosphoprotein vitellin in 1906 by [29], its first isolation and purification by [30] and first demonstration of protein kinase activity [31], marked a pivotal advancement in the field. Kinases catalyze the transfer of the gamma-phosphate from ATP or GTP to the acceptor hydroxyl residue, typically serine, threonine, or tyrosine, of a protein substrate [32,33]. This process, known as phosphorylation, is crucial for regulating various cellular activities, including metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation [34]. Phosphorylation and dephosphorylation of serine, threonine, and tyrosine residues are ubiquitous and fundamental in eukaryotic signaling [35,36]. The attachment of a phosphate group leads to an increase in protein mass by 80 Daltons (the added mass of the phosphate group) [37,38,39,40] or multiple of 80 Da for multiple sites [41,42], but the low stoichiometric [43] or substoichiometric abundance [44] of many phosphopeptides demands for phosphopeptide enrichment to distinguish them from the high concentrations of non-phosphorylated peptides.
In our study, we performed a comparative analysis of the phosphoproteomic profiles utilizing label-free quantification by mass spectrometry (LFQ-MS) of two CHO cell lines that express two different monoclonal antibodies (difficult-to-produce 2G12 and easy-to produce 353/11) as well as tunicamycin-treated 353/11 CHO cell line and untreated 353/11 CHO cell line (Figure 1). The effects of tunicamycin (TM), a compound that is known to inhibit N-linked glycosylation [45,46] were additionally analyzed as a research tool to induce endoplasmic reticulum (ER) stress and to activate the unfolded protein response (UPR) [47,48,49]. It functions as an inhibitor of N-acetylglucosamine-1-phosphate transferase (GPT), thereby obstructing the initial step of glycoprotein biosynthesis [50].
In a prior study, we performed an extensive proteomic analysis to establish a baseline understanding of the cellular proteome [12]. The results showed an increase in the abundance of proteins associated with protein folding mechanisms in low producer compared to high producer cell line. Further, Hspa9 and Dnaja3 were observed as candidates activated by the mitochondria UPR and play important roles in protein folding processes in mitochondria. We identified a significant increase in the abundance of Nedd8 and Lgmn proteins in similar levels which may contribute to UPR stress. Our findings elucidated that the first comparison between 2G12 (low producer) and 353/11 (high producer), monoclonal antibody production was delineated as an intrinsic factor, whereas in the second comparison, 353/11_TM (high producer treated with TM) and 353/11 (high producer), tunicamycin functioned as an extrinsic factor influencing the modulation of protein production. Building upon this foundation, our current research aims to understand the differences in phosphoproteomics profiles between high and low producer cell lines. Specifically, we aim to identify and compare phosphorylation patterns that contribute to variations in cellular productivity. Furthermore, we investigate how tunicamycin-induced endoplasmic reticulum (ER) stress influences cellular responses, with a specific focus on the unfolded protein response (UPR). This analysis aims to reveal the molecular mechanisms governing cellular responses to ER stress and their implications for protein production and overall cellular function at phosphorylation level.

2. Materials and Methods

The creation of isogenic CHO cell lines for producing human IgG1 antibodies was previously described by Schwaigerlehner et al. [51]. Additionally, a comprehensive experimental setup for analyzing the cellular proteome was provided in a subsequent study from Sulaj et al. [12]. The cells were maintained in chemically defined CD-CHO medium (Gibco, no. 10743-029, Grand Island, NY, USA), supplemented with 4 mM L-glutamine (Roth, no. 9183.1, Karlsruhe, Germany) 15 mg/L phenol red (Sigma-Aldrich, no. P0290, Schnelldorf, Germany), and 2 μM ganciclovir (GCV) (Sigma-Aldrich, no. G2536-100MG, Schnelldorf, Germany). As described in [12,51], the cells were grown in suspension culture using a semi-perfusion process in 50 mL vent cap spin tubes (Corning, no. 431720, Corning, NY, USA) within an ISF-X shaker (Kühner, Basel, Switzerland). Incubation conditions were set at 37°C, 80% humidity, 5% CO2, and 220 rpm, ensuring consistent growth and a uniform physiological state. The cultures were seeded at a viable density of 0.5 × 106 viable cells/mL. To ensure optimal cell viability and procedural consistency, the culture medium was refreshed daily.
Among the cell lines, 353/11 exhibited high production levels, contrasting with lower production levels observed in 2G12. Cell line 353/11, was treated separately with tunicamycin (TM) (Sigma-Aldrich, no. T7765, Schnelldorf, Germany) for induction of endoplasmic reticulum (ER) stress. To prepare phosphoproteomics samples, cell cultures were harvested on day six. At the time of sampling, the average viable cell density reached 4×107 cells/mL, with viabilities consistently maintained at approximately 99%. Samples were harvested 4 hours after medium exchange to synchronize sampling across all cultivars and for inducing mild stress, one set of samples (353/11) was treated with 1 µg/mL TM in fresh medium also for four hours. Cells suspensions were centrifuged at 1300 rpm for 7 minutes at room temperature, washed twice in PBS buffer, and stored at -80°C.

2.1. Protein In-Solution Digestion and Peptide Desalting

To prepare for in-solution protein digestion, samples were processed as described previously [12]. Each cell pellet consisting of 2 x 106 cells, was resuspended in a 200 µL solution composed of 50 mM tetraethylammonium bromide (TEAB) (Sigma-Aldrich, no. T7408, Schnelldorf, Germany) and 8 M urea buffer (pH 8.0) (Sigma-Aldrich, no. 51456, Schnelldorf, Germany). The mixture was transferred to a new low protein binding microcentrifuge tube (Thermo Fisher Scientific, no. 88379, Rockford, IL, USA), followed by the addition of 2 µL protease and phosphatase inhibitor cocktail (EDTA-free) (Thermo Fisher Scientific, no. 78443, Rockford, IL, USA).
The samples underwent lysis in an ice-cold Branson 2510 ultrasonic bath (Emerson Electric, Saint Louis, MO, USA) for 30 minutes at a frequency of 40 kHz. Afterwards, the samples were diluted with an additional 200 µL of 50 mM TEAB and centrifuged at 2500x g for 30 minutes at 4 °C. The protein concentration of the supernatant was determined using the Micro BCA™ Protein Assay Kit (Thermo Fisher Scientific, no. 23235, Rockford, IL, USA). Reduction was achieved by adding 2 µL of 1 M dithiothreitol (DTT) (Thermo Fisher Scientific, no. 20291, Rockford, IL, USA) and incubating at 37 °C for 60 minutes on a rotating shaker. The samples were then alkylated with 500 mM iodoacetamide (IAA) (Thermo Fisher Scientific, no. 90034, Rockford, IL, USA) for 30 minutes at 27 °C in the dark, followed by quenching with 414 µL of 50 mM TEAB.
For in-solution digestion, 15 µL (at a 30:1 protein/protease w/w ratio) of Trypsin/Lys-C Protease Mix, MS Grade (Thermo Fisher Scientific, no. A40009, Rockford, IL, USA) was added and the samples were incubated overnight on a shaker at 37 °C. Finally, the digestion process was terminated with the addition of 25% trifluoroacetic acid (TFA) (Thermo Fisher Scientific, no. 28904, Rockford, IL, USA) and the resulting peptides were rapidly dried using a Concentrator plus speed vacuum system (Eppendorf, Hamburg, Germany).
Peptide desalting was performed using Pierce™ Peptide Desalting Spin Columns (Thermo Fisher Scientific, no. 89852, Rockford, IL, USA) per the manufacturer's instructions. The columns were equilibrated by centrifugation at 5,000 × g for 1 minute to remove the storage buffer, then equilibrated with two washes of 0.1% trifluoroacetic acid (TFA) in 80% acetonitrile (ACN), followed by two washes with 0.1% TFA. Peptides were reconstituted in 300 µL of 0.1% TFA, loaded onto the columns, and centrifuged at 3000× g for 1 minute. After two washes with 0.1% TFA, phosphopeptides were eluted with 0.1% TFA in 80% ACN and vacuum dried.

2.3. Phosphopeptide Enrichment

Phosphopeptides were selectively enriched using the High-SelectTM TiO2 Phosphopeptide Enrichment Kit (Thermo Fisher Scientific, no. A32993, Rockford, IL, USA). To prepare the column, a Centrifuge Column Adaptor was placed into a new 2 mL low protein binding microcentrifuge tube and a TiO2 Spin Tip was inserted into the adaptor. The column was conditioned with 20 μL of Wash Buffer and centrifuged at 3000× g for 2 minutes, followed by 20 μL of Binding/Equilibration Buffer and another centrifugation at 3000× g for 2 minutes. To bind phosphopeptides, the equilibrated TiO2 Spin Tip and adaptor were transferred into a new 2 mL low protein binding microcentrifuge tube. Desalted, dried peptides were dissolved in 150 µL of Binding/Equilibration Buffer and applied to the spin tip and centrifuged at 1000× g for 5 minutes. The sample from the microcentrifuge tube was reapplied twice to the spin tip to increase phosphopeptide yield. Subsequently, the column was washed with 20 μL of LC-MS grade water (Thermo Fisher Scientific, no. 51140, Rockford, IL, USA) (autoclaved reverse osmosis (RO) water). The bound phosphopeptides were eluted using 50 µL of Phosphopeptide Elution Buffer, with two rounds of centrifugation at 1000× g for 5 minutes each. Subsequently, the eluate was promptly vacuum dried.

2.4. LC-MS/MS Analysis

For the nano LC, an UltiMate™ 3000 RSLCnano System (Dionex, Thermo Fisher Scientific, California, USA) was employed. The mass spectrometry analysis was conducted using an Orbitrap Q Exactive Plus™ instrument (Thermo Fisher Scientific, Illinois, USA). Peptide samples were pre-concentrated using a µ-pre-column with dimensions of 300 µm inner diameter (I.D.), 5 µm particle size, and 100 Å pore size (Thermo Fisher Scientific, Illinois, USA). Separation was achieved using a 50 cm Acclaim PepMap™ 100 C18 column 50 cm x 75 µm, 2 µm (Thermo Fisher Scientific, Illinois, USA). The flow rate was maintained at 300 nL/min. Mobile Phase A consisted of ultrapure water with 0.1% (v/v) formic acid, and Mobile Phase B consisted of 80% acetonitrile with 0.08% (v/v) formic acid. The gradient was programmed to transition from 3% to 40% Mobile Phase B over 77 minutes, followed by an increase to 95% in 2 minutes, and maintained at 95% B for 17 minutes for washing.
The mass spectrometer (MS) was operated in positive ion mode utilizing data-dependent acquisition (DDA). The settings were as follows: spray voltage at 2 kV, capillary temperature at 275 °C, and a mass range of 375 - 1500 m/z with a resolution of 70000 for MS spectra. The automatic gain control (AGC) target was set to 1e6 with a maximum ion accumulation time of 50 ms. For MS/MS spectra, up to the top 15 precursor ions (charge states 2-6) were selected with a resolution of 17500. The dynamic exclusion duration was 50 seconds, and the isolation window was set to 2.0 m/z. Lock masses at 445.12003 m/z and 391.28429 m/z were used to ensure mass accuracy.

