Submitted:
18 December 2023
Posted:
22 December 2023
You are already at the latest version
Abstract

Keywords:
1. Introduction
2. Materials and Methods
2.1. Computational studies
2.2. Biochemical studies. Plasmid construction, hClpP expression, and affinity purification
2.3. hClpP activity test
2.4. Cell cultures
2.5.2. D Cell viability Assay
2.6.3. D cell viability assay
2.7. Calcein-AM experiment
2.8. Hoechst 33342 experiment
2.9. ATPlite assay
2.10. Permeability experiments
2.11. Drug-transport experiment
3. Results and Discussion
3.1. Computational Studies Based on the Fingerprints for Ligands and Proteins (FLAP) Algorithm
3.2. hClpP activation by harmaline and anticancer strategy
3.3. Harmaline and cell efflux pump interactions
3.4. Biological membrane permeability by harmaline
4. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Perrone, MG, Ruggiero, A, Centonze, A, Carrieri, A, Ferorelli, F, Scilimati A. Diffuse Intrinsic Pontine Glioma (DIPG): breakthrough and clinical perspective. Curr. Med. Chem. 2021, 28, 3287-3317.
- Louis, D.N.; Perry, A.; Wesseling, P.; Brat, D.J.; Cree, I.A.; Figarella-Branger, D.; Hawkins, C.; Ng, H.K.; Pfister, S.M.; Reifenberger, G.; Soffietti, R.; von Deimling, A.; Ellison, D.W.; Neuro Oncol. 2021, 23, 1231-1251.
- Dalle Ore, C.; Coleman-Abadi, C.; Gupta, N.; Mueller, S. Pediatr Neurosurg. 2023, Epub ahead of print.
- Ralff, M.D.; Lulla, A.R.; Wagner, J.; El-Deiry, W.S. Transl. Cancer Res. 2017, 6, S1239-S1243.
- Wang, S.; Dougan, D.A. Cancer Cell. 2019, 35, 707-708.
- Wong, K.S.; Houry, W.A. ACS Chem. Biol. 2019, 14, 2349-2360.
- Cole, A.; Wang, Z.; Coyaud, E.; Voisin, V.; Gronda, M.; Jitkova, Y.; Mattson, R.; Hurren, R.; Babovic, S.; MacLean, N.; Restall, I; Wang, X.; Jeyaraju, D.V.; Sukhai, M.A.; Prabha, S.; Bashir, S.; Ramakrishnan, A.; Leung, E.; Qia, Y.H.; Zhang, N.; Combes, K.R.; Ketela, T.; Lin, F.; Houry, W.A.; Aman, A.; Al-Awar, R.; Zheng, W.; Wienholds, E.; Xu, C.J.; Dick, J.; Wang, J.C.; Moffat, J.; Minden, M.D.; Eaves, C.J.; Bader, G.D.; Hao, Z.; Kornblau, S.M.; Raught, B.; Schimmer, A.D. Cancer Cell. 2015, 27, 864-876.
- Feng, Y.; Nouri, K.; Schimmer, A.D. Cancers. 2021, 13, 2020.
- Keith, S.W.; Walid, A.H. ACS Chem. Biol. 2019, 14, 2349-2360.
- Böttcher, T.; Sieber, S. A. Med Chem Comm. 2012, 3, 408.
- Hackl, M.W.; Lakemeyer, M.; Dahmen, M.; Glaser, M.; Pahl, A.; Lorenz-Baath, K.; Menzel, T.; Sievers, S.; Bottcher, T.; Antes, I.; Waldmann H, Sieber SA. J. Am. Chem. Soc. 2015, 137, 8475–8483.
- Brötz-Oesterhelt, H.; Beyer, D.; Kroll, H.P.; Endermann, R.; Ladel, C.; Schroeder, W.; Hinzen, B.; Raddatz, S.; Paulsen, H.; Henninger, K.; Bandow, J.E.; Sahl, H-G.; Labischinski, H. Dysregulation of bacterial proteolytic machinery by a new class of antibiotics. Nat. Med., 2005, 11, 1082-1087.
