Preprint
Review

This version is not peer-reviewed.

Antimicrobial Peptides versus Antibiotics in Farm Animal Production

A peer-reviewed version of this preprint was published in:
Antibiotics 2025, 14(11), 1108. https://doi.org/10.3390/antibiotics14111108

Submitted:

02 June 2025

Posted:

02 June 2025

You are already at the latest version

Abstract
The increasing prevalence of antimicrobial resistance in livestock pathogens necessitates the development of effective alternatives to conventional antibiotics. This review aims to evaluate the potential of antimicrobial peptides (AMPs) as substitutes for traditional antibiotics in farm animal production systems, comparing their mechanisms of action, efficacy, and applications. A comprehensive analysis of recent literature was conducted to examine the properties, classification, and mechanisms of action of AMPs, their occurrence in nature, and their applications in poultry, swine, and ruminant production. The review also compared AMPs with conventional antibiotics, antifungals, and antiparasitic drugs and explored innovative delivery systems, including nano-enabled polymeric carriers. Specific AMPs have shown efficacy against livestock pathogens, including Escherichia coli, Salmonella, Clostridium perfringens, and drug-resistant fungi. Innovative delivery systems such as self-assembly techniques and nanoparticle encapsulation can address stability and bioavailability challenges associated with AMP administration in farm settings. AMPs represent prospecting alternatives to conventional antimicrobials in livestock production, with significant advantages including reduced resistance development, immunomodulatory effects, and broad-spectrum activity. However, addressing challenges related to production costs, stability, and delivery systems is essential for their successful commercial application. The integration of AMPs into sustainable farming practices could contribute significantly to global efforts to combat antimicrobial resistance.
Keywords: 
;  ;  ;  ;  ;  

1. Introduction

The agricultural industry heavily relies on antimicrobials for disease management and enhancing productivity in livestock such as aquaculture, poultry, cattle, and pigs [1,2,3]. However, rising concerns regarding antimicrobial resistance (AMR) and potential toxicological safety problems necessitate exploration of alternative strategies [2,4,5]. The growing concern regarding antimicrobial resistance in foodborne pathogens further highlights the importance of developing effective alternatives to antibiotics. From 2014 to 2024, there has been a steady increase in publications on both topics, with significantly higher interest in antibiotics in livestock, while the growing attention to antimicrobial peptides reflects rising interest in antibiotic alternatives (Figure 1).
Carbapenemase-producing Enterobacteriaceae (CPE), historically regarded as a human-associated threat, have now also been identified in farm animals [6]. Recent surveillance data indicate that CPE have been detected in 14 out of the 30 European Union member states—equivalent to nearly 50%—a trend that is particularly alarming in the context of zoonotic transmission and food chain contamination [6].
The scale of antimicrobial resistance is alarming, with an estimated 500,000 people infected worldwide. According to projections by O'Neill and colleagues [7], antimicrobial resistance could cause approximately 10 million deaths by 2050 [8]. This global challenge has prompted governments and public health agencies to increase efforts in antimicrobial resistance surveillance and research. Bacteria, including Pseudomonas aeruginosa, Staphylococcus aureus, coagulase-negative Staphylococcus, Salmonella spp., Shigella spp., Enterococcus spp., and Escherichia coli, currently demonstrate the highest levels of antibiotic resistance and cause the most serious infections in both humans and animals [4]. Of particular concern is the potential transfer of antibiotic resistance from intestinal bacteria in animals to humans through consumption of foods of animal origin (Figure 2) [4].
Recent estimates suggest global antimicrobial use in livestock could reach approximately 143,481 tons by 2040 under business-as-usual scenarios, representing a 29.5% increase from 2019 baseline levels [10]. This upward trend underscores the urgent need for effective alternatives, especially considering global commitments outlined in the Muscat Manifesto to reduce antimicrobial use in agrifood systems by 30-50% by 2030 [10]. Using an improved methodology that considers animal weight at treatment rather than at slaughter, researchers have estimated that global antimicrobial use in cattle, chickens, and pigs amounts to 76,060 tonnes annually, representing a more accurate assessment of the scale of the AMR challenge [1].
Antimicrobial peptides (AMPs), also referred to as host defense peptides (HDPs), have emerged as one prospective class of alternatives for use in livestock production systems, including aquaculture, poultry, ruminants, and swine [11,12,13]. AMPs are naturally occurring short chains of amino acids (approximately 10-50 residues long, Table 1) that are critical parts of the innate immune system of diverse organisms and are ubiquitous in nature. They are usually cationic with amphipathic properties, enabling them to interact with microbial membrane and cell wall and making them potent against a broad spectrum of pathogens [14].
This review explores the potential applications, advantages, and limitations of AMPs as alternatives to conventional antibiotics in livestock production, with a particular focus on their antimicrobial efficacy, mechanisms of action, and challenges to widespread implementation.

2. AMPs against Bacteria, Fungi, and Parasites in Farm Animal Production

AMPs have emerged as potential alternatives to conventional antibiotics in aquaculture (Table 2) and farm animal production due to their broad-spectrum antimicrobial activities and immunomodulatory functions. The growing concern over antibiotic resistance has accelerated interest in AMPs as potential substitutes to improve growth performance, intestinal health, and immunity in livestock species [11].

2.1. AMPs Against Bacterial Infections in Farm Animals

2.1.1. Application of AMPs in Poultry

The application of antimicrobial peptides in combating poultry pathogens is of particular interest due to their broad spectrum of activity, low likelihood of resistance development, and multifunctional immunomodulatory properties.
AMPs have demonstrated significant benefits for controlling necrotic enteritis (NE) caused by Clostridium perfringens, which has become a major economic concern, especially in countries that have banned antibiotic growth promoters [22]. Researchers have identified enterococci strains with antimicrobial activity against C. perfringens that could serve as protective strains in poultry farming. For instance, E. faecium X2893 and X2906 strains, which produce enterocin A and enterocin B (Table 3), have demonstrated significant inhibitory effects against C. perfringens without carrying acquired resistance genes, making them compelling candidates for protective strains. [22].
Peptides affecting the outer membrane lipid asymmetry system (MlaA-OmpC/F) in avian pathogenic Escherichia coli (APEC) have shown significant potential for reducing colonization in chickens. Three peptides derived from Lactobacillus rhamnosus GG (Table 3) have demonstrated inhibitory activity against APEC and effectively reduced cecum colonization in chickens. These peptides work by disrupting the APEC membrane and cell wall, either by causing membrane shedding, rupturing, or flaccidity, and downregulate the expression of ompC, ompF, and mlaA genes responsible for the maintenance of outer membrane lipid asymmetry [30].
Several avian AMPs have been evaluated for their efficacy in poultry production. Truncated cathelicidins CATH-1(6-26) (Table 3) and CATH-2(1-15), along with avian β-defensins (including ABD1, ABD2, ABD6, and ABD9) (Table 3), have shown potent antibacterial activities against important poultry pathogens such as E. coli, Salmonella enteritidis, Salmonella typhimurium, Campylobacter jejuni, and Clostridium perfringens [24]. Notably, in ovo administration of ABD1 significantly reduced early chick mortality (by 44%) from experimental yolk sac infection caused by avian pathogenic E. coli, demonstrating protection comparable to CpG ODN, a known immune stimulant [24].
Studies investigating the efficacy of AMPs across various production contexts highlight their multifaceted benefits beyond direct antimicrobial activity. For instance, HDP-cLF36, derived from camel lactoferrin, increased Lactobacillus spp. and decreased harmful bacteria in the ileum of E. coli-contaminated chickens, while upregulating genes associated with immune cells and tight junction proteins [11]. Similarly, sublancin reduced C. perfringens counts in the cecum of contaminated chickens, improved villus height and villus height to crypt depth ratio in the duodenum, and decreased pro-inflammatory cytokine levels in the ileum [11].

2.1.2. Application of AMPs in Swine Production

In swine production, various host defense peptides (HDPs) have been investigated to combat post-weaning diarrhea, a serious problem caused primarily by enterotoxigenic E. coli (ETEC). Dietary supplementation with HDPs like microcin J25, cecropin AD (Table 4), and composite HDPs containing lactoferrin, cecropin, defensin, and plectasin has effectively reduced diarrhea incidence and improved growth performance in weaned piglets [11]. For example, cecropin AD supplementation significantly reduced diarrhea incidence by 47.6% and improved intestinal morphology, nitrogen retention, and dietary energy digestibility in ETEC-contaminated piglets [11].
One of the most prospective classes of AMPs in agricultural production is β-defensins. Porcine β-defensins (pBDs) (Table 4, Figure 3) are positively charged peptides typically linked to the innate immune response. These molecules possess both antimicrobial and immunomodulatory properties, as evidenced by various trials [12]. The expression of pBD is thought to be regulated by a complex network of factors, including cytokine signaling, hormonal influences, dietary components like Zn2+, and the precise control of gene activity via epigenetic modifications [12].

2.1.3. Application of AMPs in Ruminants

In ruminants, HDPs, particularly bacteriocins (Table 5) like bovicin HC5 and nisin, have shown potential to reduce methane production, which accounts for 2-12% of gross energy loss from feeds and contributes significantly to agricultural greenhouse gas emissions [11]. Additionally, HDPs have shown potential in combating bovine mastitis and respiratory diseases. Peptide H18R (H2) has demonstrated greater efficacy than vancomycin in controlling Staphylococcus aureus, which causes mastitis, by being internalized into MAC-T cells and inhibiting MRSA [11]. Similarly, bovine NK-lysin-derived peptides can damage the cell wall and plasma membrane and kill Mycoplasma bovis, an important contributor to bovine respiratory disease complex [11].

2.2. AMPs against Fungal Infections in Farm Animals

Fungal infections present a significant challenge in farm animal production. The currently available antifungal agents are rather limited, and the widespread use of these agents has caused the emergence of antifungal resistance in Candida, Cryptococcus, and Aspergillus species. Therefore, the development of novel antifungals is urgently needed [45].
Antimicrobial peptides with antifungal activity, specifically referred to as antifungal peptides (AFPs) (Table 6), are currently regarded as the most prospective alternative to conventional antifungal agents due to the fact that they are highly selective and less prone to facilitate the selection of drug resistance [45].
The exploration of AFPs' modes of action against fungi reveals a variety of mechanisms (Figure 4). AFPs can function via inhibition of biosynthesis of cell wall components, interaction with membrane components, and interference with intracellular targets. Many AFPs often function via multiple modes of action [45]. For example, in a study by Gong et al., the fish-sourced peptide AP10W was shown to exert its fungicidal activity through modes of combined actions, including interaction with the fungal cell walls via laminarin, mannan, and chitin, enhancement of cell wall permeabilization, induction of membrane depolarization, and increase in intracellular reactive oxygen species (ROS) generation [48].
The application of AFPs in poultry production has shown particular potential for controlling fungal diseases like aspergillosis. Recent studies have demonstrated that certain AFPs isolated from entomopathogenic bacteria show significant activity against important fungal pathogens. These AFPs typically affect cell wall and membrane integrity and produce lethal pores in microorganisms [45].
The application of novel AMPs in food preservation has also shown efficient results against fungal contamination. A study demonstrated that a novel designed membrane-active peptide, A11 (Table 3), modified from acidocin J1132β, exhibits potent inhibitory activity against fungal pathogens, as well as a favorable safety profile [23]. A11 caused transient membrane permeabilization and killed fungal cells through membrane depolarization and/or intracellular interactions with fungal DNA, while maintaining most of its inhibitory effects when heated, even when exposed to temperatures up to 100°C [23].
Notably, certain AMPs or their derivatives may also have potential as feed additives in livestock production to prevent fungal contamination. Some studies have found that autoclaved cultures containing thermostable antimicrobial compounds may not be harmful when added as food supplements, while retaining their antimicrobial activity against fungi [50].
This suggests the possibility of developing AMP-based feed additives that could help prevent fungal infections in farm animals without the need for therapeutic intervention.

2.3. AMPs against Parasitic Infections in Farm Animals

Parasitic infections, including those caused by protozoan pathogens such as Leishmania and Histomonas, getting more and more resistant, posing substantial challenges to animal health and welfare in agricultural settings [50,51]. Traditional treatment approaches have relied heavily on chemical antiparasitic drugs, but the emergence of resistance has necessitated the exploration of novel therapeutic strategies [50]. In this context, AMPs derived from various sources, including insects, offer unique advantages as potential antiparasitic agents.
The entomopathogenic bacteria of the genera Xenorhabdus (Table 7) and Photorhabdus have emerged as particularly valuable sources of antimicrobial peptides with potential antiparasitic activity. These bacteria, which form symbiotic relationships with entomopathogenic nematodes, produce a variety of non-ribosomal templated peptides (NR-AMPs) that exhibit broad-spectrum antimicrobial properties [50]. Importantly, studies on cell-free culture media (CFCM) from Xenorhabdus budapestensis and X. szentirmaii have demonstrated potent activity against both the promastigote and amastigote forms of Leishmania, as well as against Histomonas meleagridis, which causes histomonosis (blackhead disease) in poultry [49]. This ability to target different life stages of parasites is particularly valuable for developing effective control strategies in livestock production.
The mechanism of action of peptides against parasites appears to be multifaceted (Figure 5). For instance, research on Halictine-2, a dodecameric AMP isolated from the venom of the eusocial honeybee Halictus sexcinctus, has shown that its variant P5T demonstrates significant leishmanicidal activity through membrane disruption and induction of apoptosis-like cell death [55]. This is consistent with the primary mode of action observed in many AMPs, which typically affect membrane integrity and produce lethal pores in microorganisms [56]. Electron microscopy analyses revealed distinct pores on the parasite membrane after exposure to this peptide, suggesting a direct membrane-disruptive mechanism of action. Additionally, biochemical investigations indicated that treatment with this AMP led to increased ROS production, calcium efflux, mitochondrial depolarization, and ATP depletion in the parasites, culminating in programmed cell death [55].
In contrast to most AMPs from higher eukaryotes that usually work in the micromolar range, certain cyanobacterial antiparasitic peptides are active at picomolar concentrations [57]. This remarkable potency demonstrates the diversity of action mechanisms that various AMPs can employ against parasitic targets. Whereas AMPs from higher eukaryotes typically disrupt the plasma membrane, cyanobacterial peptides often target intracellular processes, providing additional strategies for antiparasitic action.
Another encouraging aspect of AMPs for farm animal applications against parasites is their potential for combinatorial therapy with existing antiparasitic drugs. Research has demonstrated enhanced killing efficacy when certain AMPs are co-administered with conventional antiparasitic agents. For instance, the combination of P5T with potassium antimony tartrate (PAT) showed synergistic effects against Leishmania parasites [55]. Such combinatorial approaches could help address problems of drug resistance while potentially allowing for reduced dosages of conventional drugs, thereby minimizing residues in animal products.
A key advantage of AMPs in farm animal production is their potential for minimal impact on host cells. For example, the aforementioned Halictine-2 variant P5T exhibited negligible hemolytic activity against human erythrocytes and low cytotoxicity toward mouse macrophages, suggesting a favorable safety profile [55]. This selectivity is crucial for developing antiparasitic treatments that can be safely administered to livestock without detrimental effects on animal health or product quality.