2.5. Data Processing LC-MS/MS

Label-free quantification (LFQ) of phosphoproteomics was analyzed using data files (RAW format) in MaxQuant software version 2.0.3.1. The workflow was based on a previously published paper [12] and adjusted according to guidelines provided by the software's developers [52]. Samples were clustered into three sample groups: 2G12, 353/11, and 353/11_TM with four biological replicates for each sample group. In MaxQuant, the following parameters were applied: the type was set to "Standard" for LFQ; multiplicity was set to “1” (indicating no isotopic labeling was used). Variable modifications included: oxidation of methionine (Oxidation (M)), N-terminal acetylation (Acetyl (Protein N-term)), and phosphorylation of serine, threonine, and tyrosine (Phospho (STY)). Fixed modification included: carbamidomethylation of cysteine (Carbamidomethyl (C)). The digestion mode was set to “Trypsin/P” with a maximum of two missed cleavages. The minimum number of peptides required for a protein to be included in pairwise comparisons between samples was set to two (min. ratio count: 2) and the normalization type was set to “Classic.” To ensure stringent identification confidence, a false discovery rate (FDR) of 1 % was applied to peptide spectral matches (PSM), site decoy matches, protein and peptide identifications. MS/MS spectra were searched using MaxQuant with its proprietary peptide database search engine Andromeda [53], against databases comprising 58083 entries for C. griseus (UniProtKB id: 10029, downloaded on April 12, 2023) and 88534 entries for M. musculus (UniProtKB id: 10090, downloaded on April 12, 2023). The MS phosphoproteomics data have been deposited to the ProteomeXchange Consortium via the PRIDE (Perez-Riverol et al. 2022) partner repository with the dataset identifier PXD055200.

2.6. Bioinformatics Analysis

The statistical analysis was performed using Perseus platform version 2.0.6.0, following the detailed guidelines outlined in the original publications by its developers [54,55]. We filtered the "Phospho (STY)Sites.txt" file to remove phosphosite entries labeled as "reverse", "potential contaminants," and we retained only Class I phosphosites with a probability score greater than 0.75 (localization probability filter > 0.75) indicating a high confidence score measuring the accuracy of identifying and localizing a specific phosphorylation site on a peptide. With the "expand site" function data were log2-transformed (Table S1). A categorical annotation was implemented to classify the data columns into their respective groups: 2G12, 353/11, and 353/11_TM. We required a minimum of 3 non-missing values per site in at least one sample group. Sites that did not meet this criterion were excluded. Missing values were imputed using the “replace missing values from normal distribution" function in total matrix mode, applying a downshift of 1.8 times the standard deviation and a width of 0.3 times the standard deviation of the dataset.
Following the successful identification of phosphosites, a two-sample t-test was performed between the columns corresponding to the groups 2G12 versus 353/11 as well as 353/11_TM versus 353/11. Statistical significance of differentially regulated phosphosites was determined by applying a Benjamini-Hochberg False Discovery Rate (BH-FDR) correction, with a significance threshold set at q < 0.05 (Table S2). Table S2 is a refined subset of Table S1 derived from the "Phospho (STY) Sites.txt" output file from MaxQuant and includes only the phosphosites identified as significant in our comparative analysis of sample groups representing different cell lines and TM treatments. Each entry ID (phosphosite) in the dataset was further characterized using the Perseus platform, incorporating gene annotations from multiple sources, including Gene Ontology (GO), Kyoto Encyclopedia of Genes and Genomes (KEGG), Pfam, Gene Set Enrichment Analysis (GSEA), Keywords, CORUM and other UniProt databases (Table S2). This annotation process leveraged databases for C. griseus and M. musculus to maximize the comprehensiveness of annotations across the dataset.
We analyzed the gene ontologies of the differentially expressed phosphosites using ShinyGO 0.80 [56] (Tables S3–S8), with the ten most statistically significant terms being afterward visualized. The x-axis of the resulting plots represents the ratio of enriched genes associated with a specific GO term to the total number of genes in the organism annotated with that term. The results were cross-validated through a literature check with the help of other enrichment analysis tools, such as the Database for Annotation, Visualization, and Integrated Discovery as described before [57,58], (DAVID version 2021) and Metascape [59]. We performed term annotations using ShinyGO with STRING v11.5, applying the M. musculus database for the 353/11_TM vs. 353/11 comparison and the C. griseus database for the 2G12 vs. 353/11 comparison. Due to fewer GO annotations for C. griseus compared to M. musculus, this selection of databases was designed to increase the rigor of our analyses, particularly for tunicamycin, to provide more detailed insights. Furthermore, network analysis of the most significantly enriched terms associated with phosphoproteins across the two comparisons was performed (Tables S9 and S10). This analysis involved constructing and visualizing networks to illustrate the relationships and functional associations among the top enriched terms using a false discovery rate (FDR) cut-off of 0.05 and an edge cut-off of 0.3 via the ShinyGO tool. The top 15 terms were selected based on their FDR values, with the 'remove redundancy' option applied to remove similar terms. For both tables (Tables S9 and S10) the analysis was performed using the C. griseus database. By integrating and mapping these terms, we aimed to uncover underlying biological themes and interactions within the phosphoproteomic data, providing a comprehensive understanding of the functional implications of the identified phosphoproteins.

2.7. Computing Resources

Data processing was conducted using a high-performance Linux computing cluster comprising seven nodes running CentOS 6.7 and CentOS 7 operating systems (Copyright 2024 The CentOS Project; https://www.centos.org/). Each node was equipped with either 24 cores at 2.6 GHz or 32 cores at 3.3 GHz and supported a maximum RAM capacity of 1 TB.

3. Results and Discussion

3.1. Quantative Phosphoprotemics Profiling Reveals Diferences

The phosphoproteomics workflow applied in this study is illustrated in Figure 1. The dynamic changes in the phosphoproteome and proteome of CHO cells remain largely unexplored and insufficiently characterized, with only a handful of studies performed each year over the past decade. To address this gap, we conducted a comprehensive phosphoproteome analysis of mAb producing CHO-K1 cell lines, aiming to deepen our understanding of this regulatory network and contribute to the growing body of comparable data in this field. We identified 2109 proteins and quantified 4059 phosphosites in our CHO samples (Table S1). Our analysis highlights molecular differences between the 2G12 (low producer) and 353/11 (high producer) groups, recognizing monoclonal antibody production as an intrinsic factor for phosphoproteomic differences. Furthermore, we investigate the differences between the 353/11_TM (high producer treated with TM) and 353/11 (high producer) groups, where tunicamycin acts as an extrinsic factor influencing cellular homeostasis. The number of identified phosphosites aligns with results from other studies on phosphoproteins in CHO cells [19,22]. Among the quantified phosphosites, 1938 were single phosphorylation sites (multiplicity of 1), 1647 were double phosphorylation sites (multiplicity of 2), and 474 had three or more phosphorylation sites (multiplicity of 3). The varying degrees of phosphorylation suggest that different levels of phosphorylation can lead to distinct regulatory effects and biological outcomes [26,60].
The analysis of phosphorylated residues revealed that serine (S) is the most frequently phosphorylated amino acid, with 3744 phosphosites, followed by threonine (T) with 305 phosphosites, and tyrosine (Y) with 10 phosphosites. This distribution is attributable to the high prevalence of protein kinases specific to serine and threonine residues (Ser/Thr kinases) [61], which constitute 80% of known kinases [62]. Historical autoradiography measurements estimated the ratios of phosphorylated serine (S), threonine (T), and tyrosine (Y) residues as 90:10:0.05 [61,63]. In our analysis, we observed proportions of 92.20%, 7.51%, and 0.29% for S, T, and Y phosphosites, respectively highlighting the predominant occurrence of serine and threonine phosphorylation compared to tyrosine phosphorylation within the dataset.
To examine the differences in phosphosites in the 2G12 vs. 353/11 and 353/11_TM vs. 353/11 comparison groups, a two-sample t-test was conducted, correcting for multiple comparisons using the Benjamini-Hochberg False Discovery Rate (BH-FDR) method, with a significance threshold of q-value < 0.05. Detailed statistical data for each phosphosite are provided in Table S2. Notably, out of 4059 phosphosites across all three groups, 2G12, 353/11 and 353/11_TM, only 74 were statistically significant. Specifically, 53 significant phosphosites were identified between the 2G12 (low producer) and 353/11 (high producer) groups, while 26 significant phosphosites were found between the 353/11_TM (high producer treated with TM) and 353/11 (high producer) groups (Figure 2) (Table S2).
To better depict the variations among the 74 significantly identified phosphosites, we performed Z-score normalization and then conducted hierarchical clustering for visualization in a heatmap (Figure 3). Rows within the same color cluster show similar phosphorylation levels, with colors showing either increases or decreases in z-scores reflecting coordinated regulatory responses. Phosphosites represented in orange (increased Z-scores), indicate enhanced phosphorylation whereas phosphosites shown in light blue (decreased Z-scores) signify reduced phosphorylation. The interplay of these different levels of phosphorylation not only serves as a critical mechanism for switching protein function but also introduces a layer of complexity through these phosphorylation sites, allowing for sophisticated combinatorial regulation and fine-tuning of protein activities and their associated modifications [64]. Particularly, the 2G12 group forms a distinct cluster in the upper left quadrant, characterized predominantly by lower occupancy levels for many phosphosites. This decrease in phosphorylation abundance distuingwishes 2G12 from the other two groups, indicating a less active cellular environment. In contrast, the 353/11_TM group displays a pronounced increase in phosphorylation abundance, with many sites showing significantly higher abundance levels compared to 2G12. Phosphosites such as A0A8C2M783 (Srrm1) (Serine/arginine repetitive matrix protein 1) and Q9QXP3 (High mobility group protein HMG-I/HMG-Y) show an increase in phosphorylation. The 353/11 group, while more similar to 353/11_TM, shows an intermediate expression profile, with a mix of high and low phosphorylation across different proteins. This suggests that 353_11 expression may represent a transitional state, in which cellular processes are moderately active or even more balaced than in the other groups but not as elevated as in 353/11_TM. Phosphosites shown in the heatmap provide valuable insights into the underlying molecular mechanisms specific to each group, defined by their correlation with protein synthesis and cellular regulatory changes induced by TM treatment.