- Lee, B. G.; Park, E. Y.; Lee, K. E.; Jeon, H.; Sung, K. H.; Paulsen, H.; Rubsamen-Schaeff, H.; Brötz-Oesterhelt, H.; Song, H. K. Nat. Struct. Mol. Biol. 2010, 17, 471-478.
- Stahl, M.; Korotkov, V. S.; Balogh, D.; Kick, L. M.; Gersch, M.; Pahl, A.; Kielkowski, P.; Richter, K.; Schneider, S.; Sieber, S. A. Angew. Chem. 2018, 57, 14602-14607.
- Graves, P.R.; Aponte-Collazo, L.J.; Fennell, E.M.J.; Graves, A.C.; Hale, A.E.; Dicheva, N.; Herring, L.E.; Gilbert, T.S.K.; East, M.P.; McDonald, I.M.; Lockett, M.R.; Ashamalla, H.; Moorman, N.J.; Karanewsky, D.S.; Iwanowicz, E.J.; Holmuhamedov, E.; Graves, L.M. ACS Chem Biol. 2019, 14, 1020-1029.
- Ishizawa, J.; Zarabi, S.F.; Davis, R.E.; Halgas, O.; Nii, T.; Jitkova, Y.; Zhao, R.; St-Germain, J.; Heese, L.E.; Egan, G.; Ruvolo, V.R.; Barghout, S.H.; Nishida, Y.; Hurren, R.; Ma, W.; Gronda, M.; Link, T.; Wong, K.; Mabanglo, M.; Kojima, K.; Borthakur, G.; MacLean, N.; Ma, M.C.J.; Leber, A.B.; Minden, M.D.; Houry, W.; Kantarjian, H.; Stogniew, M.; Raught, B.; Pai, E.F.; Schimmer, A.D.; Andreeff, M. Cancer Cell, 2019, 35, 721-737.
- Madhukar, N.; Prabhu, V.V.; Anantharaman, L.; Sulli, C.; Davidson, E.; Deacon, S.; Tarapore, R.; Rucker, J.; Charter, N.; Doranz, B.; Oster, W.; Elemento, O.; Free, R.B.; Sibley, D.; Allen, J.E. Neuro Oncol. 2017, 19, 81–82.
- Carosati, E.; Sciabola, S.; Cruciani, G. J. Med. Chem. 2004, 47, 5114-5125.
- Jones, J.E.; Proc, R.; Soc; London; Lee, B.; Richards, F.M.; Jorgensen, E.C.; Connolly, M.L.; Ferrin, T.C.; Langridge, R.; Oatley, S.J.; Burridge, J.M.; Blake, C.C.F. J. Med. Chem, 1985, 28-32.
- Cheeseright, T., Mackey, M., Rose, S., & Vinter, A. Molecular field extrema as descriptors of biological activity: definition and validation. J. Chem. Inf. Model., 2006, 46(2), 665–676.
- Bauer, M. R., & Mackey, M. D. Electrostatic Complementarity as a Fast and Effective Tool to Optimize Binding and Selectivity of Protein-Ligand Complexes. J. Med. Chem., 2019, 62(6), 3036–3050.
- Case, D. A., Cheatham, T. E., 3rd, Darden, T., Gohlke, H., Luo, R., Merz, K. M., Jr, Onufriev, A., Simmerling, C., Wang, B., & Woods, R. J. The Amber biomolecular simulation programs. J. Comput. Chem. 2005, 26(16), 1668-1688.
- Salomon-Ferrer, R., Case, D.A., Walker, R. WIREs Comput Mol Sci, 2013, 3: 198–210.
- Wong, K.S.; Mabanglo, M.F.; Seraphim, T.V.; Mollica, A.; Mao, Y.-Q.; Rizzolo, K.; Leung, E.; Moutaoufik, M.T.; Hoell, L.; Phanse, S.; Goodreid, J.; Barbosa, L.R.S.; Ramos, C.H.I.; Babu, M.; Mennella, V.; Batey, R.A.; Schimmer, A.D.; Houry, W.A. Cell Chem. Biol. 2018, 25, 1017-1030.