2.4. Synthetic AMPs in Farm Animals

There is growing research into synthetic AMPs formulated for animal feed to improve livestock health and reduce antibiotic use, though specific commercial products are still emerging [58].
Cathelicidins are a group of AMPs, including synthetic derivatives such as Bac2A and IDR-1018, derived from bovine cathelicidins. They have demonstrated antibacterial activity and immunomodulatory effects, making them candidates for replacing antibiotics in animal feed and treatment [58,59].
Synthesized AMPs such as protegrin-1 (PG-1) have shown remarkable efficacy in veterinary applications, with transgenic mice expressing PG-1 exhibiting enhanced resistance against Actinobacillus suis infection compared to wild-type counterparts [60]. Other notable synthetic AMPs include BMAP-27 and BMAP-28 from bovine myeloid cells, which effectively inhibit multidrug-resistant bacterial strains in livestock, particularly against pathogens like methicillin-resistant Staphylococcus aureus [61] and pan-drug-resistant Acinetobacter baumannii [62].
In poultry production, synthetic AMPs such as SGAMP derived from porcine intestines have demonstrated higher feed efficiency in broilers under conditions of chronic heat stress [63], while also showing positive effects against infectious bronchitis virus in chickens [64]. These synthetic peptides are increasingly being incorporated into animal feed formulations as alternatives to antibiotic growth promoters, helping to maintain gut health, boost immunity, and prevent bacterial inflammation without contributing to antimicrobial resistance [65].
Ultimately, antimicrobial peptides offer multifaceted benefits in farm animal production as alternatives to conventional antimicrobial drugs for controlling bacterial, fungal, and parasitic infections. The diverse mechanisms of action of AMPs, their selectivity toward microbial targets, and limited propensity to induce resistance make them attractive alternatives to conventional antimicrobial drugs. Their efficacy against a wide range of pathogens, along with their immunomodulatory functions, contributes to improved animal health, productivity, and food safety.

3. Antibiotics, Antifungals, and Antiparasitic Drugs in Farm Animal Production

The widespread administration of antibiotics, antifungals, and antiparasitic drugs to farm animals serves multiple purposes: treating infections, preventing diseases, and in some countries, promoting growth. However, these practices have increasingly raised concerns about their contribution to global antimicrobial resistance (AMR) and other public health challenges.

3.1. Antibiotics in Farm Animal Production

The agricultural industry utilizes approximately 70% of all globally produced antibiotics, creating selective pressure for resistant bacterial strain development that can be transmitted to humans through direct contact, contaminated food, or environmental exposure [25,41]. Bacterial resistance mechanisms include enzymatic degradation, target modification, reduced membrane permeability, efflux pump activation, and horizontal gene transfer, which accelerates resistance spread beyond vertical transmission (Figure 6) [41]. Regulatory frameworks have emerged in response, with the EU banning antibiotic growth promoters in 2006 and the US introducing the Veterinary Feed Directive in 2017, though global consumption continues rising in emerging economies with less stringent regulations [25].
Common agricultural antibiotics include β-lactams, tetracyclines, macrolides, and fluoroquinolones, many critical for human medicine, raising cross-resistance concerns [25]. Specific pathogens demonstrate concerning resistance patterns, such as Salmonella Infantis in broiler flocks (3.7% flock-level prevalence in Netherlands) carrying pESI-like mega-plasmids with genes for antibiotic resistance, virulence, and fitness, showing resistance to aminoglycosides, sulphonamide, tetracycline (93%), trimethoprim (71%), and fluoroquinolones [67]. Following Korea's 2011 ban on antimicrobial growth promoters, Clostridium perfringens isolates showed increased resistance to multiple antimicrobials, with significantly higher resistance to gentamicin, clindamycin, and virginiamycin in isolates from chickens with necrotic enteritis compared to those from healthy chickens [68].
Antimicrobial agents can have a significant impact on the animal gut microbiota. Antibiotics like enrofloxacin or doxycycline administered to APEC-infected turkeys altered cecal microbiota metabolic activity and disrupted short-chain fatty acid production [69]. Conversely, studies have demonstrated that authorised salinomycin treatment enriches Bacteroidetes in the cecal microbiota of broilers, whereas vaccinated birds exhibit higher abundances of Firmicutes and Proteobacteria. Notably, the enrichment of Bacteroidetes correlates with improved growth performance in salinomycin-supplemented birds [70,71,72]. Similarly, Ferulago angulata extract (400 mg/kg) positively influenced immune status, growth performance, and intestinal microbiota in Campylobacter-infected broilers, reducing C. jejuni and coliform populations with performance comparable to salinomycin [73]. Also, recent research has identified salinomycin as a prospective antiviral compound that actively inhibits porcine epidemic diarrhea virus (PEDV) replication in Vero cells in a dose-dependent manner [74].
Antibiotic growth promoters (AGPs) such as flavophospholipol and virginiamycin are known to induce dynamic microbial shifts in broiler chickens, potentially enhancing anti-inflammatory pathways and nutrient absorption. However, virginiamycin has also been associated with increased colonization by potentially pathogenic bacteria, including Clostridium perfringens, Campylobacter, and Escherichia/Shigella species [75]. Among these, Campylobacter poses a notable public health risk. Studies have shown that dairy cattle can act as reservoirs for C. jejuni strains genetically similar to those infecting humans. Additionally, beef cattle farms have been found to harbor antibiotic-resistant Campylobacter isolates [76]. In a related shift in our understanding of ruminal microbiota, recent research has demonstrated that standard enrichment methods intended to isolate Fusobacterium necrophorum actually favor the growth of F. varium instead. This finding suggests a potential paradigm shift in our understanding of the rumen ecosystem and its implications for cattle health [77].
Exposure to monensin can select for resistant Staphylococcus aureus mutants showing increased growth rates and virulence, with resistance associated with derepression of de novo purine synthesis through mutations in transcriptional regulators like purR [78]. When broilers were infected with coccidiosis, researchers observed microbiota shifts with increases in Erysipelotrichaceae, Lactobacillaceae, Bacteroidaceae, Streptococcaceae, and Peptostreptococcaceae in both control and monensin groups, while functional oil blend supplementation partially mitigated these variations [79,80].
Flavophospholipol shows application in controlling resistance, with studies demonstrating that 64 ppm supplementation significantly suppressed increases in tetracycline-resistant E. coli in pig feces by inhibiting conjugational transfer and growth [81]. Similarly, flavophospholipol (64 ppm) reduced the acquisition of resistance to ampicillin, streptomycin, and tetracycline by recipient Salmonella Enteritidis strains in chickens [82]. However, flavophospholipol treatment in Salmonella Typhimurium-contaminated pigs increased Proteobacteria while decreasing Firmicutes and Roseburia, suggesting possible dysbiosis, though Lactobacillus abundance increased [83].
Alternative approaches include synbiotics, with research showing that Lactobacillus reuteri, Enterococcus faecium, Bifidobacterium animalis, and Pediococcus acidilactici culture supernatants decreased Clostridium perfringens proliferation in vitro, while in vivo supplementation increased villi height, reduced IL-1 mRNA, increased IL-10 mRNA, lowered cecal C. perfringens loads, and increased bile anti-C. perfringens IgA [84]. Sophorolipids have shown prospective antimicrobial activity against Eimeria maxima and Clostridium perfringens while improving gut health in necrotic enteritis-afflicted broilers [32].
Cross-disciplinary research has identified COVID-19 drug repurposing candidates that regulate genes related to cholesterol homeostasis and microtubule cytoskeleton organization (36% of active compounds), potentially offering new approaches to antimicrobial resistance [85].

3.2. Antifungals in Farm Animal Production

Fungal diseases pose significant threats to human, animal, and food security globally, with limited antifungal options leading to cross-use between agriculture and healthcare, promoting resistance (Figure 7) [86,87]. Climate change exacerbates these challenges by promoting thermotolerance in fungal pathogens and the emergence of resistant species, while agricultural antifungals similar to those in human medicine contribute to resistance in environmental fungi [88].
Veterinary antifungal use faces numerous challenges, including limited registered products, mechanism-of-action concerns, side effects, and withdrawal periods, with a notable lack of comprehensive surveillance compared to antibiotics [90]. Quantitative data reveals minimal usage in companion animals, with fungicide azoles constituting 37% of 2.05 tons of veterinary antifungals sold in France in 2022 [90]. Cross-resistance between agricultural fungicides and medical antifungals presents serious concerns, particularly with triazoles and examples like potential cross-resistance between ipflufenoquin and olorofim [88].
Fungal infections in farm animals range from superficial to systemic, with Candida tropicalis emerging as a significant azole-resistant pathogen in dairy cow mastitis [91]. Aspergillosis occurs frequently in companion and zoo animals but less in livestock, though poultry farms often have high environmental Aspergillus spore loads [90]. A Netherlands study found 11.3% of veterinary Aspergillus fumigatus isolates were azole-resistant across various animals, with resistance primarily cyp51A mediated [92]. Trichophyton mentagrophytes in pigs demonstrates concerning zoonotic potential, with documented transmission to farm workers [93].
Treatment approaches include various azoles (itraconazole being most common) and traditional amphotericin (AmB), though the latter often proves ineffective, and azole overuse leads to resistance [90,93,94]. Advancing alternatives include nanotechnology-enabled antifungals such as metal/metal oxide nanocomposites and nanoemulsions with high antimicrobial activity [94]. Novel antifungals with veterinary potential include fosmanogepix for drug-resistant mold infections, olorofim for endemic fungi, and inhaled formulations like opelconazole for respiratory fungal infections [88].
Preventive measures and future directions encompass improved housing, proper hygiene, appropriate stocking densities, environmental disinfection, novel compounds like 1,2,4-triazolyl-α-amino acids and dipeptides, and regular surveillance of resistance patterns [46,92,93].

3.3. Antiparasitic Drugs in Farm Animal Production

Parasitic infections pose significant challenges to livestock production worldwide, affecting animal health, welfare, and productivity, with the emergence of drug resistance (Figure 8) threatening the sustainability of parasite control strategies [95]. Major parasitic threats include gastrointestinal nematodes like Teladorsagia circumcincta in sheep and goats and Ascaridia galli in poultry, with A. galli becoming more prevalent following EU welfare regulations (Directive 1999/74/EC) that transitioned from unfurnished cages to more animal-friendly housing systems with litter, increasing parasite exposure [95,96].
Eimeria tenella is one of the most virulent species of coccidia affecting poultry, specifically targeting the ceca of chickens and causing hemorrhagic pathologies [98]. This obligate intracellular protozoan parasite is responsible for significant economic losses to the global poultry industry, with an estimated annual cost exceeding 3 billion USD worldwide [98]. As reported by Rogala-Hnatowska et al., salinomycin is a commonly used poultry feed supplement against Eimeria spp. in broiler chickens [99]. Alternative control measures, including dietary polyherbal formulations, have shown prospective results in decreasing the impact of eimeriosis on broilers by exerting coccidiostatic effects against E. tenella and other Eimeria species [100].
The impact of parasitic infections extends beyond terrestrial livestock to aquaculture (Table 2), where Ichthyophthirius multifiliis (Ich) causes white spot disease in fish worldwide, resulting in severe economic losses with high morbidity and mortality rates [101]. Parasitic infections cause significant damage, as seen with A. galli larvae penetrating the intestinal mucosa and causing inflammation, reduced nutrient absorption, and potential mortality, while Ich invades the epithelial layer of fish gill and skin, triggering both innate and adaptive immune responses [95,101].
Control of parasitic infections has traditionally relied on anthelmintic drugs, including benzimidazoles (fenbendazole, flubendazole), imidazothiazoles (levamisole, pyrantel), and macrocyclic lactones, but their efficacy is increasingly threatened by resistance development from intensive selection through repeated treatments [95]. The faecal egg count reduction test (FECRT) serves as the primary diagnostic tool for detecting anthelmintic resistance at the farm level, necessitating standardized experimental design and statistically rigorous susceptibility classification methods [102].
Concerning limitations exist in available treatments, with only benzimidazoles approved for poultry in the EU and US, administered via drinking water with risks of underdosing, repeated treatments (up to six times per production cycle), and exposure to uniform selection pressure [95]. Evidence of resistance is mounting, with T. circumcincta showing resistance to multiple drug classes (F200Y and E198L mutations in the beta-tubulin isotype 1 gene found in benzimidazole-resistant isolates) and documented resistance of Ascaridia dissimilis to fenbendazole in turkeys, while aquaculture faces challenges with chemical treatments raising food safety and environmental concerns [95,96,101].
Alternative approaches to combat resistance include plant-derived compounds like Licochalcone A (Lic A), a licorice-derived flavonoid showing potent activity against Giardia duodenalis (IC50 27.42 μM, outperforming metronidazole's 35.05 μM) by inhibiting trophozoite adhesion, causing structural damage, mitigating weight loss in infected animals, reducing intestinal parasite load, and enhancing host antioxidant capacity [103].
Targeted treatment (TT) approaches offer therapeutic potential for reducing anthelmintic resistance by deworming animals based on infection severity evidence rather than calendar-based blanket treatments, maintaining a pool of unselected parasites in refugia to reduce resistance development risk [95]. TT implementation requires reliable diagnostics including post-mortem examination, coproscopic analyses, serological tests, and molecular tools like McMaster, Mini-FLOTAC, digital droplet PCR, and LAMP-LFD assays [95]. Studies using 200 eggs per gram of feces as a treatment threshold showed lower worm burdens, fewer cumulative fecal eggs, higher egg production, better feed conversion, and improved plumage condition compared to conventional approaches [95].
Advanced genomic analyses provide insights into resistance mechanisms and host-parasite interactions, with chromosome-scale genome assemblies revealing genes associated with resistance in T. circumcincta and transcriptomic analyses showing upregulation of immunity-related genes in Ich-infected fish [96,101].
Sustainable parasite control requires continued research into novel agents with multiple mechanisms of action, prudent use of existing drugs, targeted treatment approaches, and improved understanding of resistance genetics to address the critical challenges facing livestock and aquaculture production.