3.2. Gene Ontology Enrichment Analyses

Enrichment analysis of phosphoproteins with altered abundance was performed using Gene Ontology (GO) analysis via ShinyGO (version 0.80) [56]. To ensure a focused analysis of the most relevant findings, we selected the top 10 most statistically significant terms from each comparison. These terms are presented in Figure 4 as a bar graph, describing the Gene Ontology (GO) terms. Data curation was facilitated by the use of several other tools, including Database for Annotation, Visualization, and Integrated Discovery as described before [57,58], (DAVID version 2021) and Metascape [59] to improve cross-referencing with existing literature and increase the robustness of the analysis. The respective tools are accessible online at (http://bioinformatics.sdstate.edu/go/), (https://david.ncifcrf.gov/tools.jsp) and (https://metascape.org). ShinyGO (version 0.80) was utilized according to the developers' recommendations, with a false discovery rate (FDR) cutoff of 0.05, a minimum pathway size of 2, and annotation sources based on STRING [65] version 11.5 or Ensembl [66] release 104 databases. The data in Figure 4 are detailed in Tables S3–S8.
To gain deeper insights into phosphoproteins and their biological effects, we performed the Gene Ontology (GO) analysis encompassing biological processes (BP), molecular functions (MF), and cellular components (CC). Figure 4 illustrates the GO analyses of both comparisons: the mAb2G12 expression (Fig. 4a, 4c, 4e) as intrinisic factor and the TM treatment as extrinsic factor (Fig. 4b, 4d, 4f). The length of each bar represents the gene ratio (nGenes/PathwayGenes) associated with the corresponding enriched term. The color coding reflects the varying degrees of statistical significance among the enriched terms, with blue indicating the highest significance (low FDR values) and orange representing relatively lower significance (higher, but statistically significant, FDR values).
Figure 4a,b and Tables S3 and S4 show analyses focusing on “biological processes”. In the case of 2G12 as the factor of our comparison (2G12 vs. 353/11), 14 terms were identified as being regulated. Most of them are related to gene transcription, RNA maturation and biochemical reactions and pathways involving long unbranched macromolecules formed from ribonucleotides. Studies suggest that phosphorylation may play a role and modulate protein-protein interactions within the spliceosome [67]. The main players identified in these terms and regulated by factor 2G12 expression are Hnrnpk, Taf2, Utp18, Rbm39, Srrm1, Farsa, Usp39, Nol11, Smarca4, Wdr55, Iws1 and Nolc1. In the case of TM treatment as a factor in the comparison between 353/11_TM and 353/11, we found BP terms characterising the TOR signalling pathway, the cellular development pathway, spine morphogenesis or cellular size or growth of axons, as well as modification of phosphorylation by a protein as a modulator. These terms indicate a broad spectrum of cell biological changes induced by TM treatment with regulated phosphoproteins such as Rps6, Larp1, Ehmt2, Dbnl, Hsp90ab1, Smarca4, Map1b, Nolc1, Eef2k and Tnks1bp1. The most important terms related to TM treatment are "DNA methylation on cytosine within a CG sequence", "DNA methylation on cytosine", "Response to organonitrogen compound". It is worth noting that GO terms are heavily curated to make them better/clearer in the long run. Some of these terms have recently been moved to the "MF" category by the GO consortium, but still have statistical significance.
Further Gene Ontology (GO) analyses for molecular function (MF) related to each comparison are provided in the supplementary files (Tables S5–S6) and visualized in Figure 4c,d. The GO (MF) analysis of phosphoproteins in the comparison between the 2G12 and 353/11 samples revealed significant enrichment in several key molecular functions, including “basal transcription machinery binding”, “RNA binding”, “RNA polymerase core enzyme binding”, “nucleic acid binding” and “transcription factor binding”. The GO analysis comparing the 353/11_TM and 353/11 samples demonstrated significant enrichment in “RNA binding”, “DNA polymerase binding”, “protein domain-specific binding”, “protein-containing complex binding” and “nucleic acid binding”. The effect of TM treatment was found in a variety of contexts, including binding of DNA polymerase and p53 family proteins, as well as phospholipids and altered cytoskeletal reorganisation. This again suggests a more complex effect of TM compared to 2G12 as the determining factor.
Analyses for cellular component (CC) for each comparison are included in the supplementary files (Tables S7–S8) and visualized in Figure 4e,f. The results of the GO analysis for cellular components (CC) in the comparison of significant phosphoproteins between the 2G12 and 353/11 samples indicated significant enrichment in terms related to "nuclear lumen", "membrane-enclosed lumen", "organelle lumen", "intracellular organelle lumen", "ribonucleoprotein complex, “nucleoplasm" and "spliceosomal complex". These findings suggest that the phosphoproteins in the 2G12 sample are involved in processes such as RNA processing and spliceosome assembly. In contrast, TM treatment affected cellular component-related terms such as: "non-membrane-bounded organelle", "intracellular non-membrane-bounded organelle", "site of polarised growth" and "somatodendritic compartment", often related to compartments where cell growth takes place. In addition, nuclear chromatin, heterochromatin and perichromatin terms are highlighted after TM treatment describing the different sites at which tunicamycin acts.
Altogether, GO term analysis identified that the factor difficult to express mAb 2G12 acts predominantely the transcription machinary in the cellular nucleus while the factor tunicamycin treatment influences various processes like morphogenesis, growth, the p53 family of proteins and chromatin structures, either in the cytosole or in the nucleus. Nicely described are all such complex interactions by the term “TOR (target of rapamycin) signalling”. TOR and its mammalian ortholog mTOR are serine-threonine kinases that sense growth factors, the cellular nutrient- or oxygen status and promote appropriate changes in cell growth and proliferation, cell survival, and protein synthesis. TOR signalling has key roles in cancer and autophagy and other cellular pathways.

3.3. Dynamics of Phosphorylation in the Two Different CHO Cell Lines That Produce the Antibodies

Network analysis enrichment of terms related to significant (phospho)proteins in the comparison between 2G12 and 353/11 was performed using ShinyGO (version 0.80) (Figure 5). The significant terms are predominantly associated with the nucleus and include a wide range of terms like “basal transcription machinery binding” “spliceosomal complex”, “ribonucleoprotein complex”, “RNA metabolic process”, “RNA binding”, “nucleic acid metabolic process”, “gene expression”, “nuclear lumen”, “nucleoplasm”, “nucleus”, “intracellular organelle lumen”, “membrane-enclosed lumen” and “organelle lumen” (Table S9). A few phosphoproteins are responsible for the significance of these terms and are therefore described in more detail here.
In particular, heterogeneous nuclear ribonucleoprotein K (Hnrnpk) plays a critical role in the regulation of various cellular processes, such as RNA stability, pre-mRNA processing and transport, transcription, translation, and chromatin remodelling [68]. Our data indicate that Hnrnpk is phosphorylated at Ser116 in the 2G12 samples which has been associated with the activation of downstream signalling pathways that initiate DNA damage repair, leading to cell cycle arrest It also triggers the export of Hnrnpk protein (ribonucleoprotein complex) from the nucleus to the cytoplasm [69].
The genes responsible for regulating the term 'ribonucleoprotein complex' include these proteins: Hnrnpk, Taf2, Nop58, Utp18, Cwc27, Srrm1, Vim, Usp39 and Nolc1. In our study, Nop58, Srrm1 and Usp39 were hypophosphorylated. On the other hand, the phosphorylation of Hnrnpk, Taf2, Utp18, Cwc27, Vim and Nolc1 was increased.
We conclude that expression of 2G12 regulates nuclear pathways based on increases and decreases in phosphorylation abundances. Interestingly, regulation of phosphoprotein sites does not lead to significant differences observed in the ER stress response. It can be speculated that other regulatory factors than phosphorylation are responsible for the feedback regulation in the nucleus, although it is initiated by the maturing 2G12. Alternatively, some of the identified phosphoproteins, which are also part of the ER, may act as second messengers to modulate the transcriptional machinery.

3.4. Function of Ribosomal Proteins, DNA Methylation and Regulation of Chromatin Affected by Tunicamycin

Tunicamycin-treated samples revealed a more complex picture of phosphorylation-regulated pathways. The key terms describe DNA methylation processes, chromatin dynamics and structure, organised cellular structures with distinct morphology and function, and regulation of autophosphorylations, known as a major factor in the stress respons. Notably, the TOR (target of rapamycin) signalling pathway, which plays a critical role in many cytosolic and nuclear regulatory processes (Table S10) (Figure S1), is also regulated by mild treatment with tunicamycin.
Tunicamycin induces broad phosphoproteomic changes that affect epigenetic regulation, organelle dynamics and stress response mechanisms. In particular, phosphoproteins associated with DNA methylation at cytosine residues within CG sequences and chromatin organisation suggest that tunicamycin may affect gene expression and epigenetic modulation. In addition, the enrichment of non-membrane bound organelles and cytoskeletal components implies a reorganisation of cellular structures, likely linked to the activation of the unfolded protein response (UPR) in the context of endoplasmic reticulum (ER) stress.
Following the Gene Ontology (GO) analysis and focusing exclusively on biological processes, the term "cellular component biogenesis" was identified as one of the most significantly enriched terms due to its broad relevance regarding the organization of cellular components (Table S4). This term encompasses a list of differentially phosphorylated sites from seven proteins: Rps6, Mcm2, Cebpz, Ehmt2, Map1b, Smarca4, and Dbnl. Rps6 (ribosomal protein s6) has been shown to be part of 40s subunit [70,71] and its phosphorylation is often used as an indicator of mTORC1 activity [72].
Phosphorylation of Rps6 plays a critical role in the regulation of cell size [73], glucose homeostasis [74,75] and the function of the translation machinary in mammalian cells [76,77]. Notably, we identified all five phosphorylated residues documented by [78]: Ser235, Ser236, Ser240, Ser244 and Ser247. Remarkably, the latter three phosphoserines (Ser240, Ser244, Ser247) are separated by a single non-phosphorylated serine, as reported in the referenced study [78]. 40S ribosomal subunits have been proposed to play a role in initiating translation of specific mRNAs required for adaptation to stress[79,80], which in our case is tunicamycin-induced. Other ribosomal proteins have also been found to be regulated at the proteomic level after TM treatment [12], including the Fau ribosomal protein S30, a component of the 40S subunit. Although its overall abundance exhibited a modest decrease at comparable protein concentrations.
Two other important terms are “DNA methylation” and “DNA alkylation” and have been identified as regulated key processes. DNA methylation is a critical epigenetic mechanism involved in transcriptional silencing, while DNA alkylation plays a role in genomic regulation. Proteins such as Ehmt2 and Smarca4 are involved in these processes and are essential for regulating chromatin structure and gene expression through epigenetic modifications [81,82]. Ehmt2, also known as euchromatic histone lysine methyltransferase-2, is a histone methyltransferase that primarily methylates histone H3 at lysine 9 (H3k9me1 and H3k9me2) [83] and is generally associated with transcriptional repression. It also functions as a key regulator of heterochromatin formation and maintenance, contributing to the silencing of specific genes during development [84]. Ehmt2 also interacts with DNA methyltransferases (Dnmts), such as Dnmt3a and Dnmt3b, and facilitates the recruitment of these enzymes to specific genomic loci [85]. Smarca4, a member of the Swi/Snf chromatin remodelling complex, is an ATP-dependent chromatin remodeler that drives changes in nucleosome positioning, thereby regulating DNA accessibility [86]. This remodelling activity is crucial for enabling the recruitment of repair proteins to sites of DNA damage, including those resulting from alkylation, thereby promoting effective DNA repair mechanisms [81].
Whenever the chromatin structure is modified the protein minichromosome maintenance 2 (Mcm2) is involved, which was also found to be regulated upon tunicamycin treatment. Enrichment analysis revealed that Mcm2 is associated with enriched processes such as "chromatin" and "chromosome" (Table S10) (Figure S1). Mcm2 is part of the Mcm2-7 complex, a group of six related proteins that are essential for the initiation and elongation of DNA replication in eukaryotic cells [87]. Furthermore, phosphorylation of Mcm proteins has been shown to be crucial for the initiation of DNA replication in eukaryotic cells [88].
Collectively, these results underscore the multiple effects of tunicamycin on cellular processes and emphasise its role in modulating phosphoproteomic profiles related to epigenetics, organelle function and stress adaptation mechanisms in a more complex manner than expression of the difficult-to-produce mAb 2G12. Figure S1 also highlights the multifaceted effect of tunicamycin, indicating a broad imbalance of cells.