- Iacopetta, D.; Madeo, M.; Tasco, G.; Carrisi, C.; Curcio, R.; Martello, E.; Casadio, R.; Capobianco, L.; Dolce, V. Biochim. Biophys Acta 2011, 1807, 251-261.
- Lunetti, P.; Cappello, A.R.; Marsano, R.M.; Pierri, C.L.; Carrisi, C.; Martello, E.; Caggese, C.; Dolce, V.; Capobianco, L. Biochim Biophys Acta. 2013, 1827, 1245-1255.
- See, Y.P.; Jackowski, G. Protein Structure (Creighton, T. E., ed.), IRL Press, Oxford; 1990.
- Tiwari, P.; Kaila, P.; Guptasarma, P. Electrophoresis. 2019, 40, 1273-1281.
- Corydon, T.J.; Bross, P.; Holst, H.U.; Neve, S.; Kristiansen, K.; Gregersen, N.; Bolund, L. Biochem J. 1998, 331, 309-316.
- Kang, S.G.; Dimitrova, M.N.; Ortega, J.; Ginsburg, A.; Maurizi, M.R. J Biol Chem. 2005, 280, 35424-35432.
- Aziz-Bose, R.; Monje, M. Curr Opin Oncol. 2019, 31, 522–530.
- Grasso, C.S.; Tang, Y.; Truffaux, N.; Berlow, N.E.; Liu, L.; Debily, M.A.; Quist, M.J.; Davis, L.E.; Huang, E.C.; Woo, P.J.; Ponnuswami, A.; Chen, S.; Johung, T.B.; Sun, W.; Kogiso, M.; Du, Y.; Qi, L. Huang, Y.; Hütt-Cabezas, M.; Warren, K.E.; Le Dret, L.; Meltzer, P.S.; Mao, H.; Quezado, M.; van Vuurden, D.G., Abraham, J.; Fouladi, M.; Svalina, M.N.; Wang, N.; Hawkins, C.; Nazarian, J.; Alonso, M.M.; Raabe, E.H.; Hulleman, E.; Spellman, P.T.; Li, X.N.; Keller, C.; Pal, R.; Grill, J.; Monje, M. Nat Med. 2015, 21, 555-559.
- Qin, E.Y.; Cooper, D.D.; Abbott, K.L.; Lennon, J.; Nagaraja, S.; Mackay, A.; Jones, C.; Vogel, H. Jackson, P.K.; Monje, M. Cell. 2017, 170, 845-859.
- Contino, M.; Guglielmo, S.; Riganti, C.; Antonello, G.; Perrone, M.G.; Giampietro, R.; Rolando, B.; Fruttero, R.; Colabufo, N.A. Eur. J. Med. Chem. 2020, 208, 112843-112864.
- Braconi, L.; Dei, S.; Contino, M.; Riganti, C.; Bartolucci, G.; Manetti, D.; Romanelli, M.; Perrone, M.G.; Colabufo, N.A. Guglielmo, S.; Teodori, E. Eur. J. Med. Chem. 2023, 259, 115716-115739.
- Biondic, M.C.; Erra-Balsells, R. J. Chem. Soc. Perkin trans. II, 1992, Issue 7.
- Alijanpour, S.; Jafaripour, S.; Ghasemzadeh, Z.; Khakpai, F.; Zarrindast, M.R. Eur. J. Pharmacol. 2021, 893, 173806-173812.
- Mosaffa, S.; Ahmadi, H.; Khakpai, F.; Ebrahimi-Ghiri, M.; Zarrindast, M.R. Psychopharmacology, 2021, 238, 259-269.
- Zhao, T.; Ding, K.-M.; Zhang, L.; Cheng, X.-M.; Wang, C.-H.; Wang, Z.-T. J. Chem. 2013, 2013, 1-6.