4. Prospects of Antimicrobial Peptides Compared to Antibiotics in Treating Livestock Diseases

4.1. Antimicrobial Peptides as Alternatives to Conventional Antibiotics

Antibiotics have been extensively used as growth promoters in livestock production, substantially reducing production costs, morbidity, and mortality while promoting animal production performance [104]. The widespread emergence of antimicrobial resistance (AMR) presents a significant challenge to both human and animal health, with alarming projections suggesting that AMR could be responsible for approximately 10 million deaths by 2050 if effective countermeasures are not implemented [58]. This silent pandemic has particularly affected the livestock industry, where the excessive and imprudent use of antibiotics has contributed to the rise of multidrug-resistant (MDR) bacterial strains and contamination of animal products with antibiotic residues [58]. In 2010, China, the United States, Brazil, India, and Germany were the top five countries for antimicrobial consumption in food animals, accounting for 23%, 13%, 9%, 3%, and 3% of total consumption, respectively, with projections showing increases for China (30%), the United States (10%), Brazil (8%), India (4%), and Mexico (2%) by 2030 [58].
Within this context, antimicrobial peptides (AMPs) have emerged as noteworthy alternatives to conventional antimicrobial drugs. One of the most significant advantages of AMPs over traditional antibiotics lies in their mechanism of action. While conventional antibiotics typically target specific bacterial metabolic pathways or growth processes through interaction with protein receptors, AMPs primarily interact with negatively-charged bacterial cell wall and membrane due to their positive charge and hydrophobicity [105]. This fundamental difference makes it considerably more difficult for microbes to develop resistance to AMPs, as doing so would require complex modifications to membrane and cell wall components [105]. Additionally, unlike many primarily bacteriostatic antibiotics (inhibiting bacterial growth), AMPs often exhibit bactericidal properties, directly killing pathogens (Figure 9) [58].
AMPs typically exhibit broad-spectrum activity against both Gram-positive and Gram-negative bacteria, as well as fungi, viruses, and parasites [104]. Many AMPs are also effective against antibiotic-resistant bacteria due to their unique mechanisms of action, providing a solution for infections caused by multidrug-resistant pathogens [104]. Additionally, AMPs generally exhibit low toxicity toward eukaryotic cells, making them safer for use in food-producing animals compared to some antibiotics [104].
Beyond their direct antimicrobial activity, AMPs demonstrate a remarkable range of additional biological functions that enhance their therapeutic potential. They can act as immunomodulators, influencing processes such as phagocytosis, cytokine release, and cell apoptosis [58]. They also function as chemotactic factors, facilitating the recruitment and aggregation of immune cells at sites of inflammation [58]. Furthermore, AMPs promote angiogenesis and wound healing through cytokine release and cell proliferation, providing comprehensive support for recovery from infection [58].
Farm animals harbor a diverse array of AMPs that contribute to their natural defense systems. In bovines, significant AMPs include indolicidin, bovine myeloid antimicrobial peptides (BMAPs), tracheal antimicrobial peptide (TAP), lingual antimicrobial peptide (LAP), and various bovine neutrophil β-defensins [58]. Equines produce unique AMPs such as equine cathelicidins (eCATH1, eCATH2, eCATH3), equine neutrophil antimicrobial peptides (eNAP-1, eNAP-2), and equine hepcidin [58]. Porcine species generate protegrins, PR-39, prophenin-1, cecropin P1, and porcine myeloid antimicrobial peptides, while ovine and caprine animals produce various cathelicidins and β-defensins [58].
Specific bovine AMPs have shown particular efficacy against bovine respiratory disease (BRD) pathogens. BMAP-28 (bovine myeloid antimicrobial peptide-28), a synthetic BMAP-28 analog called Syn-1, and bactenecin 5 (Bac-5) have demonstrated significant antibacterial activity against Mannheimia haemolytica, a primary bacterial pathogen in BRD. BMAP-28 has also shown effectiveness against bovine herpes virus-1 (BHV-1) and bovine respiratory syncytial virus (BRSV), indicating potential broad-spectrum activity against both bacterial and viral BRD pathogens [42]. Furthermore, when BMAP-28 and Bac-5 were used in combination, a synergistic effect was observed, allowing for significantly reduced concentrations of both peptides while maintaining antimicrobial efficacy. This combination approach could potentially address concerns about cytotoxicity that occur at higher concentrations of individual AMPs [42].
A particularly prospective antimicrobial peptide for livestock applications is thanatin, which has shown substantial antibacterial efficacy against livestock pathogens. Research by Javadmanesh et al. (2021) demonstrated that thanatin exhibited strong antimicrobial activity against various livestock pathogens with minimum inhibitory concentration (MIC) values ranging from 6.25 to 100 μg/mL. The peptide showed especially potent activity against Escherichia coli O157:H7 and Salmonella Enteritidis from cattle mastitis (MIC of 6.25 μg/mL) [106]. Additionally, thanatin displayed remarkable thermal stability at normal body temperatures of dairy cattle (37°C) and avian species (42°C), maintaining its structural integrity and antimicrobial function, which is a crucial characteristic for applications in animal health [106].
Recent research has also shown that antimicrobial peptides can act on the rumen microbiome and metabolome, affecting the performance of cattle. In a study with castrated bulls, antimicrobial peptide supplementation improved daily weight gain, carcass weight, and net meat weight of the experimental animals [107]. The study also found that antimicrobial peptides increased the rumen papillae diameter and micropapillary density, which could enhance nutrient absorption [107]. Furthermore, the content of digestive enzymes such as protease, xylanase, and β-glucosidase was higher in the antimicrobial peptide-supplemented group, potentially improving feed utilization [107]. Metagenomic analysis revealed that antimicrobial peptides had a specific antimicrobial mechanism, effectively killing viruses and harmful bacteria while sparing beneficial bacteria [107]. Importantly, the study demonstrated that antimicrobial peptides could enhance immunity without developing drug resistance [107].
Studies in pigs have also provided encouraging results for the application of AMPs in livestock production. A study examining porcine intestinal antimicrobial peptide (PIAP) as an in-feed antibiotic alternative showed beneficial effects on intestinal morphology, digestive enzymes, immunity, and gut permeability in weaned piglets. Specifically, a relatively low dose of PIAP (400 mg/kg from day 1 to 24; 300 mg/kg from day 25 to 37) significantly improved intestinal villus height-to-crypt depth ratio, increased the activity of digestive enzymes including maltase, lactase, and sucrase, and enhanced secretory immunoglobulin A (SIgA) levels compared to control groups [108]. Additionally, PIAP supplementation was associated with increases in beneficial gut bacteria like Lactobacillus reuteri, which showed positive correlations with improved digestive enzyme activities and SIgA levels [108].
Comprehensive meta-analyses of antimicrobial peptides in piglets has provided further evidence of their efficacy as antibiotic substitutes [109,110]. The analysis included data from 56 trials involving 4,067 piglets and revealed that AMPs significantly improved healthy piglets' average daily gain (ADG), average daily feed intake (ADFI), gain:feed ratio (G/F), immunoglobulin levels (IgM and IgG), and intestinal villus height:crypt depth ratio (V/C) compared to negative control groups [109]. In infected piglets, AMPs significantly increased ADG, ADFI, G/F, and V/C of the jejunum and ileum, while notably decreasing diarrhea rates [109]. When compared to antibiotics, AMPs showed slightly weaker effects in healthy piglets but demonstrated similar efficacy to antibiotics in infected piglets [109]. The optimal dose of highly purified AMPs was determined to be approximately 0.01% [109].
In livestock production, insect meals have emerged as another potential source of AMPs, providing both a protein supplement and potential antimicrobial benefits. Studies have shown that insect meals can positively influence gastrointestinal microbiota, strengthen immunity, and increase antibacterial activity in farm animals. Animals fed with insect meals have demonstrated improved intestinal health, with changes in gut microflora, enhanced immune response, and greater resistance to pathogens [111]. Insects produce the largest number of identified antimicrobial peptides in the animal kingdom, making them an excellent source for novel antimicrobial compounds. These insect-derived AMPs are categorized into major groups including defensins (cysteine-rich peptides), cecropins (α-helical AMPs), moricins, proline-rich peptides, and glycine-rich peptides, each with distinctive structures and mechanisms of action [111].
The black soldier fly (Hermetia illucens) has garnered particular attention as a sustainable source of AMPs. These insects naturally thrive in microbe-rich environments and have evolved robust antimicrobial defense systems. Xia et al. (2021) describe how antimicrobial peptides from black soldier fly have great potential as alternatives to antibiotics for prophylaxis and treatment of diseases in animals due to their extensive antimicrobial properties and lower tendency to induce resistance. Their study highlights that black soldier fly larvae can participate in a circular economy by digesting organic waste and then promoting the growth performance of domestic animals fed the larvae [112]. This approach creates a sustainable cycle where waste is converted to valuable antimicrobial protein sources for livestock.

4.2. Antifungal and Antiparasitic Properties of AMPs and Their Relevance

A significant advantage of many AMPs is their broad-spectrum activity not only against bacteria but also against fungi, which represents an important consideration for livestock health management. Buda De Cesare et al. [47] emphasize that while current research often focuses on antibacterial peptides, there are many with antifungal properties that represent important potential additions to the antimicrobial arsenal.
Fungal infections in livestock can cause significant economic losses and health problems, yet they have received less attention compared to bacterial infections. Cathelicidin-inspired “PepBiotics” have shown remarkable efficacy against fungi, including azole-resistant strains, suggesting their potential in addressing these challenges [113].
Understanding the antifungal mechanisms of cathelicidin-inspired AMPs is crucial for their application in livestock disease management. Research indicates that AMPs kill target cells through diverse mechanisms, primarily by disrupting the membrane and cell wall, but they can also target key cellular processes, including DNA and protein synthesis, protein folding, cell wall synthesis, and enzymatic activity [113, page 1074]. The broad-spectrum antifungal activity of cathelicidins has been demonstrated against medically relevant fungal species, including species of Aspergillus, Candida, Cryptococcus, Fusarium, Malassezia, and Talaromyces [113].
A study by van Eijk and colleagues demonstrated that cathelicidin-inspired antimicrobial peptides termed “PepBiotics” showed strong inhibitory activity against a variety of filamentous fungi and yeasts at low concentrations (≤1 μM), including azole-resistant Aspergillus fumigatus isolates [113]. Cytotoxicity testing of PepBiotics on primary human nasal epithelial cells has shown that many of these compounds have no significant cytotoxic effect at concentrations effective against pathogens [113]. This favorable safety profile further supports their potential for livestock applications, where safety for the treated animals and the absence of harmful residues in animal products are crucial considerations.
Regarding antiparasitic activity, AMPs have also demonstrated significant potential as alternatives to conventional antiparasitic drugs, which is particularly relevant in livestock production, where parasitic diseases can cause substantial economic losses. Parasitic protozoa can cause diseases in humans and animals through various routes, including animal-to-person or person-to-person contact, water, soil, and food [44]. With the increase in parasite drug resistance, the need for new treatments has intensified. Antiparasitic peptides show killing effects on parasites that cause diseases such as malaria and leishmaniasis [44], and AMPs like cathelicidin and temporins-SHd show high inhibitory activity against various parasites [44].
The peptide Jellein derived from bee royal jelly and a 4-amino acid AMP called KDEL (lysine, aspartic acid, glutamic acid, and leucine) have shown significant effects against Leishmania parasites [57]. However, it should be noted that their mechanisms of action differ. Cyanobacterial peptides differ from higher-eukaryote AMPs because their antiparasitic action depends on specific protein targets. This allows these peptides to distinguish accurately between target parasites even when they belong to the same family or genus [57]. The distinctive mechanism of action of cyanobacterial peptides offers a precision tool for addressing specific parasitic infections in livestock, potentially allowing for more targeted treatment approaches compared to conventional broad-spectrum antiparasitic drugs. This specificity could be particularly valuable in minimizing disruption to beneficial microbiota in the host animal while effectively eliminating pathogenic parasites.

4.3. Addressing Challenges: Enhancing AMP Stability via Self-Assembly

Despite their considerable potential, several challenges have limited the clinical translation of AMPs. Stability is a primary concern, as AMPs are often rapidly cleared from the bloodstream through enzymatic degradation, renal filtration, and uptake by the reticuloendothelial system [105]. To address this, researchers have explored nanotechnology approaches, particularly self-assembly strategies, to enhance AMP stability and prolong their half-lives [105]. For example, self-assembled peptide CPC-1 demonstrated a fourfold increase in half-life retention at infection sites compared to non-self-assembled variants [105]. Similarly, peptide PTP-7 showed significant improvements in serum stability, extending from 2 hours to more than 5 hours through self-assembly technology [105].
Recent innovations in self-assembly technology have led to the development of AMPs that can transform from nanoparticles to nanofibers in response to bacterial cell wall components like lipopolysaccharides (LPS) and lipoteichoic acid (LTA) [105, page 2-3]. These transformations enhance stability and enable bacterial capture through nanofibrous networks, complementing traditional membrane-disruption mechanisms [105]. For instance, the self-assembled peptide FFN can form nanoparticles at concentrations as low as 35.46 μM and dynamically transform into nanofibers when exposed to bacteria, resulting in significant improvements in stability against trypsin and tissues compared to non-assembled peptides [105].
Several AMP-based products have already reached clinical application, including dalbavancin, daptomycin, and nisin, demonstrating the feasibility of translating these compounds into commercial therapeutics [105]. In veterinary medicine, AMPs show particular prospects for treating mastitis, a common and economically significant infection in dairy cattle [105]. Studies using mouse models have shown that self-assembled AMPs can effectively alleviate mastitis caused by MDR Escherichia coli and Staphylococcus aureus by eliminating pathogenic bacteria, reducing inflammatory markers, and preserving mammary tissue integrity [105].
One significant advantage of AMPs is that their non-specific mechanism of action through electrostatic interactions with microbial membrane and cell wall reduces opportunities for resistance development, unlike conventional antibiotics [111]. Practical applications in farm settings have already shown that supplementing animal feed with AMPs can reduce the incidence of diarrhea, improve growth performance, and enhance intestinal function in weaned piglets, demonstrating their potential as viable alternatives to conventional antibiotics in commercial production settings [108].
Continued advancements in peptide design, self-assembly technologies, delivery systems, and combination approaches will likely enhance the stability, efficacy, and cost-effectiveness of AMP-based therapeutics. By providing effective antimicrobial, antifungal, and antiparasitic solutions with reduced risk of resistance development, AMPs represent a valuable tool in preserving the efficacy of conventional drugs for critical applications while maintaining animal health and productivity in sustainable agriculture systems.