3.5. Identification of Phosphorylated Key Proteins under TM as an Extrinsic Stress Factor

To identify regulated phosphorylation on proteins, corresponding to TM-induced stress, we selected relevant terms from Table S4 specifically “response to stress”, “cellular response to stress”, and “response to osmotic stress” (highlighted in light blue). This analysis revealed seven phosphoproteins associated with these stress responses, namely: Eef2k, Ehmt2, Hsp90ab1, Map1b, Larp1, Tnks1bp1 and Nolc1, as listed in Table 1. Eukaryotic elongation factor 2 kinase (Eef2k) is a calcium/calmodulin-dependent enzyme that serves as a critical regulator of protein synthesis [89]. Inactivation of Eef2k (often through phosphorylation) promotes protein translation by preventing the phosphorylation of eukaryotic elongation factor 2 (eEF2), thereby allowing eEF2 to remain active and facilitate protein synthesis [90,91]. Eukaryotic elongation factor 2 (eEF2) a monomer, catalyzes the translocation of elongating ribosomes [92] relative to mRNA [93]. Eef2k activity is regulated by multiple signalling pathways, with the mammalian target of rapamycin complex 1 (mTORC1) playing a key role [94]. mTORC1 promotes the phosphorylation of Eef2k at inhibitory sites, thereby blocking Eef2k activity and leading to no phosphorylation of eEF2 and activation of translational elongation [94,95,96]. One of the commonly used indicators of mTORC1 activity [72], already discussed in this manuscript, is ribosomal protein S6 (Rps6). In TM-treated samples, we observe that Ser73 on Eef2k is phosphorylated. Under prolonged tunicamycin treatment (minimun 12h), Eef2k is typically hypophosphorylated [97] which likely serves as a mechanism to inhibit protein synthesis under stressful conditions [90], thereby helping the cell to manage the accumulation of misfolded proteins. We also observed low levels of phosphorylation of Eef2k and speculate that this is part of a more general TM response. This continuation of protein synthesis prepares the cell to subsequently increase the expression of molecular chaperones that facilitate proper protein folding and help alleviate ER stress [98]. This suggests that phosphorylation of eEF2 may interfere with or prevent eEF2 binding to the ribosome, reducing the affinity of eEF2 for ribosome complex formation and ultimately rendering it inactive in the elongation phase of translation [99,100]. Other highly enriched BP terms associated with the increase in phosphorylation for Eef2k include “positive regulation of cell morphogenesis involved in differentiation” and “regulation of protein autophosphorylation”. Additionally, the significantly enriched MF terms include “nucleic acid binding” and “translation regulator activity”.
Euchromatic histone lysine methyltransferase-2 (Ehmt2) in another paper was shown to modulate the expression of genes related to stress responses, such as those involved in apoptosis or endoplasmic reticulum (ER) stress [101]. In our data, it is found to be phosphorylated at Ser229; however, no data has been published on this specific phosphorylation site. Conversely, another study [102] has shown that phosphorylation at Ser211 is associated with mediating of the DNA damage repair.
The decrease in phosphorylation abundance of Hsp90ab1 (Heat shock protein HSP 90-beta) at Ser255 can bee seen as strongly associated with the Akt signaling pathway and has been identified as a target of the kinase Tssk4 at this position [103]. Also this position (Ser255) has also been shown to be crucial in the MAPK/ERK signaling pathway, having an essential role in cell growth and cell viability [104]. Phosphorylation at Ser255 may inhibit Hsp90ab1 ATPase activity, potentially restricting the Pi3k/Akt pathway and leading to decreased survival functions, ultimately resulting in apoptosis of the target cells [103,105]. Akt, also known as protein kinase B (Pkb) has an esssential role in preventing apoptosis and promoting cell survival [106,107]. Our analysis revealed that among the most significantly enriched BP terms associated with Hsp90ab1 included “response to organonitrogen compound”, “cell development” and “regulation of cell size”. Furthermore, the significant enriched MF terms include “Regulation of cell size”, “DNA polymerase binding”, “Protein domain specific binding” and “UTP binding”.
The observed deacrease in phosphorylation of Map1b at postion Ser1255 might have a role for Map1b in stress response or aging [108]. Changes in microtubules are thought to influence cellular responses to environmental stress, with microtubule-associated proteins playing a role in these stress mechanisms [109]. Additionally, in another study, treatment with another stressor (rapamycin) resulted in decreased phosphorylation of Map1b at Serine 1265 [110]. The proposed role of phosphorylated Map1b in maintaining microtubule integrity suggests its contribution in keeping microtubules in a dynamically unstable state [111]. We identified that among the most significantly enriched BP terms associated with the Map1b include “response to organonitrogen compound” and “regulation of cell size”. In terms of MF, the significantly enriched terms included “protein-containing complex binding”, “cytoskeletal regulatory protein binding” and “phospholipid binding”. For CC terms, the top hits were “non-membrane-bounded organelle”, “intracellular non-membrane-bounded organelle” and “site of polarized growth”.
Larp1 is found to to show an increase in phosphorylation at sites Ser735 and Ser743. Larp1 is a direct substrate of mTORC1, and its phosphorylation by mTORC1 leads to its dissociation from the 5' untranslated region (UTR) of mRNA, thereby relieving its inhibitory activity on translation [112]. We identified that the most significantly enriched BP terms associated with the Larp1 include “response to organonitrogen compound” and “TOR signaling”. Additionally, the significantly enriched MF terms include “RNA binding” and “protein-containing complex binding”. For CC terms, among the top hits were “non-membrane-bounded organelle” and “intracellular non-membrane-bounded organelle”.
Tnks1bp1 (182 kDa tankyrase-1-binding protein) was found to be phosphorylated at Ser1630. Tnks1bp1 is essential for the efficient repair of DNA double-strand breaks and is localized in both the nucleus and the cytoplasm [113]. Furthermore, Tnks1bp1 has been shown to co-immunoprecipitate with Tankyrase 1 (Tnks1) [114] a protein associated with the Wnt/β-catenin signaling pathway [115]. Among the significant enriched BP terms for Tnks1bp1 were “regulation of protein autophosphorylation” and “cellular nitrogen compound metabolic process”. Enriched MF terms include “protein domain specific binding” and “protein-containing complex binding”. For CC terms, “non-membrane-bounded organelle” and “intracellular non-membrane-bounded organelle” were the most prominent.
Nolc1 (Nucleolar and coiled-body phosphoprotein 1) is hypophosphorylated at postion Ser542 compared to non-TM treated samples. Nolc1 is predominantly found in the nucleus and is thought to play an important role in transcription and translation processes [116]. In our previuos proteomics study [12], we observed that tunicamycin (TM) did not influence the Nolc1 protein level. Consequently, we may conclude that the observed effects of NolcI are attributable solely to changes in phosphorylation levels. The significant enriched BP terms associated with Nolc1 are “cell development” and “cellular nitrogen compound metabolic process”, while the enriched MF terms were “RNA binding”, “protein domain specific binding” and “nucleic acid binding”. For CC terms, the top hits were “non-membrane-bounded organelle” and “intracellular non-membrane-bounded organelle”.

4. Conclusions

The entire proteome encompasses not only proteins but also diverse proteoforms, including those modified by post-translational modifications (such as phosphorylation or glycosylation) and other protein variants within a cell or tissue. This makes the proteome inherently more complex and dynamic than the genome, as each gene has the potential to produce multiple protein forms.
In our approach we used LFQ using quantitative LC-MS/MS to generate consistent data at both proteomics and phosphoproteomics level to minimize variability in sample handling. One limitation of this approach lies in the inherent assumption that the identification of one or two closely spaced peptides is indicative of the presence of intact proteins. This reliance may inadvertently overlook the potential for incomplete protein representation or the existence of alternative splicing variants, both of which could significantly impact the observed phosphoproteomic profile. This oversight may lead to an incomplete understanding of the phosphorylation landscape, as noncanonical phosphorylations, such as those on histidine, lysine, aspartate, and glutamate, can play crucial roles in protein function and signaling pathways. Additionally, the study primarily focused on the most abundant phosphorylations, as the quantification method used was based on the total number of MS/MS spectra corresponding to each phosphopeptide. Thus, this approach may have limited the detection of less abundant but potentially significant phosphorylations.
Our study focused on conducting a comprehensive phosphoproteomics analysis of CHO-K1 cells to enhance the understanding of complex proteome-based cellular processes affected by the production of the challenging recombinant monoclonal antibody (mAb) 2G12 as an intrinsic cellular factor.
Additionally, the effects of tunicamycin (TM) treatment—as an extrinsic stressor—were examined in CHO-K1 cells that produce the more easily manufactured mAb 353/11. The analysis identified 2109 proteins and quantified 4059 phosphosites, revealing that serine is the most frequently phosphorylated residue, followed by threonine and tyrosine, consistent with previous studies. These findings suggest that phosphorylation is predominantly regulated by serine/threonine kinases, with significant implications for various signaling pathways and biological processes. Although only 26 phosphorylation sites were regulated in TM-treated cells and 53 in the case of the different antibodies, the number of regulated pathways in TM-treated cells is higher and more complex in terms of the compartment in which the changes take place and the biological processes affected.
The study significantly expands our understanding of the complex CHO-K1 cell phosphoproteome by comparing the production of the hard-to-produce mAb 2G12 with the easy-to-produce mAb 353/11. In particular, proteins associated with the nucleus showed differential phosphorylation between the two samples, especially those involved in RNA processing and gene expression. Heterogeneous nuclear ribonucleoprotein K (Hnrnpk) and other proteins were highlighted for their roles in signaling pathways and stress response. In response to tunicamycin-induced stress, key proteins and phosphorylation sites involved in critical cellular processes such as mTORC1 signaling, protein synthesis, DNA replication, and stress response were identified. These findings provide valuable insights into the relatively unexplored field of CHO cell phosphoproteomics, with potential implications for improving cell line engineering and bioprocess optimization. The observed phosphorylation changes suggest a complex regulatory network that enables cells to adapt to external and internal stressors, underscoring potential targets for further research into cellular stress mechanisms and antibody manufacturing.

Supplementary Materials

The following supporting information can be downloaded at the website of this paper posted on Preprints.org, Table S1: Phosphoproteomic data generated using MaxQuant and Perseus; Table S2: Phosphoproteomic data sorted and showing only significant phosphosites (BH-FDR, q-value < 0.05); Table S3: Gene Ontology (GO) terms for biological process (BP) enrichment analysis (2G12 vs. 353/11); Table S4: Gene Ontology (GO) terms for biological process (BP) enrichment analysis (353/11_TM vs. 353/11); Table S5: Gene Ontology (GO) terms for biological process (MF) enrichment analysis (2G12 vs. 353/11); Table S6: Gene Ontology (GO) terms for biological process (MF) enrichment analysis (353/11_TM vs. 353/11); Table S7: Gene Ontology (GO) terms for biological process (CC) enrichment analysis (2G12 vs. 353/11); Table S8: Gene Ontology (GO) terms for biological process (CC) enrichment analysis (353/11_TM vs. 353/11); Table S9: Top terms from the enrichment plot network analysis (2G12 vs. 353/11); Table S10: Top terms from the enrichment plot network analysis (353/11_TM vs. 353/11); Figure S1: The enrichment plot network analysis comparing 353/11_TM and 353/11.

Author Contributions

Conceptualization, G.M., and R.K.; methodology, E.S., G. M. and R.K.; formal analysis, E.S.; experiments, E.S. and L.S.; resources, G.M., J.C.D., R.K.; data curation, E.S., F. S., J.C.D.; writing—original draft preparation, E.S. and G.M.; writing—review and editing, E.S., F.S G.M., J.C.D., and R.K.; visualization, E.S. and F.S. ; supervision, G.M., J.C.D., R.K.; project administration, R.K.; funding acquisition, R.K. All authors have read and agreed to the published version of the manuscript.

Funding

This research was made possible by funding from Austrian Science Fund (FWF) Projects: Complement Initiation by Pentameric and Hexameric IgMs P-34860 and Doctoral Program on Biomolecular Technology of Proteins, BioToP W1224.

Institutional Review Board Statement

Not applicable.

Data Availability Statement

Phosphoroteomics data generated in this study have been deposited via ProteomeXchange, with identifier PXD055200.