5. Nano-Enabled Polymeric Systems for Pathogen Control in Animal Farming

The application of nanotechnology in veterinary medicine has been expanding as researchers explore various nano-systems including liposomes, metallic nanoparticles, polymeric micelles, nanospheres, functionalized fullerenes, carbon nanotubes, dendrimers, polymer-coated nanocrystals, and nanoshells [114]. These nanotechnology applications are particularly valuable for animal health and production, as they can help solve problems related to delivering antibiotics that suffer from poor bioavailability and numerous side effects. Nanoparticles are characterized by their minimal size and large surface area to mass ratio, making them effective delivery systems for antimicrobials in treating microbial diseases by enhancing therapeutic effects while overcoming side effects [114].
The veterinary applications of various nanoparticles extend to different animal farming contexts, with research addressing therapeutic, preventive, and diagnostic indications [114]. Nanoparticles used for therapeutic purposes in veterinary medicine can control drug release, target neurotic sores effectively, improve medication bioavailability, and reduce required treatment dosages, which has significant economic benefits. They also enable the treatment of intracellular pathogens like Brucella and Leishmania, as well as multi-antibiotic-resistant pathogens such as methicillin-resistant Staphylococcus aureus (MRSA) [114].
Nanoparticles in association with antimicrobial peptides, termed NanoAMPs, offer versatile structures for the protection and controlled release of AMPs [115]. These NanoAMPs can overcome challenges associated with traditional AMP applications, such as reduced defensive activity due to degradation when exposed to microbial proteases or environmental conditions [115]. In the context of animal farming, NanoAMPs could provide sustained antimicrobial action against common pathogens while minimizing the development of resistance.
Polymers, including polyethylene glycol (PEG), poly lactic-co-glycolic acid (PLGA), chitosan, poly-L lysine (PLL), and hyper-branched polyglycerol (HPG), have been extensively employed in AMP drug delivery systems. These polymers act as carriers, protecting peptides from degradation and facilitating their delivery across the cell wall and cellular membrane to specific target sites [116]. Polymer-AMP conjugates can significantly improve antimicrobial efficacy while reducing potential toxicity concerns.
The use of polymer nanocarriers for drug delivery offers numerous advantages, including protection from degradation, controlled release, and increased bioavailability in tissues and cells [4]. For instance, chitosan nanoparticles (CS NPs) have been widely studied for delivering various essential oils with antimicrobial properties. These CS-NPs systems demonstrate improved efficacy against pathogenic bacteria while preserving beneficial intestinal flora bacteria such as Lactobacillus spp. [4]. Studies conducted on poultry show that nanoencapsulation of essential oils in chitosan carriers improves body weight gain, feed conversion ratio, and feed intake in broiler chickens [4].
Chitosan (CS) is a natural, positively charged cationic polymer with a broad spectrum of antimicrobial properties that works by associating with negatively charged particles on bacterial cell surfaces, though its antibacterial ability on its own is limited [117]. When combined with gold nanoparticles (AuNPs) through electrostatic interactions, CS-AuNPs show enhanced antimicrobial activity by disrupting the bacterial cell wall and membrane [117]. This synergistic effect between the gold core and surface ligands creates a more potent antimicrobial system that effectively kills bacteria, including methicillin-resistant Staphylococcus aureus (MRSA), which is particularly problematic in animal agriculture [117].
Several polymeric nanoparticles functionalized with AMPs have demonstrated remarkable potential for pathogen control. For instance, PLGA nanoparticles loaded with LL37 (a human cathelicidin AMP) have shown significant antimicrobial activity against Escherichia coli while accelerating wound healing [116]. PLGA has been recognized as a biocompatible, biodegradable polymer approved by regulatory agencies for biomedical applications, making it suitable for veterinary use [4]. The release of essential oils from PLGA nanoparticles typically follows a biphasic pattern with an initial burst effect, followed by a slower, sustained release [4].
A novel nano-antimicrobial polymer engineered with chitosan nanoparticles and bioactive peptides has demonstrated significant potential as a food biopreservative for controlling foodborne pathogens. In a recent study, researchers developed chitosan nanoparticles with the antimicrobial peptide microcin J25 (CNMs) which showed excellent bactericidal activity against E. coli O157, a critical foodborne pathogen that causes food contamination, diarrhea, and death in humans, neonates, and weaned animals [118]. The CNMs protected against E. coli O157-induced intestinal barrier dysfunction by increasing transepithelial electrical resistance, decreasing lactate dehydrogenase release, and promoting the expression of tight junction proteins like occludin. Additionally, they ameliorated inflammation by modulating inflammatory cytokines and inhibiting mitogen-activated protein kinase and NF-κB activation [118].
Metal and metal oxide nanoparticles, particularly silver nanoparticles, have exhibited strong antimicrobial properties by disrupting bacterial cell walls and membranes. When functionalized with AMPs, these nanoparticles have demonstrated potent effects in killing mycobacteria without causing cytotoxicity or DNA damage [116]. Silver nanoparticles (AgNPs) are known to damage the structure of the bacterial cell wall and membrane and depress the activity of membranous enzymes. Several studies have shown that AgNPs can interact with sulfur-containing proteins in bacterial membrane and with phosphorus groups in cell DNA, preferably attacking the respiratory chain and cell division processes [8]. Gold nanoparticles (AuNPs), while not inherently antimicrobial, can be modified with ligands to achieve potent bactericidal effects through direct multivalent interactions with the bacterial membrane [117]. The morphology of bacterial strains treated with CS-AuNPs shows significant disruption, characterized by cell membrane collapse and rupture [117].
Polymeric nanofibers incorporating AMPs have also shown capability for pathogen control. These nanofibers can be designed to release AMPs over extended periods, maintaining their antimicrobial activity. For example, plantaricin 423 and ST4SA (bacteriocins with antimicrobial properties) incorporated into poly D, L-lactide and polyethylene oxide nanofibers have demonstrated effective control of microbial infections [116]. Similarly, cellulose nanofibers incorporating essential oils like thyme have shown antibacterial properties against both Gram-positive and Gram-negative bacteria [4].
Liposomal formulations of AMPs represent another prospective approach for pathogen control in animal farming. Liposomes can extend the drug half-life, improve biocompatibility, and reduce the toxicity of encapsulated AMPs [116]. For instance, liposome-encapsulated nisin (an antimicrobial peptide commonly used in food preservation) has shown enhanced efficacy against Listeria monocytogenes compared to free nisin [116]. The nanostructured lipid carriers loaded with essential oils can penetrate bacterial cells, disrupt biomembranes, release polypeptides into the medium, and decrease the ATP content of cells [4]. Lipid-based nanocarrier systems have been shown to provide sustained release of essential oils for improved therapeutic efficacy [4].
Hydrogels incorporating AMPs have demonstrated potential for wound healing applications that could benefit animal agriculture. These hydrogels can maintain antimicrobial activity while providing a moist environment conducive to healing [116]. For example, gelatin methacryloyl hydrogels loaded with antimicrobial peptides have shown biocompatibility, biodegradation, and promotion of wound healing in vivo [116]. Similarly, sodium alginate films loaded with essential oils have shown potential for wound dressings with antimicrobial properties against both Gram-positive and Gram-negative bacteria [4]. Hydrogel dressings can effectively soak up inflammatory exudates from wounds, preventing their accumulation and accelerating healing [117], which is particularly important in animal farming, where wound management is challenging.
In the field of nano-vaccines and nano-adjuvants, nanoparticles are increasingly used in veterinary vaccine production due to their ability to improve immunological responses, serving as adjuvants that allow for slow release of antigens, which enhances vaccine performance [114]. These include nano-emulsion vaccines, PLGA nanoparticle-loaded vaccines, chitosan nanoparticle vaccines, and gold nanoparticle-based vaccines for various animal diseases [114].
The application of NanoAMPs in agriculture could significantly impact food security by controlling phytopathogens and pests that cause substantial yield losses in major crops [115]. The same principles could be applied to animal farming, where infectious diseases can lead to significant economic losses and compromise animal welfare.
Recent advances in antimicrobial polymer-based assemblies have further expanded the toolkit available for pathogen control in animal farming. Carmona-Ribeiro and Araújo (2021) highlight that cationic antimicrobial polymers (APs) offer several advantages over AMPs, including lower manufacturing costs, resistance to proteolytic degradation, and the ability to be produced on a large scale following industrial synthetic protocols. These polymers typically contain cationic moieties such as quaternary ammonium, sulfonium, guanidinium, or phosphonium groups, along with hydrophobic components that facilitate interaction with the bacterial cell wall and membrane [119].
Zein, a protein derived from maize, has also been explored as a nanocarrier for essential oils in animal farming applications. Zein nanoparticles loaded with essential oils have shown bactericidal activity against pathogenic bacteria in fish, offering a potential alternative to antibiotics such as oxytetracycline, florfenicol, amoxicillin, and erythromycin in aquaculture [4]. These formulations demonstrate high encapsulation efficiency and maintain stability during storage for extended periods [4].
As a result, nano-enabled polymeric systems constitute a novel and prospective platform for controlling pathogens in animal farming by enabling targeted delivery, boosting antimicrobial efficacy, and minimizing ecological impact. The functionalization of such systems with AMPs via incorporation into various biomaterials, such as nanoparticles, liposomes, polymers, and hydrogels, further augments their therapeutic potential and stability [40]. Nonetheless, realizing their full potential requires overcoming several technical and regulatory challenges, including upscaling, economic feasibility, and environmental safety. Furthermore, their clinical applicability remains to be validated through comprehensive in vivo studies [115,120]. Finally, there is still a lack of essential data concerning resistance development rates and species-specific dosing strategies [4].

6. Advantages and Future Perspectives

One of the key advantages of AMPs is their potent antimicrobial activity against a broad spectrum of pathogens relevant to farm animal health. Studies have demonstrated their effectiveness against various Gram-positive bacteria, including Staphylococcus aureus, Bacillus cereus, Bacillus subtilis, Listeria monocytogenes, and Enterococcus faecalis [4]. They also show efficacy against Gram-negative bacteria such as Escherichia coli, Salmonella serovars (including S. Typhimurium and S. Enteritidis), Proteus mirabilis, Yersinia spp., Klebsiella pneumoniae, Shigella boydii, Acinetobacter anitratus, and Pseudomonas aeruginosa [4].
The mechanisms of action of AMPs are diverse and often involve targeting bacterial membrane and cell wall [23,40], which contributes to their effectiveness against multidrug-resistant pathogens. As described by Mishra et al. [14], most AMPs are cationic (positively charged) and amphipathic in nature, which enables them to interact with the negatively charged surfaces of microbial cell wall and membrane. Their amphipathic nature means they have both hydrophilic (water-loving) and lipophilic (fat-loving) properties, facilitating their interaction with the bacterial cell wall and membrane. Furthermore, AMPs possess immunomodulatory properties that extend beyond direct killing [12], enhancing their potential as therapeutic agents. For instance, porcine β-defensins (pBDs) have demonstrated both direct antimicrobial effects and the ability to modulate immune responses [12]. Recent advances in research have revealed that certain AMPs can overcome resistance mechanisms that affect conventional antibiotics, including vancomycin resistance in Staphylococcus aureus [40], making them valuable candidates for addressing the growing AMR crisis.
Despite these significant advantages, several challenges must be addressed before AMPs can be widely adopted in livestock production systems. While favorable in vitro results have been obtained for specific peptides like pBDs [12], more comprehensive quantitative studies and in vivo evaluations are needed before commercial application [4].
The stability and delivery of AMPs present another significant hurdle. These peptides can be susceptible to degradation by proteases in the gastrointestinal tract and may have limited bioavailability when administered orally [40]. Mishra et al. [14] point out that AMPs face several limitations that hinder their clinical applications, including their instability in clinically relevant environments, susceptibility to protease degradation, toxicity to host cells, and high development and production costs. To address these limitations, innovative delivery systems are being explored. Nanodelivery technologies, which have proven effective for other antimicrobial agents like essential oils, could potentially enhance the dispersibility, stability, and release kinetics of AMPs [4]. Such approaches could improve the efficacy and practical application of AMPs in livestock production systems.
The cost-effectiveness of AMP production also remains a concern for commercial applications [40]. Current production methods may be expensive compared to conventional antibiotics, potentially limiting widespread adoption. However, advances in biotechnology and the increasing scale of production could potentially reduce costs over time. Additionally, economic assessments of AMPs should consider not only direct production costs but also the broader economic benefits of reduced antimicrobial resistance [10].
The application of advanced techniques, including computational approaches and genomic tools, could accelerate the discovery and optimization of new AMPs with enhanced properties [40]. Additionally, interdisciplinary approaches combining insights from microbiology, immunology, and animal science could advance our understanding of AMP applications in livestock production systems.

7. Conclusions

Antimicrobial peptides represent a prospective alternative to conventional antibiotics in livestock production, with potential benefits for animal health, food safety, and addressing antimicrobial resistance. Their broad-spectrum antimicrobial activity, immunomodulatory properties, and ability to overcome resistance mechanisms make them attractive candidates for future applications. However, achieving their full potential will require addressing challenges related to delivery, stability, production costs, and in vivo efficacy.
As highlighted by Mishra et al. [14], strategies such as lipidation, modifying peptides into peptidomimetics, and combining AMPs with other peptides or conventional antibiotics offer opportunities to enhance their stability, safety, and efficacy, making them more suitable for clinical applications in livestock. The authors emphasize that the quest for new alternatives to treat infections should focus not only on AMPs but also on their combination with other active molecules.
Ultimately, evaluating both molecular outcomes and behavioral outcomes is necessary to fully assess the safety and efficacy of AMPs as alternatives to traditional antimicrobials in livestock sectors [2]. With continued research and development efforts, AMPs could play a significant role in sustainable livestock production systems while contributing to global efforts to combat antimicrobial resistance.

Author Contributions

Writing - original draft, Data curation, Visualization - AG; Supervision, Writing - review & editing - BG, SD, GS; Conceptualization, Supervision, Writing - review & editing, Data curation, Project administration - BG, GS . All authors have read and agreed to the published version of the manuscript.

Institutional Review Board Statement

Not applicable.

Data Availability Statement

The data used during the current study are available from the corresponding author upon request.

Acknowledgments

This work was conducted in UPIZ “Educational and Research Laboratory of Biology”- Master Faculty, New Bulgarian University and HUVEPHARMA.

Conflicts of Interest

The authors declare no conflicts of interest.