Acknowledgments

We appreciate the assistance and work of Dr. Patrick Mayrhofer in adaptation of sample preparation protocol for CHO cell extraction. We sincerely thank Dr. Corina Mayerhofer and Core-Facility at IFA-Tulln for providing sample preparation protocol and performing the mass spectrometry. We express our gratitude to Dr. Peter Sykacek for providing us with his statistical and scientific knowledge to understand the results obtained. Our thanks go to Proteomes (MDPI) for invitation of a feature paper free of charge.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Walsh, G.; Walsh, E. Biopharmaceutical benchmarks 2022. Nat Biotechnol 2022, 40, 1722–1760. [Google Scholar] [CrossRef] [PubMed]
  2. Aebersold, R.; Mann, M. Mass spectrometry-based proteomics. Nature 2003, 422, 198–207. [Google Scholar] [CrossRef] [PubMed]
  3. Baycin-Hizal, D.; Tabb, D.L.; Chaerkady, R.; Chen, L.; Lewis, N.E.; Nagarajan, H.; Sarkaria, V.; Kumar, A.; Wolozny, D.; Colao, J.; et al. Proteomic analysis of Chinese hamster ovary cells. J Proteome Res 2012, 11, 5265–5276. [Google Scholar] [CrossRef] [PubMed]
  4. Meleady, P.; Doolan, P.; Henry, M.; Barron, N.; Keenan, J.; O'Sullivan, F.; Clarke, C.; Gammell, P.; Melville, M.W.; Leonard, M.; et al. Sustained productivity in recombinant Chinese hamster ovary (CHO) cell lines: proteome analysis of the molecular basis for a process-related phenotype. BMC Biotechnol 2011, 11, 78. [Google Scholar] [CrossRef] [PubMed]
  5. Liu, Z.; Dai, S.; Bones, J.; Ray, S.; Cha, S.; Karger, B.L.; Li, J.J.; Wilson, L.; Hinckle, G.; Rossomando, A. A quantitative proteomic analysis of cellular responses to high glucose media in Chinese hamster ovary cells. Biotechnol Prog 2015, 31, 1026–1038. [Google Scholar] [CrossRef]
  6. Xu, N.; Ma, C.; Ou, J.; Sun, W.W.; Zhou, L.; Hu, H.; Liu, X.M. Comparative Proteomic Analysis of Three Chinese Hamster Ovary (CHO) Host Cells. Biochem Eng J 2017, 124, 122–129. [Google Scholar] [CrossRef]
  7. Sommeregger, W.; Mayrhofer, P.; Steinfellner, W.; Reinhart, D.; Henry, M.; Clynes, M.; Meleady, P.; Kunert, R. Proteomic differences in recombinant CHO cells producing two similar antibody fragments. Biotechnol Bioeng 2016, 113, 1902–1912. [Google Scholar] [CrossRef]
  8. Heffner, K.M.; Hizal, D.B.; Yerganian, G.S.; Kumar, A.; Can, O.; O'Meally, R.; Cole, R.; Chaerkady, R.; Wu, H.; Bowen, M.A.; et al. Lessons from the Hamster: Cricetulus griseus Tissue and CHO Cell Line Proteome Comparison. J Proteome Res 2017, 16, 3672–3687. [Google Scholar] [CrossRef]
  9. Lakshmanan, M.; Kok, Y.J.; Lee, A.P.; Kyriakopoulos, S.; Lim, H.L.; Teo, G.; Poh, S.L.; Tang, W.Q.; Hong, J.; Tan, A.H.; et al. Multi-omics profiling of CHO parental hosts reveals cell line-specific variations in bioprocessing traits. Biotechnol Bioeng 2019, 116, 2117–2129. [Google Scholar] [CrossRef]
  10. Kaushik, P.; Curell, R.V.; Henry, M.; Barron, N.; Meleady, P. LC-MS/MS-based quantitative proteomic and phosphoproteomic analysis of CHO-K1 cells adapted to growth in glutamine-free media. Biotechnol Lett 2020, 42, 2523–2536. [Google Scholar] [CrossRef]
  11. Romanova, N.; Schelletter, L.; Hoffrogge, R.; Noll, T. Hyperosmolality in CHO cell culture: effects on the proteome. Appl Microbiol Biotechnol 2022, 106, 2569–2586. [Google Scholar] [CrossRef] [PubMed]
  12. Sulaj, E.; Schwaigerlehner, L.; Sandell, F.L.; Dohm, J.C.; Marzban, G.; Kunert, R. Quantitative proteomics reveals cellular responses to individual mAb expression and tunicamycin in CHO cells. Appl Microbiol Biotechnol 2024, 108, 381. [Google Scholar] [CrossRef] [PubMed]
  13. Chang, M.; Huhn, S.; Nelson, L.; Betenbaugh, M.; Du, Z. Significant impact of mTORC1 and ATF4 pathways in CHO cell recombinant protein production induced by CDK4/6 inhibitor. Biotechnol Bioeng 2022, 119, 1189–1206. [Google Scholar] [CrossRef] [PubMed]
  14. Muller, B.; Heinrich, C.; Jabs, W.; Kaspar-Schonefeld, S.; Schmidt, A.; Rodrigues de Carvalho, N.; Albaum, S.P.; Baessmann, C.; Noll, T.; Hoffrogge, R. Label-free protein quantification of sodium butyrate treated CHO cells by ESI-UHR-TOF-MS. J Biotechnol 2017, 257, 87–98. [Google Scholar] [CrossRef]
  15. Henry, M.; Gallagher, C.; Kelly, R.M.; Frye, C.C.; Osborne, M.D.; Brady, C.P.; Barron, N.; Clynes, M.; Meleady, P. Clonal variation in productivity and proteolytic clipping of an Fc-fusion protein in CHO cells: Proteomic analysis suggests a role for defective protein folding and the UPR. J Biotechnol 2018, 281, 21–30. [Google Scholar] [CrossRef]
  16. Perez-Rodriguez, S.; Wulff, T.; Voldborg, B.G.; Altamirano, C.; Trujillo-Roldan, M.A.; Valdez-Cruz, N.A. Compartmentalized Proteomic Profiling Outlines the Crucial Role of the Classical Secretory Pathway during Recombinant Protein Production in Chinese Hamster Ovary Cells. ACS Omega 2021, 6, 12439–12458. [Google Scholar] [CrossRef]
  17. Bryan, L.; Henry, M.; Kelly, R.M.; Frye, C.C.; Osborne, M.D.; Clynes, M.; Meleady, P. Mapping the molecular basis for growth related phenotypes in industrial producer CHO cell lines using differential proteomic analysis. BMC Biotechnol 2021, 21, 43. [Google Scholar] [CrossRef]
  18. Landry, C.R.; Levy, E.D.; Michnick, S.W. Weak functional constraints on phosphoproteomes. Trends Genet 2009, 25, 193–197. [Google Scholar] [CrossRef]
  19. Schelletter, L.; Albaum, S.; Walter, S.; Noll, T.; Hoffrogge, R. Clonal variations in CHO IGF signaling investigated by SILAC-based phosphoproteomics and LFQ-MS. Appl Microbiol Biotechnol 2019, 103, 8127–8143. [Google Scholar] [CrossRef]
  20. Kaushik, P.; Henry, M.; Clynes, M.; Meleady, P. The Expression Pattern of the Phosphoproteome Is Significantly Changed During the Growth Phases of Recombinant CHO Cell Culture. Biotechnol J 2018, 13, e1700221. [Google Scholar] [CrossRef]
  21. Henry, M.; Power, M.; Kaushik, P.; Coleman, O.; Clynes, M.; Meleady, P. Differential Phosphoproteomic Analysis of Recombinant Chinese Hamster Ovary Cells Following Temperature Shift. J Proteome Res 2017, 16, 2339–2358. [Google Scholar] [CrossRef] [PubMed]
  22. Bryan, L.; Henry, M.; Kelly, R.M.; Lloyd, M.; Frye, C.C.; Osborne, M.D.; Clynes, M.; Meleady, P. Global phosphoproteomic study of high/low specific productivity industrially relevant mAb producing recombinant CHO cell lines. Current Research in Biotechnology 2021, 3, 49–56. [Google Scholar] [CrossRef]
  23. Johnson, L.N. The regulation of protein phosphorylation. Biochem Soc Trans 2009, 37, 627–641. [Google Scholar] [CrossRef] [PubMed]
  24. Hunter, T. Protein kinases and phosphatases: the yin and yang of protein phosphorylation and signaling. Cell 1995, 80, 225–236. [Google Scholar] [CrossRef]
  25. Yakubu, R.R.; Nieves, E.; Weiss, L.M. The Methods Employed in Mass Spectrometric Analysis of Posttranslational Modifications (PTMs) and Protein-Protein Interactions (PPIs). Adv Exp Med Biol 2019, 1140, 169–198. [Google Scholar] [CrossRef]
  26. Cohen, P. The regulation of protein function by multisite phosphorylation--a 25 year update. Trends Biochem Sci 2000, 25, 596–601. [Google Scholar] [CrossRef]
  27. Hubbard, M.J.; Cohen, P. On target with a new mechanism for the regulation of protein phosphorylation. Trends Biochem Sci 1993, 18, 172–177. [Google Scholar] [CrossRef]
  28. Thingholm, T.E.; Jorgensen, T.J.; Jensen, O.N.; Larsen, M.R. Highly selective enrichment of phosphorylated peptides using titanium dioxide. Nat Protoc 2006, 1, 1929–1935. [Google Scholar] [CrossRef]
  29. Levene, P.A.; Alsberg, C.L. The cleavage products of vitellin. Journal of Biological Chemistry 1906, 2, 127–133. [Google Scholar] [CrossRef]
  30. Mecham, D.K.; Olcott, H.S. An egg yolk protein containing 10% phosphorus. Fed Proc 1948, 7, 173. [Google Scholar]
  31. Burnett, G.; Kennedy, E.P. The enzymatic phosphorylation of proteins. J Biol Chem 1954, 211, 969–980. [Google Scholar] [CrossRef] [PubMed]
  32. Hanks, S.K.; Hunter, T. Protein kinases 6. The eukaryotic protein kinase superfamily: kinase (catalytic) domain structure and classification. FASEB J 1995, 9, 576–596. [Google Scholar] [CrossRef] [PubMed]
  33. Hanks, S.K.; Quinn, A.M.; Hunter, T. The protein kinase family: conserved features and deduced phylogeny of the catalytic domains. Science 1988, 241, 42–52. [Google Scholar] [CrossRef] [PubMed]
  34. Manning, G.; Whyte, D.B.; Martinez, R.; Hunter, T.; Sudarsanam, S. The protein kinase complement of the human genome. Science 2002, 298, 1912–1934. [Google Scholar] [CrossRef]
  35. Gunawardena, J. Multisite protein phosphorylation makes a good threshold but can be a poor switch. Proc Natl Acad Sci U S A 2005, 102, 14617–14622. [Google Scholar] [CrossRef]
  36. Roach, P.J. Multisite and hierarchal protein phosphorylation. J Biol Chem 1991, 266, 14139–14142. [Google Scholar] [CrossRef]
  37. Yu, L.R.; Veenstra, T.D. Characterization of Phosphorylated Proteins Using Mass Spectrometry. Curr Protein Pept Sci 2021, 22, 148–157. [Google Scholar] [CrossRef]
  38. Liao, P.C.; Leykam, J.; Andrews, P.C.; Gage, D.A.; Allison, J. An approach to locate phosphorylation sites in a phosphoprotein: mass mapping by combining specific enzymatic degradation with matrix-assisted laser desorption/ionization mass spectrometry. Anal Biochem 1994, 219, 9–20. [Google Scholar] [CrossRef]
  39. Yip, T.T.; Hutchens, T.W. Mapping and sequence-specific identification of phosphopeptides in unfractionated protein digest mixtures by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry. FEBS Lett 1992, 308, 149–153. [Google Scholar] [CrossRef]
  40. Stensballe, A.; Andersen, S.; Jensen, O.N. Characterization of phosphoproteins from electrophoretic gels by nanoscale Fe(III) affinity chromatography with off-line mass spectrometry analysis. Proteomics 2001, 1, 207–222. [Google Scholar] [CrossRef]
  41. Mann, M.; Ong, S.E.; Gronborg, M.; Steen, H.; Jensen, O.N.; Pandey, A. Analysis of protein phosphorylation using mass spectrometry: deciphering the phosphoproteome. Trends Biotechnol 2002, 20, 261–268. [Google Scholar] [CrossRef] [PubMed]
  42. Delom, F.; Chevet, E. Phosphoprotein analysis: from proteins to proteomes. Proteome Sci 2006, 4, 15. [Google Scholar] [CrossRef] [PubMed]
  43. Riley, N.M.; Coon, J.J. Phosphoproteomics in the Age of Rapid and Deep Proteome Profiling. Anal Chem 2016, 88, 74–94. [Google Scholar] [CrossRef] [PubMed]
  44. Needham, E.J.; Parker, B.L.; Burykin, T.; James, D.E.; Humphrey, S.J. Illuminating the dark phosphoproteome. Sci Signal 2019, 12. [Google Scholar] [CrossRef]
  45. Yoo, J.; Mashalidis, E.H.; Kuk, A.C.Y.; Yamamoto, K.; Kaeser, B.; Ichikawa, S.; Lee, S.Y. GlcNAc-1-P-transferase-tunicamycin complex structure reveals basis for inhibition of N-glycosylation. Nat Struct Mol Biol 2018, 25, 217–224. [Google Scholar] [CrossRef]
  46. Elbein, A.D. Inhibitors of the biosynthesis and processing of N-linked oligosaccharide chains. Annu Rev Biochem 1987, 56, 497–534. [Google Scholar] [CrossRef]
  47. Wang, Y.; Zhang, L.; He, Z.; Deng, J.; Zhang, Z.; Liu, L.; Ye, W.; Liu, S. Tunicamycin induces ER stress and inhibits tumorigenesis of head and neck cancer cells by inhibiting N-glycosylation. Am J Transl Res 2020, 12, 541–550. [Google Scholar]
  48. Guha, P.; Kaptan, E.; Gade, P.; Kalvakolanu, D.V.; Ahmed, H. Tunicamycin induced endoplasmic reticulum stress promotes apoptosis of prostate cancer cells by activating mTORC1. Oncotarget 2017, 8, 68191–68207. [Google Scholar] [CrossRef]
  49. Wang, H.; Wang, X.; Ke, Z.J.; Comer, A.L.; Xu, M.; Frank, J.A.; Zhang, Z.; Shi, X.; Luo, J. Tunicamycin-induced unfolded protein response in the developing mouse brain. Toxicol Appl Pharmacol 2015, 283, 157–167. [Google Scholar] [CrossRef]
  50. Oslowski, C.M.; Urano, F. Measuring ER stress and the unfolded protein response using mammalian tissue culture system. Methods Enzymol 2011, 490, 71–92. [Google Scholar] [CrossRef]
  51. Schwaigerlehner, L.; Mayrhofer, P.; Diem, M.; Steinfellner, W.; Fenech, E.; Oostenbrink, C.; Kunert, R. Germinality does not necessarily define mAb expression and thermal stability. Appl Microbiol Biotechnol 2019, 103, 7505–7518. [Google Scholar] [CrossRef] [PubMed]
  52. Tyanova, S.; Temu, T.; Cox, J. The MaxQuant computational platform for mass spectrometry-based shotgun proteomics. Nat Protoc 2016, 11, 2301–2319. [Google Scholar] [CrossRef] [PubMed]
  53. Cox, J.; Neuhauser, N.; Michalski, A.; Scheltema, R.A.; Olsen, J.V.; Mann, M. Andromeda: a peptide search engine integrated into the MaxQuant environment. J Proteome Res 2011, 10, 1794–1805. [Google Scholar] [CrossRef]
  54. Tyanova, S.; Temu, T.; Sinitcyn, P.; Carlson, A.; Hein, M.Y.; Geiger, T.; Mann, M.; Cox, J. The Perseus computational platform for comprehensive analysis of (prote)omics data. Nat Methods 2016, 13, 731–740. [Google Scholar] [CrossRef]
  55. Tyanova, S.; Cox, J. Perseus: A Bioinformatics Platform for Integrative Analysis of Proteomics Data in Cancer Research. Methods Mol Biol 2018, 1711, 133–148. [Google Scholar] [CrossRef]
  56. Ge, S.X.; Jung, D.; Yao, R. ShinyGO: a graphical gene-set enrichment tool for animals and plants. Bioinformatics 2020, 36, 2628–2629. [Google Scholar] [CrossRef]
  57. Sherman, B.T.; Hao, M.; Qiu, J.; Jiao, X.; Baseler, M.W.; Lane, H.C.; Imamichi, T.; Chang, W. DAVID: a web server for functional enrichment analysis and functional annotation of gene lists (2021 update). Nucleic Acids Res 2022, 50, W216–W221. [Google Scholar] [CrossRef]
  58. Huang da, W.; Sherman, B.T.; Lempicki, R.A. Systematic and integrative analysis of large gene lists using DAVID bioinformatics resources. Nat Protoc 2009, 4, 44–57. [Google Scholar] [CrossRef]
  59. Zhou, Y.; Zhou, B.; Pache, L.; Chang, M.; Khodabakhshi, A.H.; Tanaseichuk, O.; Benner, C.; Chanda, S.K. Metascape provides a biologist-oriented resource for the analysis of systems-level datasets. Nat Commun 2019, 10, 1523. [Google Scholar] [CrossRef]
  60. Morrison, D.K.; Cutler, R.E. The complexity of Raf-1 regulation. Curr Opin Cell Biol 1997, 9, 174–179. [Google Scholar] [CrossRef]
  61. Sharma, K.; D'Souza, R.C.; Tyanova, S.; Schaab, C.; Wisniewski, J.R.; Cox, J.; Mann, M. Ultradeep human phosphoproteome reveals a distinct regulatory nature of Tyr and Ser/Thr-based signaling. Cell Rep 2014, 8, 1583–1594. [Google Scholar] [CrossRef] [PubMed]
  62. Ramasamy, P.; Vandermarliere, E.; Vranken, W.F.; Martens, L. Panoramic Perspective on Human Phosphosites. J Proteome Res 2022, 21, 1894–1915. [Google Scholar] [CrossRef] [PubMed]
  63. Hunter, T.; Sefton, B.M. Transforming gene product of Rous sarcoma virus phosphorylates tyrosine. Proc Natl Acad Sci U S A 1980, 77, 1311–1315. [Google Scholar] [CrossRef] [PubMed]
  64. Salazar, C.; Hofer, T. Multisite protein phosphorylation--from molecular mechanisms to kinetic models. FEBS J 2009, 276, 3177–3198. [Google Scholar] [CrossRef] [PubMed]
  65. Szklarczyk, D.; Kirsch, R.; Koutrouli, M.; Nastou, K.; Mehryary, F.; Hachilif, R.; Gable, A.L.; Fang, T.; Doncheva, N.T.; Pyysalo, S.; et al. The STRING database in 2023: protein-protein association networks and functional enrichment analyses for any sequenced genome of interest. Nucleic Acids Res 2023, 51, D638–D646. [Google Scholar] [CrossRef]
  66. Harrison, P.W.; Amode, M.R.; Austine-Orimoloye, O.; Azov, A.G.; Barba, M.; Barnes, I.; Becker, A.; Bennett, R.; Berry, A.; Bhai, J.; et al. Ensembl 2024. Nucleic Acids Res 2024, 52, D891–D899. [Google Scholar] [CrossRef]
  67. Misteli, T. RNA splicing: What has phosphorylation got to do with it? Curr Biol 1999, 9, R198–R200. [Google Scholar] [CrossRef]
  68. Li, M.; Yang, X.; Zhang, G.; Wang, L.; Zhu, Z.; Zhang, W.; Huang, H.; Gao, R. Heterogeneous nuclear ribonucleoprotein K promotes the progression of lung cancer by inhibiting the p53-dependent signaling pathway. Thorac Cancer 2022, 13, 1311–1321. [Google Scholar] [CrossRef]
  69. Mikula, M.; Bomsztyk, K. Direct recruitment of ERK cascade components to inducible genes is regulated by heterogeneous nuclear ribonucleoprotein (hnRNP) K. J Biol Chem 2011, 286, 9763–9775. [Google Scholar] [CrossRef]
  70. Meyuhas, O. Ribosomal Protein S6 Phosphorylation: Four Decades of Research. Int Rev Cell Mol Biol 2015, 320, 41–73. [Google Scholar] [CrossRef]
  71. Yi, Y.W.; You, K.S.; Park, J.S.; Lee, S.G.; Seong, Y.S. Ribosomal Protein S6: A Potential Therapeutic Target against Cancer? Int J Mol Sci 2021, 23. [Google Scholar] [CrossRef] [PubMed]
  72. Bohlen, J.; Roiuk, M.; Teleman, A.A. Phosphorylation of ribosomal protein S6 differentially affects mRNA translation based on ORF length. Nucleic Acids Res 2021, 49, 13062–13074. [Google Scholar] [CrossRef] [PubMed]
  73. Ruvinsky, I.; Sharon, N.; Lerer, T.; Cohen, H.; Stolovich-Rain, M.; Nir, T.; Dor, Y.; Zisman, P.; Meyuhas, O. Ribosomal protein S6 phosphorylation is a determinant of cell size and glucose homeostasis. Genes Dev 2005, 19, 2199–2211. [Google Scholar] [CrossRef] [PubMed]
  74. Pende, M.; Kozma, S.C.; Jaquet, M.; Oorschot, V.; Burcelin, R.; Le Marchand-Brustel, Y.; Klumperman, J.; Thorens, B.; Thomas, G. Hypoinsulinaemia, glucose intolerance and diminished beta-cell size in S6K1-deficient mice. Nature 2000, 408, 994–997. [Google Scholar] [CrossRef]
  75. Ruvinsky, I.; Meyuhas, O. Ribosomal protein S6 phosphorylation: from protein synthesis to cell size. Trends Biochem Sci 2006, 31, 342–348. [Google Scholar] [CrossRef]
  76. Frost, V.; Morley, S.J.; Mercep, L.; Meyer, T.; Fabbro, D.; Ferrari, S. The phosphodiesterase inhibitor SQ 20006 selectively blocks mitogen activation of p70S6k and transition to S phase of the cell division cycle without affecting the steady state phosphorylation of eIF-4E. J Biol Chem 1995, 270, 26698–26706. [Google Scholar] [CrossRef]
  77. Wang, X.; Li, W.; Williams, M.; Terada, N.; Alessi, D.R.; Proud, C.G. Regulation of elongation factor 2 kinase by p90(RSK1) and p70 S6 kinase. EMBO J 2001, 20, 4370–4379. [Google Scholar] [CrossRef]
  78. Krieg, J.; Hofsteenge, J.; Thomas, G. Identification of the 40 S ribosomal protein S6 phosphorylation sites induced by cycloheximide. J Biol Chem 1988, 263, 11473–11477. [Google Scholar] [CrossRef]
  79. Buchan, J.R.; Parker, R. Eukaryotic stress granules: the ins and outs of translation. Mol Cell 2009, 36, 932–941. [Google Scholar] [CrossRef]
  80. Takahara, T.; Maeda, T. Transient sequestration of TORC1 into stress granules during heat stress. Mol Cell 2012, 47, 242–252. [Google Scholar] [CrossRef]
  81. Harrod, A.; Lane, K.A.; Downs, J.A. The role of the SWI/SNF chromatin remodelling complex in the response to DNA double strand breaks. DNA Repair (Amst) 2020, 93, 102919. [Google Scholar] [CrossRef]
  82. Jiang, Q.; Ang, J.Y.J.; Lee, A.Y.; Cao, Q.; Li, K.Y.; Yip, K.Y.; Leung, D.C.Y. G9a Plays Distinct Roles in Maintaining DNA Methylation, Retrotransposon Silencing, and Chromatin Looping. Cell Rep 2020, 33, 108315. [Google Scholar] [CrossRef] [PubMed]
  83. Tachibana, M.; Sugimoto, K.; Nozaki, M.; Ueda, J.; Ohta, T.; Ohki, M.; Fukuda, M.; Takeda, N.; Niida, H.; Kato, H.; et al. G9a histone methyltransferase plays a dominant role in euchromatic histone H3 lysine 9 methylation and is essential for early embryogenesis. Genes Dev 2002, 16, 1779–1791. [Google Scholar] [CrossRef] [PubMed]
  84. Poulard, C.; Noureddine, L.M.; Pruvost, L.; Le Romancer, M. Structure, Activity, and Function of the Protein Lysine Methyltransferase G9a. Life (Basel) 2021, 11. [Google Scholar] [CrossRef] [PubMed]
  85. Epsztejn-Litman, S.; Feldman, N.; Abu-Remaileh, M.; Shufaro, Y.; Gerson, A.; Ueda, J.; Deplus, R.; Fuks, F.; Shinkai, Y.; Cedar, H.; et al. De novo DNA methylation promoted by G9a prevents reprogramming of embryonically silenced genes. Nat Struct Mol Biol 2008, 15, 1176–1183. [Google Scholar] [CrossRef]
  86. Alver, B.H.; Kim, K.H.; Lu, P.; Wang, X.; Manchester, H.E.; Wang, W.; Haswell, J.R.; Park, P.J.; Roberts, C.W. The SWI/SNF chromatin remodelling complex is required for maintenance of lineage specific enhancers. Nat Commun 2017, 8, 14648. [Google Scholar] [CrossRef]
  87. Bell, S.P.; Dutta, A. DNA replication in eukaryotic cells. Annu Rev Biochem 2002, 71, 333–374. [Google Scholar] [CrossRef]
  88. Tsuji, T.; Ficarro, S.B.; Jiang, W. Essential role of phosphorylation of MCM2 by Cdc7/Dbf4 in the initiation of DNA replication in mammalian cells. Mol Biol Cell 2006, 17, 4459–4472. [Google Scholar] [CrossRef]
  89. Ryazanov, A.G.; Shestakova, E.A.; Natapov, P.G. Phosphorylation of elongation factor 2 by EF-2 kinase affects rate of translation. Nature 1988, 334, 170–173. [Google Scholar] [CrossRef]
  90. Zhu, H.; Yang, X.; Liu, J.; Zhou, L.; Zhang, C.; Xu, L.; Qin, Q.; Zhan, L.; Lu, J.; Cheng, H.; et al. Eukaryotic elongation factor 2 kinase confers tolerance to stress conditions in cancer cells. Cell Stress Chaperones 2015, 20, 217–220. [Google Scholar] [CrossRef]
  91. Kenney, J.W.; Moore, C.E.; Wang, X.; Proud, C.G. Eukaryotic elongation factor 2 kinase, an unusual enzyme with multiple roles. Adv Biol Regul 2014, 55, 15–27. [Google Scholar] [CrossRef] [PubMed]
  92. Smith, P.R.; Loerch, S.; Kunder, N.; Stanowick, A.D.; Lou, T.F.; Campbell, Z.T. Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance. Nat Commun 2021, 12, 6789. [Google Scholar] [CrossRef] [PubMed]
  93. Proud, C.G. Peptide-chain elongation in eukaryotes. Mol Biol Rep 1994, 19, 161–170. [Google Scholar] [CrossRef] [PubMed]
  94. Wang, X.; Regufe da Mota, S.; Liu, R.; Moore, C.E.; Xie, J.; Lanucara, F.; Agarwala, U.; Pyr Dit Ruys, S.; Vertommen, D.; Rider, M.H.; et al. Eukaryotic elongation factor 2 kinase activity is controlled by multiple inputs from oncogenic signaling. Mol Cell Biol 2014, 34, 4088–4103. [Google Scholar] [CrossRef] [PubMed]
  95. Redpath, N.T.; Foulstone, E.J.; Proud, C.G. Regulation of translation elongation factor-2 by insulin via a rapamycin-sensitive signalling pathway. EMBO J 1996, 15, 2291–2297. [Google Scholar] [CrossRef] [PubMed]
  96. Hijazi, M.; Casado, P.; Akhtar, N.; Alvarez-Teijeiro, S.; Rajeeve, V.; Cutillas, P.R. eEF2K Activity Determines Synergy to Cotreatment of Cancer Cells With PI3K and MEK Inhibitors. Mol Cell Proteomics 2022, 21, 100240. [Google Scholar] [CrossRef]
  97. Cheng, Y.; Ren, X.; Zhang, Y.; Shan, Y.; Huber-Keener, K.J.; Zhang, L.; Kimball, S.R.; Harvey, H.; Jefferson, L.S.; Yang, J.M. Integrated regulation of autophagy and apoptosis by EEF2K controls cellular fate and modulates the efficacy of curcumin and velcade against tumor cells. Autophagy 2013, 9, 208–219. [Google Scholar] [CrossRef]
  98. Walter, P.; Ron, D. The unfolded protein response: from stress pathway to homeostatic regulation. Science 2011, 334, 1081–1086. [Google Scholar] [CrossRef]
  99. Carlberg, U.; Nilsson, A.; Nygard, O. Functional properties of phosphorylated elongation factor 2. Eur J Biochem 1990, 191, 639–645. [Google Scholar] [CrossRef]
  100. Liu, R.; Proud, C.G. Eukaryotic elongation factor 2 kinase as a drug target in cancer, and in cardiovascular and neurodegenerative diseases. Acta Pharmacol Sin 2016, 37, 285–294. [Google Scholar] [CrossRef]