Abbreviations

The following abbreviations are used in this manuscript:
AMP Antimicrobial Peptide
AFP Antifungal Peptide
AMR Antimicrobial Resistance
HDP Host Defense Peptide
ROS Reactive Oxygen Species

References

  1. Ardakani, Z.; Aragrande, M.; Canali, M. Global Antimicrobial Use in Livestock Farming: An Estimate for Cattle, Chickens, and Pigs. Animal 2024, 18, 101060. [Google Scholar] [CrossRef] [PubMed]
  2. Sołek, P.; Stępniowska, A.; Koszła, O.; Jankowski, J.; Ognik, K. Antibiotics/Coccidiostat Exposure Induces Gut-Brain Axis Remodeling for Akt/mTOR Activation and BDNF-Mediated Neuroprotection in APEC-Infected Turkeys. Poultry Science 2025, 104, 104636. [Google Scholar] [CrossRef] [PubMed]
  3. Woo, W.-S.; Shim, S.H.; Kang, G.; Kim, K.-H.; Son, H.-J.; Sohn, M.-Y.; Lee, S.; Kim, J.; Seo, J.-S.; Kwon, M.-G.; et al. Assessment of Salinomycin’s Potential to Treat Microcotyle Sebastis in Korean Rockfish (Sebastes Schlegelii). Animals 2023, 13, 3233. [Google Scholar] [CrossRef] [PubMed]
  4. Dupuis, V.; Cerbu, C.; Witkowski, L.; Potarniche, A.-V.; Timar, M.C.; Żychska, M.; Sabliov, C.M. Nanodelivery of Essential Oils as Efficient Tools against Antimicrobial Resistance: A Review of the Type and Physical-Chemical Properties of the Delivery Systems and Applications. Drug Delivery 2022, 29, 1007–1024. [Google Scholar] [CrossRef]
  5. Veerapandian, R.; Abdul Azees, P.A.; Viswanathan, T.; Amaechi, B.T.; Vediyappan, G. Editorial: Developing Therapeutics for Antimicrobial Resistant Pathogens: Volume II. Front. Cell. Infect. Microbiol. 2025, 15, 1581237. [Google Scholar] [CrossRef]
  6. Allende, A.; Álvarez-Ordóñez, A.; Bortolaia, V.; Bover-Cid, S.; De Cesare, A.; Dohmen, W.; Guillier, L.; Herman, L.; Jacxsens, L.; et al.; EFSA BIOHAZ Panel (EFSA Panel on Biological Hazards) Occurrence and Spread of Carbapenemase-producing Enterobacterales (CPE) in the Food Chain in the EU/EFTA. Part 1: 2025 Update. EFSA Journal 2025, 23. [Google Scholar] [CrossRef]
  7. O’Neill, J. Review on Antimicrobial Resistance. Antimicrobial Resistance: Tackling a Crisis for the Health and Wealth of Nations. 2014.
  8. Kamaruzzaman, N.F.; Tan, L.P.; Hamdan, R.H.; Choong, S.S.; Wong, W.K.; Gibson, A.J.; Chivu, A.; Pina, M.D.F. Antimicrobial Polymers: The Potential Replacement of Existing Antibiotics? IJMS 2019, 20, 2747. [Google Scholar] [CrossRef]
  9. Silva, A.; Silva, V.; Pereira, J.E.; Maltez, L.; Igrejas, G.; Valentão, P.; Falco, V.; Poeta, P. Antimicrobial Resistance and Clonal Lineages of Escherichia coli from Food-Producing Animals. Antibiotics 2023, 12, 1061. [Google Scholar] [CrossRef]
  10. Acosta, A.; Tirkaso, W.; Nicolli, F.; Van Boeckel, T.P.; Cinardi, G.; Song, J. The Future of Antibiotic Use in Livestock. Nat Commun 2025, 16, 2469. [Google Scholar] [CrossRef]
  11. Wu, D.; Fu, L.; Wen, W.; Dong, N. The Dual Antimicrobial and Immunomodulatory Roles of Host Defense Peptides and Their Applications in Animal Production. J Animal Sci Biotechnol 2022, 13, 141. [Google Scholar] [CrossRef]
  12. Finatto, A.N.; Meurens, F.; De Oliveira Costa, M. Piggybacking on Nature: Exploring the Multifaceted World of Porcine β-Defensins. Vet Res 2025, 56, 47. [Google Scholar] [CrossRef] [PubMed]
  13. Debbarma, S.; Narsale, S.A.; Acharya, A.; Singh, S.K.; Mocherla, B.P.; Debbarma, R.; Yirang, Y. Drawing Immune-Capacity of Fish-Derived Antimicrobial Peptides for Aquaculture Industry: A Comprehensive Review. Comparative Immunology Reports 2024, 6, 200150. [Google Scholar] [CrossRef]
  14. Mishra, S.K.; Akter, T.; Urmi, U.L.; Enninful, G.; Sara, M.; Shen, J.; Suresh, D.; Zheng, L.; Mekonen, E.S.; Rayamajhee, B.; et al. Harnessing Non-Antibiotic Strategies to Counter Multidrug-Resistant Clinical Pathogens with Special Reference to Antimicrobial Peptides and Their Coatings. Antibiotics 2025, 14, 57. [Google Scholar] [CrossRef]
  15. UniProt. Available online: https://www.uniprot.org/ (accessed on 16 May 2025).
  16. García-Beltrán, J.M.; Arizcun, M.; Chaves-Pozo, E. Antimicrobial Peptides from Photosynthetic Marine Organisms with Potential Application in Aquaculture. Marine Drugs 2023, 21, 290. [Google Scholar] [CrossRef]
  17. Yan, C.; Chen, M.; Xu, H.; Jin, J.; Liu, X.; Wang, Z.; Zhang, D. A Hypothetical Protein Fragment from Large Yellow Croaker (Larimichthys Crocea) Demonstrates Significant Activity Against Both Bacterial and Parasite. Fishes 2025, 10, 109. [Google Scholar] [CrossRef]
  18. Chen, M.; Lin, N.; Liu, X.; Tang, X.; Wang, Z.; Zhang, D. A Novel Antimicrobial Peptide Screened by a Bacillus Subtilis Expression System, Derived from Larimichthys Crocea Ferritin H, Exerting Bactericidal and Parasiticidal Activities. Front. Immunol. 2023, 14, 1168517. [Google Scholar] [CrossRef]
  19. Lei, Y.; Qiu, R.; Shen, Y.; Zhou, Y.; Cao, Z.; Sun, Y. Molecular Characterization and Antibacterial Immunity Functional Analysis of Liver-Expressed Antimicrobial Peptide 2 (LEAP-2) Gene in Golden Pompano (Trachinotus Ovatus). Fish & Shellfish Immunology 2020, 106, 833–843. [Google Scholar] [CrossRef]
  20. Ortega, L.; Carrera, C.; Muñoz-Flores, C.; Salazar, S.; Villegas, M.F.; Starck, M.F.; Valenzuela, A.; Agurto, N.; Montesino, R.; Astuya, A.; et al. New Insight into the Biological Activity of Salmo Salar NK-Lysin Antimicrobial Peptides. Front. Immunol. 2024, 15, 1191966. [Google Scholar] [CrossRef]
  21. Fernandes, J.M.O.; Saint, N.; Kemp, G.D.; Smith, V.J. Oncorhyncin III: A Potent Antimicrobial Peptide Derived from the Non-Histone Chromosomal Protein H6 of Rainbow Trout, Oncorhynchus Mykiss. Biochemical Journal 2003, 373, 621–628. [Google Scholar] [CrossRef]
  22. García-Vela, S.; Ben Said, L.; Soltani, S.; Guerbaa, R.; Fernández-Fernández, R.; Ben Yahia, H.; Ben Slama, K.; Torres, C.; Fliss, I. Targeting Enterococci with Antimicrobial Activity against Clostridium Perfringens from Poultry. Antibiotics 2023, 12, 231. [Google Scholar] [CrossRef]
  23. Sengkhui, S.; Klubthawee, N.; Aunpad, R. A Novel Designed Membrane-Active Peptide for the Control of Foodborne Salmonella Enterica Serovar Typhimurium. Sci Rep 2023, 13, 3507. [Google Scholar] [CrossRef] [PubMed]
  24. Nguyen, T.T.T.; Allan, B.; Wheler, C.; Köster, W.; Gerdts, V.; Dar, A. Avian Antimicrobial Peptides: In Vitro and in Ovo Characterization and Protection from Early Chick Mortality Caused by Yolk Sac Infection. Sci Rep 2021, 11, 2132. [Google Scholar] [CrossRef] [PubMed]
  25. Satchanska, G.; Davidova, S.; Gergova, A. Diversity and Mechanisms of Action of Plant, Animal, and Human Antimicrobial Peptides. Antibiotics 2024, 13, 202. [Google Scholar] [CrossRef]
  26. Liu, Y.; Zai, X.; Weng, G.; Ma, X.; Deng, D. Brevibacillus Laterosporus: A Probiotic with Important Applications in Crop and Animal Production. Microorganisms 2024, 12, 564. [Google Scholar] [CrossRef]
  27. Hao, S.; Shi, W.; Chen, L.; Kong, T.; Wang, B.; Chen, S.; Guo, X. CATH-2-Derived Antimicrobial Peptide Inhibits Multidrug-Resistant Escherichia Coli Infection in Chickens. Front. Cell. Infect. Microbiol. 2024, 14, 1390934. [Google Scholar] [CrossRef]
  28. Bin Hafeez, A.; Jiang, X.; Bergen, P.J.; Zhu, Y. Antimicrobial Peptides: An Update on Classifications and Databases. IJMS 2021, 22, 11691. [Google Scholar] [CrossRef]
  29. Shen, S.; Ren, F.; He, J.; Wang, J.; Sun, Y.; Hu, J. Recombinant Antimicrobial Peptide OaBac5mini Alleviates Inflammation in Pullorum Disease Chicks by Modulating TLR4/MyD88/NF-κB Pathway. Animals 2023, 13, 1515. [Google Scholar] [CrossRef]
  30. Kathayat, D.; Closs, G.; Helmy, Y.A.; Lokesh, D.; Ranjit, S.; Rajashekara, G. Peptides Affecting the Outer Membrane Lipid Asymmetry System (MlaA-OmpC/F) Reduce Avian Pathogenic Escherichia Coli (APEC) Colonization in Chickens. Appl Environ Microbiol 2021, 87, e00567–21. [Google Scholar] [CrossRef]
  31. Wang, D.; Yu, P.; She, R.; Wang, K. Protective Effects of Rabbit Sacculus-Derived Antimicrobial Peptides on SPF Chicken against Infection with Very Virulent Infectious Bursal Disease Virus. Poultry Science 2024, 103, 103797. [Google Scholar] [CrossRef]
  32. Park, I.; Oh, S.; Nam, H.; Celi, P.; Lillehoj, H.S. Antimicrobial Activity of Sophorolipids against Eimeria Maxima and Clostridium Perfringens, and Their Effect on Growth Performance and Gut Health in Necrotic Enteritis. Poultry Science 2022, 101, 101731. [Google Scholar] [CrossRef]
  33. Chen, X.; Zhu, F.; Cao, Y.; Qiao, S. Novel Expression Vector for Secretion of Cecropin AD in Bacillus Subtilis with Enhanced Antimicrobial Activity. Antimicrob Agents Chemother 2009, 53, 3683–3689. [Google Scholar] [CrossRef] [PubMed]
  34. Wu, S.; Zhang, F.; Huang, Z.; Liu, H.; Xie, C.; Zhang, J.; Thacker, P.A.; Qiao, S. Effects of the Antimicrobial Peptide Cecropin AD on Performance and Intestinal Health in Weaned Piglets Challenged with Escherichia Coli. Peptides 2012, 35, 225–230. [Google Scholar] [CrossRef] [PubMed]
  35. Huang, H.-N.; Pan, C.-Y.; Wu, H.-Y.; Chen, J.-Y. Antimicrobial Peptide Epinecidin-1 Promotes Complete Skin Regeneration of Methicillin-Resistant Staphylococcus Aureus-Infected Burn Wounds in a Swine Model. Oncotarget 2017, 8, 21067–21080. [Google Scholar] [CrossRef] [PubMed]
  36. Chee, P.Y.; Mang, M.; Lau, E.S.; Tan, L.T.-H.; He, Y.-W.; Lee, W.-L.; Pusparajah, P.; Chan, K.-G.; Lee, L.-H.; Goh, B.-H. Epinecidin-1, an Antimicrobial Peptide Derived From Grouper (Epinephelus Coioides): Pharmacological Activities and Applications. Front. Microbiol. 2019, 10, 2631. [Google Scholar] [CrossRef]
  37. Pränting, M.; Negrea, A.; Rhen, M.; Andersson, D.I. Mechanism and Fitness Costs of PR-39 Resistance in Salmonella Enterica Serovar Typhimurium LT2. Antimicrob Agents Chemother 2008, 52, 2734–2741. [Google Scholar] [CrossRef]
  38. Peng, Z.; Wang, A.; Xie, L.; Song, W.; Wang, J.; Yin, Z.; Zhou, D.; Li, F. Use of Recombinant Porcine β-Defensin 2 as a Medicated Feed Additive for Weaned Piglets. Sci Rep 2016, 6, 26790. [Google Scholar] [CrossRef]
  39. Wilson, H.L.; Buchanan, R.M.; Allan, B.; Tikoo, S.K. Milk-Derived Antimicrobial Peptides to Protect against Neonatal Diarrheal Disease: An Alternative to Antibiotics. Procedia in Vaccinology 2012, 6, 21–32. [Google Scholar] [CrossRef]
  40. Zhang, H.; Lv, J.; Ma, Z.; Ma, J.; Chen, J. Advances in Antimicrobial Peptides: Mechanisms, Design Innovations, and Biomedical Potential. Molecules 2025, 30, 1529. [Google Scholar] [CrossRef]
  41. Mihaylova-Garnizova, R.; Davidova, S.; Hodzhev, Y.; Satchanska, G. Antimicrobial Peptides Derived from Bacteria: Classification, Sources, and Mechanism of Action against Multidrug-Resistant Bacteria. IJMS 2024, 25, 10788. [Google Scholar] [CrossRef]
  42. Cornejo, S.; Barber, C.; Thoresen, M.; Lawrence, M.; Seo, K.S.; Woolums, A. Synthetic Antimicrobial Peptides Bac-5, BMAP-28, and Syn-1 Can Inhibit Bovine Respiratory Disease Pathogens in Vitro. Front. Vet. Sci. 2024, 11, 1430919. [Google Scholar] [CrossRef]
  43. Luo, C.; Yin, D.; Gao, X.; Li, Q.; Zhang, L. Goat Mammary Gland Expression of Cecropin B to Inhibit Bacterial Pathogens Causing Mastitis. Animal Biotechnology 2013, 24, 66–78. [Google Scholar] [CrossRef] [PubMed]
  44. Huan, Y.; Kong, Q.; Mou, H.; Yi, H. Antimicrobial Peptides: Classification, Design, Application and Research Progress in Multiple Fields. Front. Microbiol. 2020, 11, 582779. [Google Scholar] [CrossRef] [PubMed]