  101. Hwang, S.; Kim, S.; Kim, K.; Yeom, J.; Park, S.; Kim, I. Euchromatin histone methyltransferase II (EHMT2) regulates the expression of ras-related GTP binding C (RRAGC) protein. BMB Rep 2020, 53, 576–581. [Google Scholar] [CrossRef] [PubMed]
  102. Yang, Q.; Zhu, Q.; Lu, X.; Du, Y.; Cao, L.; Shen, C.; Hou, T.; Li, M.; Li, Z.; Liu, C.; et al. G9a coordinates with the RPA complex to promote DNA damage repair and cell survival. Proc Natl Acad Sci U S A 2017, 114, E6054–E6063. [Google Scholar] [CrossRef] [PubMed]
  103. Chen, H.; He, A.; Li, H.; Chen, H.; Xie, H.; Luo, L.; Huang, Y.; Chen, J.; Guan, J.; He, Q.; et al. TSSK4 upregulation in alveolar epithelial type-II cells facilitates pulmonary fibrosis through HSP90-AKT signaling restriction and AT-II apoptosis. Cell Death Dis 2021, 12, 938. [Google Scholar] [CrossRef] [PubMed]
  104. Hu, C.W.; Hsu, C.L.; Wang, Y.C.; Ishihama, Y.; Ku, W.C.; Huang, H.C.; Juan, H.F. Temporal Phosphoproteome Dynamics Induced by an ATP Synthase Inhibitor Citreoviridin. Mol Cell Proteomics 2015, 14, 3284–3298. [Google Scholar] [CrossRef]
  105. Paez-Ribes, M.; Gonzalez-Gualda, E.; Doherty, G.J.; Munoz-Espin, D. Targeting senescent cells in translational medicine. EMBO Mol Med 2019, 11, e10234. [Google Scholar] [CrossRef]
  106. Kim, A.H.; Khursigara, G.; Sun, X.; Franke, T.F.; Chao, M.V. Akt phosphorylates and negatively regulates apoptosis signal-regulating kinase 1. Mol Cell Biol 2001, 21, 893–901. [Google Scholar] [CrossRef]
  107. Manning, B.D.; Toker, A. AKT/PKB Signaling: Navigating the Network. Cell 2017, 169, 381–405. [Google Scholar] [CrossRef]
  108. Godel, M.; Temerinac, D.; Grahammer, F.; Hartleben, B.; Kretz, O.; Riederer, B.M.; Propst, F.; Kohl, S.; Huber, T.B. Microtubule Associated Protein 1b (MAP1B) Is a Marker of the Microtubular Cytoskeleton in Podocytes but Is Not Essential for the Function of the Kidney Filtration Barrier in Mice. PLoS One 2015, 10, e0140116. [Google Scholar] [CrossRef]
  109. Parker, A.L.; Kavallaris, M.; McCarroll, J.A. Microtubules and their role in cellular stress in cancer. Front Oncol 2014, 4, 153. [Google Scholar] [CrossRef]
  110. Laks, D.R.; Oses-Prieto, J.A.; Alvarado, A.G.; Nakashima, J.; Chand, S.; Azzam, D.B.; Gholkar, A.A.; Sperry, J.; Ludwig, K.; Condro, M.C.; et al. A molecular cascade modulates MAP1B and confers resistance to mTOR inhibition in human glioblastoma. Neuro Oncol 2018, 20, 764–775. [Google Scholar] [CrossRef]
  111. Goold, R.G.; Owen, R.; Gordon-Weeks, P.R. Glycogen synthase kinase 3beta phosphorylation of microtubule-associated protein 1B regulates the stability of microtubules in growth cones. J Cell Sci 1999, 112 Pt 19, 3373–3384. [Google Scholar] [CrossRef] [PubMed]
  112. Hong, S.; Freeberg, M.A.; Han, T.; Kamath, A.; Yao, Y.; Fukuda, T.; Suzuki, T.; Kim, J.K.; Inoki, K. LARP1 functions as a molecular switch for mTORC1-mediated translation of an essential class of mRNAs. Elife 2017, 6. [Google Scholar] [CrossRef] [PubMed]
  113. Zou, L.H.; Shang, Z.F.; Tan, W.; Liu, X.D.; Xu, Q.Z.; Song, M.; Wang, Y.; Guan, H.; Zhang, S.M.; Yu, L.; et al. TNKS1BP1 functions in DNA double-strand break repair though facilitating DNA-PKcs autophosphorylation dependent on PARP-1. Oncotarget 2015, 6, 7011–7022. [Google Scholar] [CrossRef]
  114. Seimiya, H.; Smith, S. The telomeric poly(ADP-ribose) polymerase, tankyrase 1, contains multiple binding sites for telomeric repeat binding factor 1 (TRF1) and a novel acceptor, 182-kDa tankyrase-binding protein (TAB182). J Biol Chem 2002, 277, 14116–14126. [Google Scholar] [CrossRef]
  115. Chen, M.; Tang, B.; Xie, S.; Yan, J.; Yang, L.; Zhou, X.; Zeng, E. Biological Functions of TNKS1 and Its Relationship with Wnt/beta-Catenin Pathway in Astrocytoma. Onco Targets Ther 2019, 12, 10841–10850. [Google Scholar] [CrossRef]
  116. Sun, Z.; Zhang, Q.; Lv, J.; Sun, Y.; Feng, Z.; Zhang, M.; Zhang, F.; Xia, C.; Gao, Y.; Zhang, Z.; et al. High expression of NOLC1 as an independent prognostic factor for survival in patients with colorectal cancer. J Cancer Res Clin Oncol 2023, 149, 15697–15712. [Google Scholar] [CrossRef]
Figure 1. Schematic workflow of label-free quantitative (LFQ) phosphoproteomics coupled with liquid chromatography-tandem mass spectrometry (LC-MS/MS) to analyze phosphorylation levels in proteins derived from Chinese hamster ovary (CHO) cells. The proteins were initially digested with trypsin to generate peptides for further analysis at proteomics and phosphoproteomics level. Subsequently, phosphopeptides were to be selectively enriched using a Titanium Dioxide (TiO2) Phosphopeptide Enrichment Kit. The phosphorylation levels of these phosphopeptides were then analyzed and compared using a label-free liquid chromatography-tandem mass spectrometry (LC–MS/MS) technique. Created with BioRender.com.
Figure 1. Schematic workflow of label-free quantitative (LFQ) phosphoproteomics coupled with liquid chromatography-tandem mass spectrometry (LC-MS/MS) to analyze phosphorylation levels in proteins derived from Chinese hamster ovary (CHO) cells. The proteins were initially digested with trypsin to generate peptides for further analysis at proteomics and phosphoproteomics level. Subsequently, phosphopeptides were to be selectively enriched using a Titanium Dioxide (TiO2) Phosphopeptide Enrichment Kit. The phosphorylation levels of these phosphopeptides were then analyzed and compared using a label-free liquid chromatography-tandem mass spectrometry (LC–MS/MS) technique. Created with BioRender.com.
Preprints 139190 g001
Figure 2. Volcano plots depicting fold changes of proteins adjusted for multiple testing using a permutation-based FDR, with q < 0.05. On the X-axis, the Log2 fold change is shown between the groups (a) 2G12 vs. 353/11 and (b) 353/11_TM vs. 353/11 respectively. The Y-axis portrays -Log10 p-values, adhering to the corresponding q-value after correcting for multiple hypotheses. Proteins colored in orange exhibit q < 0.05. The analysis was conducted using Perseus software.
Figure 2. Volcano plots depicting fold changes of proteins adjusted for multiple testing using a permutation-based FDR, with q < 0.05. On the X-axis, the Log2 fold change is shown between the groups (a) 2G12 vs. 353/11 and (b) 353/11_TM vs. 353/11 respectively. The Y-axis portrays -Log10 p-values, adhering to the corresponding q-value after correcting for multiple hypotheses. Proteins colored in orange exhibit q < 0.05. The analysis was conducted using Perseus software.
Preprints 139190 g002
Figure 3. A heatmap generated using Perseus software, illustrating the expression overview of all significantly different phosphosites (rows) across all samples (columns) between the 2G12 vs. 353/11 and 353/11_TM vs. 353/11 comparisons (BH-FDR, q-value < 0.05) (Table S2). Phosphosites with higher intensities are highlighted in orange, while those with lower intensities are indicated in light blue.
Figure 3. A heatmap generated using Perseus software, illustrating the expression overview of all significantly different phosphosites (rows) across all samples (columns) between the 2G12 vs. 353/11 and 353/11_TM vs. 353/11 comparisons (BH-FDR, q-value < 0.05) (Table S2). Phosphosites with higher intensities are highlighted in orange, while those with lower intensities are indicated in light blue.
Preprints 139190 g003
Figure 4. Top Gene Ontology (GO) terms for biological process (BP), molecular function (MF), and cellular compartment (CC) enrichment analysis based on ShinyGO tool. The length of each bar indicates the gene ratio (nGenes/PathwayGenes) linked to the corresponding enriched term, while color denotes the statistical significance of the enrichment, ranging from high significance (blue) to low significance (orange) (a) The bar chart displays the Gene Ontology (GO) enrichment analysis for biological processes (BP) of differentially expressed phosphoproteins between the 2G12 and 353/11 comparison (b) GO enrichment for biological processes (BP) between 353/11_TM and 353/11; (c) GO enrichment for molecular functions (MF) of differentially expressed phosphoproteins between 2G12 and 353/11; (d) GO enrichment for molecular functions (MF) between 353/11_TM and 353/11; (e) GO enrichment for cellular compartments (CC) of differentially expressed phosphoproteins between 2G12 and 353/11; (f) GO enrichment for cellular compartments (CC) between 353/11_TM and 353/11.
Figure 4. Top Gene Ontology (GO) terms for biological process (BP), molecular function (MF), and cellular compartment (CC) enrichment analysis based on ShinyGO tool. The length of each bar indicates the gene ratio (nGenes/PathwayGenes) linked to the corresponding enriched term, while color denotes the statistical significance of the enrichment, ranging from high significance (blue) to low significance (orange) (a) The bar chart displays the Gene Ontology (GO) enrichment analysis for biological processes (BP) of differentially expressed phosphoproteins between the 2G12 and 353/11 comparison (b) GO enrichment for biological processes (BP) between 353/11_TM and 353/11; (c) GO enrichment for molecular functions (MF) of differentially expressed phosphoproteins between 2G12 and 353/11; (d) GO enrichment for molecular functions (MF) between 353/11_TM and 353/11; (e) GO enrichment for cellular compartments (CC) of differentially expressed phosphoproteins between 2G12 and 353/11; (f) GO enrichment for cellular compartments (CC) between 353/11_TM and 353/11.
Preprints 139190 g004aPreprints 139190 g004b
Figure 5. The enrichment plot network analysis comparing 2G12 and 353/11 illustrates the top 13 identified terms across different functional categories, using an edge cut-off of 0.3. Nodes correspond to the enriched terms, with edges representing their interactions. The thickness of the edges reflects the degree of gene overlap, while node size indicates the number of genes associated with each term (Table S9).
Figure 5. The enrichment plot network analysis comparing 2G12 and 353/11 illustrates the top 13 identified terms across different functional categories, using an edge cut-off of 0.3. Nodes correspond to the enriched terms, with edges representing their interactions. The thickness of the edges reflects the degree of gene overlap, while node size indicates the number of genes associated with each term (Table S9).
Preprints 139190 g005
Table 1. The seven proteins comprising term; “Response to stress”.
Table 1. The seven proteins comprising term; “Response to stress”.
Protein Protein names Gene names Sequence window Residue Log2 Change 353/11_TM vs. 353/11
G3IHK4 Eukaryotic elongation factor 2 kinase Eef2k NYYSNLMKTECGSTGSPASSFHFKEAWKHAI S73 2.31
A0A8C2MXF1 euchromatic histone lysine methyltransferase 2(Ehmt2) Ehmt2 LGKVTSDAAKRRKLNSGSLSEDFGSARGSGD S229 1.72
A0A8C2MUK8 Heat shock protein HSP 90-BETA Hsp90ab1 EDKDDEEKPKIEDVGSDEEDDSGKDKKKKTK S255 -3.46
A0A8C2MBL3 Microtubule-associated protein 1B; Map1b heavy chain; Map1 light chain Lc1 Map1b IKDVSDERLSPTKSPSLSPSPPSPIEKTPLG S1255 -5.19
A0A8C2MCK2 La-related protein 1 Larp1 ANKLFGAPEPSTIARSLPTTVPESPNYRNAR S735 1.00
EPSTIARSLPTTVPESPNYRNARTPRTPRTP S743 1.00
G3HRJ2 182 kDa tankyrase-1-binding protein Tnks1bp1 LSPSALKAKLRSRNRSAEEGEVTESKSSQKE S1630 -3.92
A0A8C2LS20 Nucleolar and coiled-body phosphoprotein 1 Nolc1 ANGTPASQNGKAGKESEEDEEEEETKMAVSK S542 -4.83
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
Copyright: This open access article is published under a Creative Commons CC BY 4.0 license, which permit the free download, distribution, and reuse, provided that the author and preprint are cited in any reuse.