  45. Gong, Y.; Xue, Q.; Li, J.; Zhang, S. Antifungal Peptides from Living Organisms. Front. Microbiol. 2024, 15, 1511461. [Google Scholar] [CrossRef]
  46. Sargsyan, T.; Stepanyan, L.; Panosyan, H.; Hakobyan, H.; Israyelyan, M.; Tsaturyan, A.; Hovhannisyan, N.; Vicidomini, C.; Mkrtchyan, A.; Saghyan, A.; et al. Synthesis and Antifungal Activity of Fmoc-Protected 1,2,4-Triazolyl-α-Amino Acids and Their Dipeptides Against Aspergillus Species. Biomolecules 2025, 15, 61. [Google Scholar] [CrossRef]
  47. Buda De Cesare, G.; Cristy, S.A.; Garsin, D.A.; Lorenz, M.C. Antimicrobial Peptides: A New Frontier in Antifungal Therapy. mBio 2020, 11, e02123–20. [Google Scholar] [CrossRef]
  48. Gong, Y.; Li, H.; Wu, F.; Li, Y.; Zhang, S. Fungicidal Activity of AP10W, a Short Peptide Derived from AP-2 Complex Subunit Mu-A, In Vitro and In Vivo. Biomolecules 2022, 12, 965. [Google Scholar] [CrossRef]
  49. Perez-Rodriguez, A.; Eraso, E.; Quindós, G.; Mateo, E. Antimicrobial Peptides with Anti-Candida Activity. Int. J. Mol. Sci. 2022, 23, 9264. [Google Scholar] [CrossRef]
  50. Fodor, A.; Hess, C.; Ganas, P.; Boros, Z.; Kiss, J.; Makrai, L.; Dublecz, K.; Pál, L.; Fodor, L.; Sebestyén, A.; et al. Antimicrobial Peptides (AMP) in the Cell-Free Culture Media of Xenorhabdus Budapestensis and X. Szentirmaii Exert Anti-Protist Activity against Eukaryotic Vertebrate Pathogens Including Histomonas Meleagridis and Leishmania Donovani Species. Antibiotics 2023, 12, 1462. [Google Scholar] [CrossRef]
  51. Ünübol, N.; Çavuş, İ.; Polat, T.; Kurt, Ö.; Özbilgin, A.; Kocagöz, T. Antimicrobial Peptides and Their Anti-Leishmanial Efficacies on Leishmania Tropica Promastigotes In Vitro. Turkish Journal of Parasitology 2024, 135–141. [Google Scholar] [CrossRef]
  52. Aley, S.B.; Gillin, F.D. Killing of Giardia Lamblia by Cryptdins and Cationic Neutrophil Peptidest. 1994, 62.
  53. Wickramasuriya, S.S.; Park, I.; Lee, Y.; Kim, W.H.; Przybyszewski, C.; Gay, C.G.; Oosterwijk, J.G.V.; Lillehoj, H.S. Oral Delivery of Bacillus Subtilis Expressing Chicken NK-2 Peptide Protects Against Eimeria Acervulina Infection in Broiler Chickens. Front. Vet. Sci. 2021, 8, 684818. [Google Scholar] [CrossRef]
  54. Proaño-Bolaños, C.; Morán-Marcillo, G.; Espinosa De Los Monteros-Silva, N.; Bermúdez-Puga, S.; Salazar, M.A.; Blasco-Zúñiga, A.; Cuesta, S.; Molina, C.; Espinosa, F.; Meneses, L.; et al. Bioactivity of Synthetic Peptides from Ecuadorian Frog Skin Secretions against Leishmania Mexicana, Plasmodium Falciparum, and Trypanosoma Cruzi. Microbiol Spectr 2024, 12, e03339–23. [Google Scholar] [CrossRef] [PubMed]
  55. Pitale, D.M.; Kaur, G.; Baghel, M.; Kaur, K.J.; Shaha, C. Halictine-2 Antimicrobial Peptide Shows Promising Anti-Parasitic Activity against Leishmania Spp. Experimental Parasitology 2020, 218, 107987. [Google Scholar] [CrossRef] [PubMed]
  56. Sabiá Júnior, E.F.; Menezes, L.F.S.; De Araújo, I.F.S.; Schwartz, E.F. Natural Occurrence in Venomous Arthropods of Antimicrobial Peptides Active against Protozoan Parasites. Toxins 2019, 11, 563. [Google Scholar] [CrossRef]
  57. Rivas, L.; Rojas, V. Cyanobacterial Peptides as a Tour de Force in the Chemical Space of Antiparasitic Agents. Archives of Biochemistry and Biophysics 2019, 664, 24–39. [Google Scholar] [CrossRef]
  58. Kumar, R.; Ali, S.A.; Singh, S.K.; Bhushan, V.; Mathur, M.; Jamwal, S.; Mohanty, A.K.; Kaushik, J.K.; Kumar, S. Antimicrobial Peptides in Farm Animals: An Updated Review on Its Diversity, Function, Modes of Action and Therapeutic Prospects. Veterinary Sciences 2020, 7, 206. [Google Scholar] [CrossRef]
  59. Fasina, Y.O.; Obanla, T.; Dosu, G.; Muzquiz, S. Significance of Endogenous Antimicrobial Peptides on the Health of Food Animals. Front. Vet. Sci. 2021, 8, 585266. [Google Scholar] [CrossRef]
  60. Cheung, Q.C.K.; Turner, P.V.; Song, C.; Wu, D.; Cai, H.Y.; MacInnes, J.I.; Li, J. Enhanced Resistance to Bacterial Infection in Protegrin-1 Transgenic Mice. Antimicrob Agents Chemother 2008, 52, 1812–1819. [Google Scholar] [CrossRef]
  61. Takagi, S.; Hayashi, S.; Takahashi, K.; Isogai, H.; Bai, L.; Yoneyama, H.; Ando, T.; Ito, K.; Isogai, E. Antimicrobial Activity of a Bovine Myeloid Antimicrobial Peptide (BMAP-28) against Methicillin-susceptible and Methicillin-resistant Staphylococcus Aureus. Animal Science Journal 2012, 83, 482–486. [Google Scholar] [CrossRef]
  62. Guo, Y.; Xun, M.; Han, J. A Bovine Myeloid Antimicrobial Peptide (BMAP-28) and Its Analogs Kill Pan-Drug-Resistant Acinetobacter Baumannii by Interacting with Outer Membrane Protein A (OmpA). Medicine 2018, 97, e12832. [Google Scholar] [CrossRef]
  63. Hu, F.; Gao, X.; She, R.; Chen, J.; Mao, J.; Xiao, P.; Shi, R. Effects of Antimicrobial Peptides on Growth Performance and Small Intestinal Function in Broilers under Chronic Heat Stress. Poultry Science 2017, 96, 798–806. [Google Scholar] [CrossRef]
  64. Sun, Q.; Wang, K.; She, R.; Ma, W.; Peng, F.; Jin, H. Swine Intestine Antimicrobial Peptides Inhibit Infectious Bronchitis Virus Infectivity in Chick Embryos. Poultry Science 2010, 89, 464–469. [Google Scholar] [CrossRef] [PubMed]
  65. Wang, J.; Dou, X.; Song, J.; Lyu, Y.; Zhu, X.; Xu, L.; Li, W.; Shan, A. Antimicrobial Peptides: Promising Alternatives in the Post Feeding Antibiotic Era. Medicinal Research Reviews 2019, 39, 831–859. [Google Scholar] [CrossRef] [PubMed]
  66. Petrov, P.D.; Davidova, S.; Satchanska, G. Polymer Micelles as Nanocarriers of Bioactive Peptides. Polymers 2025, 17, 1174. [Google Scholar] [CrossRef] [PubMed]
  67. Mughini-Gras, L.; Van Hoek, A.H.A.M.; Cuperus, T.; Dam-Deisz, C.; Van Overbeek, W.; Van Den Beld, M.; Wit, B.; Rapallini, M.; Wullings, B.; Franz, E.; et al. Prevalence, Risk Factors and Genetic Traits of Salmonella Infantis in Dutch Broiler Flocks. Veterinary Microbiology 2021, 258, 109120. [Google Scholar] [CrossRef]
  68. Wei, B.; Cha, S.-Y.; Zhang, J.-F.; Shang, K.; Park, H.-C.; Kang, J.; Lee, K.-J.; Kang, M.; Jang, H.-K. Antimicrobial Susceptibility and Association with Toxin Determinants in Clostridium Perfringens Isolates from Chickens. Microorganisms 2020, 8, 1825. [Google Scholar] [CrossRef]
  69. Mikulski, D.; Juśkiewicz, J.; Ognik, K.; Fotschki, B.; Tykałowski, B.; Jankowski, J. Gastrointestinal Response to the Early Administration of Antimicrobial Agents in Growing Turkeys Infected with Escherichia Coli. Poultry Science 2024, 103, 103720. [Google Scholar] [CrossRef]
  70. Orso, C.; Stefanello, T.B.; Franceschi, C.H.; Mann, M.B.; Varela, A.P.M.; Castro, I.M.S.; Frazzon, J.; Frazzon, A.P.G.; Andretta, I.; Ribeiro, A.M.L. Changes in the Ceca Microbiota of Broilers Vaccinated for Coccidiosis or Supplemented with Salinomycin. Poultry Science 2021, 100, 100969. [Google Scholar] [CrossRef]
  71. Cheng, X.; Zheng, H.; Wang, C.; Wang, X.; Fei, C.; Zhou, W.; Zhang, K. Effects of Salinomycin and Ethanamizuril on the Three Microbial Communities in Vivo and in Vitro. Front. Microbiol. 2022, 13, 941259. [Google Scholar] [CrossRef]
  72. Bampidis, V.; Azimonti, G.; Bastos, M. de L.; Christensen, H.; Durjava, M.; Dusemund, B.; Kouba, M.; López-Alonso, M.; Puente, S.L.; et al. Safety and Efficacy of a Feed Additive Consisting of Salinomycin Sodium (Sacox®) for Rabbits for Fattening (Huvepharma N.V.). EFSA Journal 2024, 22. [Google Scholar] [CrossRef]
  73. Nooreh, Z.; Taherpour, K.; Akbari Gharaei, M.; Shirzadi, H.; Ghasemi, H.A. Effects of a Dietary Direct-Fed Microbial and Ferulago Angulata Extract on Growth Performance, Intestinal Microflora, and Immune Function of Broiler Chickens Infected with Campylobacter Jejuni. Poultry Science 2021, 100, 100942. [Google Scholar] [CrossRef]
  74. Yuan, C.; Huang, X.; Zhai, R.; Ma, Y.; Xu, A.; Zhang, P.; Yang, Q. In Vitro Antiviral Activities of Salinomycin on Porcine Epidemic Diarrhea Virus. Viruses 2021, 13, 580. [Google Scholar] [CrossRef] [PubMed]
  75. Mysara, M.; Berkell, M.; Xavier, B. B.; De Backer, S.; Lammens, C.; Hautekiet, V.; Petkov, S.; Goossens, H.; Kumar-Singh, S.; Malhotra-Kumar, S. Assessing the Impact of Flavophospholipol and Virginiamycin Supplementation on the Broiler Microbiota: A Prospective Controlled Intervention Study. mSystems 2021, 6. [Google Scholar] [CrossRef] [PubMed]
  76. Dittoe, D.K.; Anderson, R.C.; Krueger, N.A.; Harvey, R.B.; Poole, T.L.; Crippen, T.L.; Callaway, T.R.; Ricke, S.C. Campylobacter Jejuni Response When Inoculated in Bovine In Vitro Fecal Microbial Consortia Incubations in the Presence of Metabolic Inhibitors. Pathogens 2023, 12, 1391. [Google Scholar] [CrossRef]
  77. Schwarz, C.; Mathieu, J.; Gomez, J.L.; Miller, M.R.; Tikhonova, M. ; Nagaraja, Tiruvoor. G.; Alvarez, P.J.J. Unexpected Finding of Fusobacterium Varium as the Dominant Fusobacterium Species in Cattle Rumen: Potential Implications for Liver Abscess Etiology and Interventions. Journal of Animal Science 2023, 101, skad130. [Google Scholar] [CrossRef]
  78. Warsi, O. M.; Upterworth, L. M.; Breidenstein, A.; Lustig, U.; Mikkelsen, K.; Nagy, T.; Dávid Szatmari; Hanne Ingmer; Andersson, D. I. Staphylococcus Aureus Mutants Resistant to the Feed-Additive Monensin Show Increased Virulence and Altered Purine Metabolism. mBio 2024, 15. [Google Scholar] [CrossRef]
  79. Vieira, A.M.; Soratto, T.A.T.; Cardinal, K.M.; Wagner, G.; Hauptli, L.; Lima, A.L.F.; Dahlke, F.; Peres Netto, D.; Moraes, P.D.O.; Ribeiro, A.M.L. Modulation of the Intestinal Microbiota of Broilers Supplemented with Monensin or Functional Oils in Response to Challenge by Eimeria Spp. PLoS ONE 2020, 15. [Google Scholar] [CrossRef]
  80. Pires, P.G.D.S.; Torres, P.; Teixeira Soratto, T.A.; Filho, V.B.; Hauptli, L.; Wagner, G.; Haese, D.; Pozzatti, C.D.; Moraes, P.D.O. Comparison of Functional-Oil Blend and Anticoccidial Antibiotics Effects on Performance and Microbiota of Broiler Chickens Challenged by Coccidiosis. PLoS ONE 2022, 17. [Google Scholar] [CrossRef]
  81. Kimura, J.; Kudo, H.; Fukuda, A.; Yamada, M.; Makita, K.; Oka, K.; Takahashi, M.; Tamura, Y.; Usui, M. Decreasing the Abundance of Tetracycline-Resistant Escherichia Coli in Pig Feces during Nursery Using Flavophospholipol as a Pig Feed Additive. Veterinary and Animal Science 2022, 15, 100236. [Google Scholar] [CrossRef]
  82. Lim, K.; Pennell, M.; Lewis, S.; El-Gazzar, M.; Gebreyes, W.A. Effects of Flavophospholipol on Conjugation and Plasmid Curing of Multidrug-Resistant Salmonella Enteritidis in Broiler Chickens. JAC-Antimicrobial Resistance 2021, 3. [Google Scholar] [CrossRef]
  83. Nair, S.; Farzan, A.; Weese, J.S.; Poljak, Z.; Friendship, R.M. Effect of Flavophospholipol on Fecal Microbiota in Weaned Pigs Challenged with Salmonella Typhimurium. Porc Health Manag 2020, 6, 14. [Google Scholar] [CrossRef]
  84. Shanmugasundaram, R.; Markazi, A.; Mortada, M.; Ng, T.T.; Applegate, T.J.; Bielke, L.R.; Syed, B.; Pender, C.M.; Curry, S.; Murugesan, G.R.; et al. Research Note: Effect of Synbiotic Supplementation on Caecal Clostridium Perfringens Load in Broiler Chickens with Different Necrotic Enteritis Challenge Models. Poultry Science 2020, 99, 2452–2458. [Google Scholar] [CrossRef] [PubMed]
  85. Xing, J.; Paithankar, S.; Liu, K.; Uhl, K.; Li, X.; Ko, M.; Kim, S.; Haskins, J.; Chen, B. Published Anti-SARS-CoV-2 in Vitro Hits Share Common Mechanisms of Action That Synergize with Antivirals. Briefings in Bioinformatics 2021, 22. [Google Scholar] [CrossRef] [PubMed]
  86. Woods, M.; McAlister, J.A.; Geddes-McAlister, J. A One Health Approach to Overcoming Fungal Disease and Antifungal Resistance. WIREs Mechanisms of Disease 2023, 15. [Google Scholar] [CrossRef]
  87. Russo, T.P.; Santaniello, A. Tackling Antibiotic and Antifungal Resistance in Domestic Animals, Synanthropic Species, and Wildlife: A Global Health Imperative. Antibiotics 2023, 12, 1632. [Google Scholar] [CrossRef]
  88. Hoenigl, M.; Arastehfar, A.; Arendrup, M.C.; Brüggemann, R.; Carvalho, A.; Chiller, T.; Chen, S.; Egger, M.; Feys, S.; Gangneux, J.-P.; et al. Novel Antifungals and Treatment Approaches to Tackle Resistance and Improve Outcomes of Invasive Fungal Disease. Clin Microbiol Rev 2024, 37, e00074–23. [Google Scholar] [CrossRef]
  89. Hossain, C.M.; Ryan, L.K.; Gera, M.; Choudhuri, S.; Lyle, N.; Ali, K.A.; Diamond, G. Antifungals and Drug Resistance. Encyclopedia 2022, 2, 1722–1737. [Google Scholar] [CrossRef]
  90. de Jong, J.E.; Heuvelink, A.E.; Dieste Pérez, L.; Holstege, M.M.C. Aspergillus Spp., Aspergillosis and Azole Usage in Animal Species in Europe: Results from a Multisectoral Survey and Review of Recent Literature. Medical Mycology 2025, 63. [Google Scholar] [CrossRef]
  91. Jiang, C.; Fang, W.; Chen, S.; Guo, X.; Gao, X.; Liu, P.; Hu, G.; Li, G.; Mai, W.; Liu, P. Genetic Framework Sequencing Analysis of Candida Tropicalis in Dairy Cow Mastitis and Study of Pathogenicity and Drug Resistance. BMC Microbiol 2024, 24, 428. [Google Scholar] [CrossRef]
  92. Van Dijk, M.A.M.; Buil, J.B.; Tehupeiory-Kooreman, M.; Broekhuizen, M.J.; Broens, E.M.; Wagenaar, J.A.; Verweij, P.E. Azole Resistance in Veterinary Clinical Aspergillus Fumigatus Isolates in the Netherlands. Mycopathologia 2024, 189, 50. [Google Scholar] [CrossRef]
  93. Sylvén, K.R.; Bergefur, A.-L.; Jacobson, M.; Wallgren, P.; Selling, L.E. Dermatophytosis Caused by Trichophyton Mentagrophytes Complex in Organic Pigs. Acta Vet Scand 2023, 65, 32. [Google Scholar] [CrossRef]
  94. Alghuthaymi, M.A.; Hassan, A.A.; Kalia, A.; Sayed El Ahl, R.M.H.; El Hamaky, A.A.M.; Oleksak, P.; Kuca, K.; Abd-Elsalam, K.A. Antifungal Nano-Therapy in Veterinary Medicine: Current Status and Future Prospects. JoF 2021, 7, 494. [Google Scholar] [CrossRef] [PubMed]
  95. Höglund, J.; Daş, G.; Tarbiat, B.; Geldhof, P.; Jansson, D.S.; Gauly, M. Ascaridia Galli - An Old Problem That Requires New Solutions. International Journal for Parasitology: Drugs and Drug Resistance 2023, 23, 1–9. [Google Scholar] [CrossRef] [PubMed]
  96. McIntyre, J.; Morrison, A.; Maitland, K.; Berger, D.; Price, D.R.G.; Dougan, S.; Grigoriadis, D.; Tracey, A.; Holroyd, N.; Bull, K.; et al. Chromosomal Genome Assembly Resolves Drug Resistance Loci in the Parasitic Nematode Teladorsagia Circumcincta. PLoS Pathog 2025, 21, e1012820. [Google Scholar] [CrossRef]
  97. Moncada-Diaz, M.J.; Rodríguez-Almonacid, C.C.; Quiceno-Giraldo, E.; Khuong, F.T.H.; Muskus, C.; Karamysheva, Z.N. Molecular Mechanisms of Drug Resistance in Leishmania spp. Pathogens 2024, 13, 835. Pathogens 2024, 13, 835. [Google Scholar] [CrossRef]
  98. Sun, H.; Su, X.; Fu, Y.; Hao, L.; Zhou, W.; Zhou, Z.; Huang, J.; Wang, Y.; Shi, T. Pathogenicity and Drug Resistance of the Eimeria Tenella Isolate from Yiwu, Zhejiang Province, Eastern China. Poultry Science 2023, 102, 102845. [Google Scholar] [CrossRef]
  99. Rogala-Hnatowska, M.; Gould, G.; Mehrotra, S.; Drażbo, A.; Konieczka, P.; Ramasami, P.; Kozłowski, K. Efficacy and Growth Performance between Two Different Ionophore Coccidiostats (Narasin and Salinomycin) in Broiler Chickens after Challenge with Eimeria spp. Animals 2024, 14, 2750. Animals 2024, 14, 2750. [Google Scholar] [CrossRef]
  100. Tsiouris, V.; Giannenas, I.; Bonos, E.; Papadopoulos, E.; Stylianaki, I.; Sidiropoulou, E.; Lazari, D.; Tzora, A.; Ganguly, B.; Georgopoulou, I. Efficacy of a Dietary Polyherbal Formula on the Performance and Gut Health in Broiler Chicks after Experimental Infection with Eimeria Spp. Pathogens 2021, 10, 524. [Google Scholar] [CrossRef]
  101. Qiu, Y.; Yin, Y.; Ruan, Z.; Gao, Y.; Bian, C.; Chen, J.; Wang, X.; Pan, X.; Yang, J.; Shi, Q.; et al. Comprehensive Transcriptional Changes in the Liver of Kanglang White Minnow (Anabarilius Grahami) in Response to the Infection of Parasite Ichthyophthirius Multifiliis. Animals 2020, 10, 681. [Google Scholar] [CrossRef]
  102. Denwood, M.J.; Kaplan, R.M.; McKendrick, I.J.; Thamsborg, S.M.; Nielsen, M.K.; Levecke, B. A Statistical Framework for Calculating Prospective Sample Sizes and Classifying Efficacy Results for Faecal Egg Count Reduction Tests in Ruminants, Horses and Swine. Veterinary Parasitology 2023, 314, 109867. [Google Scholar] [CrossRef]
  103. Zhang, Y.; Zhao, W.; Du, H.; Dhakal, P.; Chen, X.; Wu, L.; Li, X.; Wang, R.; Zhang, L.; Zhang, S.; et al. Licochalcone a: A Promising Antiparasitic Drug against Giardiasis. International Journal for Parasitology: Drugs and Drug Resistance 2025, 27, 100573. [Google Scholar] [CrossRef]
  104. Kim, J.; Ahn, J. Emergence and Spread of Antibiotic-Resistant Foodborne Pathogens from Farm to Table. Food Sci Biotechnol 2022, 31, 1481–1499. [Google Scholar] [CrossRef] [PubMed]
  105. Ma, X.; Yang, N.; Mao, R.; Hao, Y.; Li, Y.; Guo, Y.; Teng, D.; Huang, Y.; Wang, J. Self-Assembly Antimicrobial Peptide for Treatment of Multidrug-Resistant Bacterial Infection. J Nanobiotechnol 2024, 22, 668. [Google Scholar] [CrossRef] [PubMed]
  106. Javadmanesh, A.; Mohammadi, E.; Mousavi, Z.; Azghandi, M.; Tanhaiean, A. Antibacterial Effects Assessment on Some Livestock Pathogens, Thermal Stability and Proposing a Probable Reason for Different Levels of Activity of Thanatin. Sci Rep 2021, 11, 10890. [Google Scholar] [CrossRef] [PubMed]
  107. Shi, J.; Lei, Y.; Wu, J.; Li, Z.; Zhang, X.; Jia, L.; Wang, Y.; Ma, Y.; Zhang, K.; Cheng, Q.; et al. Antimicrobial Peptides Act on the Rumen Microbiome and Metabolome Affecting the Performance of Castrated Bulls. J Animal Sci Biotechnol 2023, 14, 31. [Google Scholar] [CrossRef]
  108. Ji, F.; Yang, H.; Wang, Q.; Li, J.; Zhou, H.; Liu, S. Porcine Intestinal Antimicrobial Peptide as an In-Feed Antibiotic Alternative Improves Intestinal Digestion and Immunity by Shaping the Gut Microbiota in Weaned Piglets. Animal Nutrition 2023, 14, 43–55. [Google Scholar] [CrossRef]
  109. Xu, B.C.; Fu, J.; Zhu, L.Y.; Li, Z.; Wang, Y.Z.; Jin, M.L. Overall Assessment of Antimicrobial Peptides in Piglets: A Set of Meta-Analyses. Animal 2020, 14, 2463–2471. [Google Scholar] [CrossRef]
  110. Xu, B.; Fu, J.; Zhu, L.; Li, Z.; Jin, M.; Wang, Y. Overall Assessment of Antibiotic Substitutes for Pigs: A Set of Meta-Analyses. J Animal Sci Biotechnol 2021, 12, 3. [Google Scholar] [CrossRef]
  111. Patyra, E.; Kwiatek, K. Insect Meals and Insect Antimicrobial Peptides as an Alternative for Antibiotics and Growth Promoters in Livestock Production. Pathogens 2023, 12, 854. [Google Scholar] [CrossRef]
  112. Xia, J.; Ge, C.; Yao, H. Antimicrobial Peptides from Black Soldier Fly (Hermetia Illucens) as Potential Antimicrobial Factors Representing an Alternative to Antibiotics in Livestock Farming. Animals 2021, 11, 1937. [Google Scholar] [CrossRef]
  113. Van Eijk, M.; Boerefijn, S.; Cen, L.; Rosa, M.; Morren, M.J.H.; Van Der Ent, C.K.; Kraak, B.; Dijksterhuis, J.; Valdes, I.D.; Haagsman, H.P.; et al. Cathelicidin-Inspired Antimicrobial Peptides as Novel Antifungal Compounds. Medical Mycology 2020, 58, 1073–1084. [Google Scholar] [CrossRef]
  114. Youssef, F.S.; El-Banna, H.A.; Elzorba, H.Y.; Galal, A.M. Application of Some Nanoparticles in the Field of Veterinary Medicine. International Journal of Veterinary Science and Medicine 2019, 7, 78–93. [Google Scholar] [CrossRef] [PubMed]
  115. Maximiano, M.R.; Rios, T.B.; Campos, M.L.; Prado, G.S.; Dias, S.C.; Franco, O.L. Nanoparticles in Association with Antimicrobial Peptides (NanoAMPs) as a Promising Combination for Agriculture Development. Front. Mol. Biosci. 2022, 9, 890654. [Google Scholar] [CrossRef] [PubMed]
  116. Maleki Dizaj, S.; Salatin, S.; Khezri, K.; Lee, J.-Y.; Lotfipour, F. Targeting Multidrug Resistance With Antimicrobial Peptide-Decorated Nanoparticles and Polymers. Front. Microbiol. 2022, 13, 831655. [Google Scholar] [CrossRef]
  117. Meng, H.; Zhao, Y.; Cai, H.; You, D.; Wang, Y.; Wu, S.; Wang, Y.; Guo, W.; Qu, W. Hydrogels Containing Chitosan-Modified Gold Nanoparticles Show Significant Efficacy in Healing Diabetic Wounds Infected with Antibiotic-Resistant Bacteria. IJN 2024, Volume 19, 1539–1556. [Google Scholar] [CrossRef]
  118. Kuang, M.; Yu, H.; Qiao, S.; Huang, T.; Zhang, J.; Sun, M.; Shi, X.; Chen, H. A Novel Nano-Antimicrobial Polymer Engineered with Chitosan Nanoparticles and Bioactive Peptides as Promising Food Biopreservative Effective against Foodborne Pathogen E. Coli O157-Caused Epithelial Barrier Dysfunction and Inflammatory Responses. IJMS 2021, 22, 13580. [Google Scholar] [CrossRef]
  119. Carmona-Ribeiro, A.M.; Araújo, P.M. Antimicrobial Polymer−Based Assemblies: A Review. IJMS 2021, 22, 5424. [Google Scholar] [CrossRef]
  120. Sandhu, A.K.; Yang, Y.; Li, W.-W. In Vivo Antibacterial Efficacy of Antimicrobial Peptides Modified Metallic Implants─Systematic Review and Meta-Analysis. ACS Biomater. Sci. Eng. 2022, 8, 1749–1762. [Google Scholar] [CrossRef]
Figure 1. Graphs showing the number of publications over ten years (2014–2024). Graph (a) depicts the number of papers published using the keywords “antibiotics in livestock”, whereas graph (b) depicts the number of papers published using the keywords “antimicrobial peptides in livestock”.
Figure 1. Graphs showing the number of publications over ten years (2014–2024). Graph (a) depicts the number of papers published using the keywords “antibiotics in livestock”, whereas graph (b) depicts the number of papers published using the keywords “antimicrobial peptides in livestock”.
Preprints 162041 g001
Figure 2. Antimicrobial resistance in livestock, humans, and the environment [9].
Figure 2. Antimicrobial resistance in livestock, humans, and the environment [9].
Preprints 162041 g002
Figure 3. Multifunctional roles of pBD. Porcine β-defensins (pBDs) are secreted by a variety of specialized cells (“A”), including B and T lymphocytes, macrophages, neutrophils, and epithelial cells. The roles of pBDs extend beyond direct antimicrobial activity against bacteria, viruses, and fungi (“B”); pBDs also possess the ability to neutralize lipopolysaccharides (LPS) (“C”). These findings suggest that pBDs play a pivotal role in immunomodulating host cells, triggering immune activation and boosting cellular immune responses, thereby enhancing the ability of the host to combat target pathogens. Some of these mechanisms include enhanced phagocytosis (“D”), chemotaxis of specialized cells to sites of infection (“E”), fine-tuned secretion of inflammatory cytokines (“F”), and the strengthening and maintenance of epithelial barrier integrity through the induction of tight junctions (“G”). Figure and description reproduced from [12].
Figure 3. Multifunctional roles of pBD. Porcine β-defensins (pBDs) are secreted by a variety of specialized cells (“A”), including B and T lymphocytes, macrophages, neutrophils, and epithelial cells. The roles of pBDs extend beyond direct antimicrobial activity against bacteria, viruses, and fungi (“B”); pBDs also possess the ability to neutralize lipopolysaccharides (LPS) (“C”). These findings suggest that pBDs play a pivotal role in immunomodulating host cells, triggering immune activation and boosting cellular immune responses, thereby enhancing the ability of the host to combat target pathogens. Some of these mechanisms include enhanced phagocytosis (“D”), chemotaxis of specialized cells to sites of infection (“E”), fine-tuned secretion of inflammatory cytokines (“F”), and the strengthening and maintenance of epithelial barrier integrity through the induction of tight junctions (“G”). Figure and description reproduced from [12].
Preprints 162041 g003
Figure 4. Schematic representation of the mechanisms of action of antimicrobial peptides for yeast [49].
Figure 4. Schematic representation of the mechanisms of action of antimicrobial peptides for yeast [49].
Preprints 162041 g004
Figure 5. Schematic overview of a protozoan cell with various internal targets (highlighted in red) of AMPs [56].
Figure 5. Schematic overview of a protozoan cell with various internal targets (highlighted in red) of AMPs [56].
Preprints 162041 g005
Figure 6. Mechanisms for the development of antibiotic resistance [66].
Figure 6. Mechanisms for the development of antibiotic resistance [66].
Preprints 162041 g006
Figure 7. Classes of Antifungal Drugs and Their Overall Mechanism of Action. Drug class names are indicated in red [89].
Figure 7. Classes of Antifungal Drugs and Their Overall Mechanism of Action. Drug class names are indicated in red [89].
Preprints 162041 g007
Figure 8. Drug-resistance mechanisms employed by amastigotes of Leishmania spp. [97].
Figure 8. Drug-resistance mechanisms employed by amastigotes of Leishmania spp. [97].
Preprints 162041 g008
Figure 9. Statistics of the main functions of antimicrobial peptides. Figure adapted from [44].
Figure 9. Statistics of the main functions of antimicrobial peptides. Figure adapted from [44].
Preprints 162041 g009
Table 1. Examples of Host Defense Peptides Sequences from Livestock Species with Corresponding UniProt Entries [15].
Table 1. Examples of Host Defense Peptides Sequences from Livestock Species with Corresponding UniProt Entries [15].
AMP Source Organism Uniprot Entry Name Sequence
PR-39 Sus scrofa (Pig) PR39_PIG METQRASLCLGRWSLWLLLLGLVVPSASAQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLNPSIHSLDISCNEIQSVRRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFPGKR
Beta-defensin 1 Sus scrofa (Pig) DEFB1_PIG MRLHRLLLVFLLMVLLPVPGLLKNIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK
Beta-defensin 10 Bos taurus (Bovine) DFB10_BOVIN MRLHHLLLLLLLVVLSSGSGFTQGVRSYLSCWGNRGICLLNRCPGRMRQIGTCLAPRVKCCR
Cathelicidin-1 Gallus gallus (Chicken) CTHL1_CHICK MLSCWVLLLALLGGACALPAPLGYSQALAQAVDSYNQRPEVQNAFRLLSADPEPGPNVQLSSLHNLNFTIMETRCQARSGAQLDSCEFKEDGLVKDCAAPVVLQGGRAVLDVTCVDSMADPVRVKRVWPLVIRTVIAGYNLYRAIKKK
Cathelicidin-2 Gallus gallus (Chicken) CTHL2_CHICK MLSCWVLLLALLGGVCALPAPLSYPQALIQAVDSYNQRPEVQNAFRLLSADPEPGPGVDLSTLRALNFTIMETECTPSARLPVDDCDFKENGVIRDCSGPVSVLQDTPEINLRCRDASSDPVLVQRGRFGRFLRKIRRFRPKVTITIQGSARFG
Cathelicidin-4 Bos taurus (Bovine) CTHL4_BOVIN MQTQRASLSLGRWSLWLLLLGLVVPSASAQALSYREAVLRAVDQLNELSSEANLYRLLELDPPPKDNEDLGTRKPVSFTVKETVCPRTIQQPAEQCDFKEKGRVKQCVGTVTLDPSNDQFDLNCNELQSVILPWKWPWWPWRRG
Cathelicidin-6 Bos taurus (Bovine) CTHL6_BOVIN METQRASLSLGRWSLWLLLLGLALPSASAQALSYREAVLRAVDQFNERSSEANLYRLLELDPPPKEDDENPNIPKPVSFRVKETVCPRTSQQPAEQCDFKENGLVKQCVGTVTLDAVKGKINVTCEELQSVGRFKRFRKKFKKLFKKLSPVIPLLHLG
Gallinacin-1 Gallus gallus (Chicken) GLL1_CHICK MRIVYLLLPFILLLAQGAAGSSQALGRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIWG
Hepcidin Larimichthys crocea (Large yellow croaker) HEPC_LARCR MKTFSVAVAVAVVLAFICLQESSAVPANEEQELEQQIYFADPEMPVESCKMPYYMRENRQGSPARCRFCCRCCPRMRGCGICCRF
LEAP 2 Sus scrofa (Pig) LEAP2_PIG MWHLKLFAVLVICLLLAVQVHGSPIPELSSAKRRPRRMTPFWRAVSLRPIGASCRDDSECLTRLCRKRRCSLSVAQE
Oncorhyncin-1 Salmo gairdneri (Rainbow trout) ONC1_ONCMY SKGKKANKDVELARG
Ostricacin-1 Struthio camelus (Common ostrich) OSTR1_STRCA LFCRKGTCHFGGCPAHLVKVGSCFGFRACCKWPWDV
Piscidin-3 Morone chrysops x Morone saxatilis (White bass x Striped bass) PISC3_MORCS FIHHIFRGIVHAGRSIGRFLTG
Protegrin-1 Sus scrofa (Pig) PG1_PIG METQRASLCLGRWSLWLLLLALVVPSASAQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEVQGVRGGRLCYCRRRFCVCVGRG
Table 2. Examples of Antimicrobial Peptides for Use in Aquaculture: Sources, Target Pathogens, and Intended Applications.
Table 2. Examples of Antimicrobial Peptides for Use in Aquaculture: Sources, Target Pathogens, and Intended Applications.
Peptide Source Organism Target Pathogen Reference
Algal AMPs (various) Marine photosynthetic organisms Gram-positive & Gram-negative bacteria, parasites [16]
Hepcidin Fish Bacteria, fungi, parasites [13]
Lc149 Large Yellow Croaker (Larimichthys crocea) Escherichia coli, Vibrio harveyi, fish parasites [17]
Lc1687 C-terminal fragment of a Ferritin H in Larimichthys crocea Gram-positive & Gram-negative bacteria [18]
LEAP-2 Golden pompano (fish) Edwardsiella tarda and Streptococcus agalactiae [19]
NK-lysin Atlantic salmon (Salmo salar) Piscirickettsia salmonis, Flavobacterium psychrophilum [20]
Oncorhyncin III Non-histone chromosomal protein H6 from Rainbow Trout Gram-positive & Gram-negative bacteria [21]
Piscidin Fish Bacteria, viruses, fungi, parasites [13]
Table 3. Examples of Antimicrobial Peptides for Use in Poultry: Sources, Target Pathogens, and Intended Applications.
Table 3. Examples of Antimicrobial Peptides for Use in Poultry: Sources, Target Pathogens, and Intended Applications.
Peptide Source Organism Target Pathogen Target Animal Reference
A11 Modified Acidocin J1132β (from L. acidophilus) Salmonella Typhimurium Poultry (Food chain) [23]
ABD1 Chicken Gram-positive & Gram-negative bacteria Chicken [24,25]
Brevilaterins Brevibacillus laterosporus Bacteria, Fungi Livestock (general, incl. aquaculture, poultry, and swine) [26]
C2-2 Modified chicken CATH-2 Multidrug-resistant E. coli Chicken [27]
CATH-1(6–26) Chicken Gram-positive & Gram-negative bacteria Chicken [23]
Enterocin A and B Enterococcus faecium from poultry Clostridium perfringens Poultry [22]
Fowlicidins (cathelicidins from chicken) Chicken Gram-positive & Gram-negative bacteria Chicken [28]
OaBac5mini E.coli recombinant system Salmonella Pullorum Chicken [29]
Ostricacins Ostrich Bacteria Ostrich [25]
P1 (NPSRQERR) Lactobacillus rhamnosus GG Avian Pathogenic E. coli (APEC) Chicken [30]
Rabbit sacculus rotundus-derived AMP Rabbit sacculus rotundus vvIBDV (very virulent infectious bursal disease virus) Chicken [31]
Sophorolipids (SL1-SL4) Candida bombicola and other yeasts Eimeria maxima and Clostridium perfringens Chicken [32]
Table 4. Examples of Antimicrobial Peptides for Use in Swine Production: Sources, Target Pathogens, and Intended Applications.
Table 4. Examples of Antimicrobial Peptides for Use in Swine Production: Sources, Target Pathogens, and Intended Applications.
Peptide Source Organism Target Pathogen Target Animal Reference
Brevilaterins Brevibacillus laterosporus Bacteria, Fungi Livestock (general, incl. aquaculture, poultry and swine) [26]
Cecropin AD Synthetic hybrid (insect cecropins A & D) E. coli (enterotoxigenic strain) Pig (weaned piglets) [33,34]
Epinecidin-1 Epinephelus coioides MRSA Pig [35,36]
LEAP-2 Golden pompano (fish); Pig liver Salmonella Typhimurium Aquaculture species; Pig [12]
PR-39 Pig (intestinal cathelicidin) Salmonella Typhimurium Pig (swine) [37]
Porcine β-Defensins (pBDs) Pig Escherichia coli (ETEC – post-weaning diarrhea) Pig (swine) [38]
Protegrin-1 (PG-1) Porcine leukocytes Gram-positive & Gram-negative bacteria Piglets [25,39]
Table 5. Examples of Antimicrobial Peptides for Use in Ruminants: Sources, Target Pathogens, and Intended Applications.
Table 5. Examples of Antimicrobial Peptides for Use in Ruminants: Sources, Target Pathogens, and Intended Applications.
Peptide Source Organism Target Pathogen Target Animal Reference
BMAP-27 Bovine myeloid antimicrobial peptide E. coli Calves (cattle) [39]
Bac-7 Bos taurus E. coli, Salmonella typhimurium Cattle [40]
Bacteriocins Gram-positive & Gram-negative bacteria Gram-positive & Gram-negative bacteria Eggs, poultry and dairy products [23,41]
Cathelicidin 4 Bos taurus Gram-positive & Gram-negative bacteria Cattle [25,42]
Cecropin B Insect (moth peptide, via transgenic expression) Staphylococcus aureus (mastitis pathogen) Goat (dairy goats) [43]
Indolicidin Bovine neutrophils; Bos taurus Gram-positive & Gram-negative bacteria Calves (cattle) [25,39]
Lfcin B (Lactoferricin B) Cattle milk (lactoferrin fragment) Broad-spectrum bacteria Cattle, dairy products [44]
Table 6. Examples of Antifungal Peptides for Use in Livestock: Sources, Target Pathogens, and Intended Applications.
Table 6. Examples of Antifungal Peptides for Use in Livestock: Sources, Target Pathogens, and Intended Applications.
Peptide Source Organism Target Pathogen Target Animal Reference
Fmoc-dipeptide 7a Synthetic (modeled for veterinary pathogens) Aspergillus flavus, Aspergillus versicolor, Aspergillus candidus Cattle [46]
Defensins Mammalian immune cells, Plants Broad-spectrum (bacteria, fungi, viruses) Multiple livestock species [45,47]
Piscidin Fish Bacteria, viruses, fungi, parasites Aquaculture species [13,45]
Hepcidin Fish Bacteria, fungi, parasites Aquaculture species [13]
SMAP-29 Sheep (Ovis aries) C. albicans, C. neoformans, and R. rubra Sheep [45]
Cathelicidins Sheep, Cattle, Pigs Broad-spectrum: bacteria, fungi Ruminants [25,47]
Table 7. Examples of Antimicrobial Peptides against parasites in Livestock: Sources, Target Pathogens, and Intended Applications.
Table 7. Examples of Antimicrobial Peptides against parasites in Livestock: Sources, Target Pathogens, and Intended Applications.
Peptide Source Organism Target Pathogen Target Animal Reference
Fabclavine Xenorhabdus szentirmaii Histomonas meleagridis, Paenibacillus larvae, bacteria, parasites Poultry, Honey bees [50]
Indolicidin Cattle (bovine neutrophil peptide) Giardia lamblia Cattle (calves) or general [39,52]
Chicken NK-2 (cNK-2) Chicken (NK-lysin peptide 2) Eimeria acervulina (coccidian parasite) Poultry (broiler chickens) [53]
Sophorolipids (SL1-SL4) Candida bombicola and other yeasts Eimeria maxima and Clostridium perfringens Chicken [32]
Dermaseptin-SP2 Agalychnis spurrelli (frog) Plasmodium falciparum, Leishmania mexicana, T. cruzi Livestock parasite models [54]
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
Copyright: This open access article is published under a Creative Commons CC BY 4.0 license, which permit the free download, distribution, and reuse, provided that the author and preprint are cited in any reuse.
Prerpints.org logo

Preprints.org is a free preprint server supported by MDPI in Basel, Switzerland.

Subscribe

Disclaimer

Terms of Use

Privacy Policy

Privacy Settings

© 2026 MDPI (Basel, Switzerland) unless otherwise stated