- Herraiz, T.; Gonzalez, D.; Ancin-Azpilicueta, C.; Arán, V. J.; Guillén, H. Food Chem. Toxicol. 2010, 48, 839-845.
- Bensalem, S.; Soubhye, J.; Aldib, I.; Bournine, L.; Nguyen, A.T.; Vanhaeverbeek, M.; Rousseau, A.; Boudjeltia, K.Z.; Sarakbi, A.; Kauffmann, J.M.; Nève, J.; Prévost, M.; Stévigny, C.; Maiza-Benabdesselam, F.; Bedjou, F.; Van Antwerpen, P.; Duez, P. J Ethnopharmacol. 2014, 154, 361-369.
- Uddin, M.J.; Xu, S.; Crews, B.C.; Aleem, A.M.; Ghebreselasie, K.; Banerjee, S.; Marnett, L.J. ACS Med Chem Lett. 2020, 11, 1881-1885.
- Li, S.P.; Wang, Y.W.; Qi, S.L.; Zhang, Y.P., Deng, G.; Ding, W.Z.; Ma, C.; Lin, Q.Y.; Guan, H.D.; Liu, W., Cheng, X.M.; Wang, C.H. Front Pharmacol. 2019, 24, 1430-1447.
- Roy, S.; Mohammad, T.; Gupta, P.; Dahiya, R.; Parveen, S.; Luqman, S.; Hasan, G.M.; Hassan, M.I. ACS Omega. 2020, 42, 27480–27491.
- Rashidi, M.; Mahmoudian, E.; Mirzaei, S.; Mazloomi, S.N.; Bazi, A.; Azadeh, H.; Mozaffari, M. Chem Biol Interact. 2022, 365, 1100871100.
- Adnan, M.; Anwar, S.; DasGupta, D.; Patel, M.; Elasbali, A.M.; Alhassan, H.H.; Shafie, A.; Siddiqui, A.J.; Bardakci, F.; Snoussi, M.; Hassan, M.I. Int J Biol Macromol. 2023, 224, 188-195.
- Hashemi, S.; Shabani, S.; Rabiei, Z.; Enferadi, S.T.; Vannozzi G.P; Biotechnol Rep 2015, 8, 138-143.
- Jackson, E.R.; Persson, M.L.; Fish, C.J.; Findlay, I.J.; Mueller, S.; Nazarian, J.; Hulleman, E.; van der Lugt, J.; Duchatel, R.J.; Dun, M.D. Neuro Oncol. 2023, 17, 144-152.
- Zingales, V.; Torriero, N.; Zanella, L.; Fernández-Franzón, M.; Ruiz, M.J., Esposito, M.R.; Cimetta, E. Food Chem. Toxicol. 2021, 157, 112605-112619.
- Mahringer, A.; Fricker, G. Expert Opin. Drug Metab. Toxicol. 2016, 12, 499- 508.
- Orlický, J.; Sulová, Z.; Dovinová, I; Fiala, R;. Zahradníková, A. Jr.; Breier, A. Gen Physiol Biophys. 2004, 23, 357-66.
- Remigijus, D.; Pranas J.; Alex A.; Alanas P.; J Drug Target 2003, 11, 391-406.
- Chatterjee, S.; Deshpande, A.A.; Shen, H. Biopharm Drug Dispos. 2023, 44, 7-25.












| MPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPASTENLYFQGKLGKPIPNPLLGLDSTRTGHHHHHH | |
| TEV sequence | ENLYFQG |
| V5 epitope | GKPIPNPLLGLDST |
| His Tag | HHHHHH |
| Ligand |
Bennet(kcal/mol) |
FEP (kcal/mol) |
TI (kcal/mol) |
Consensus (kcal/mol) |
| Harmaline | -28.13 | -28.08 | -27.49 | -27.91 ± 1.87 |
| ONC201 | -34.08 | -32.51 | -32.44 | -33.27 ± 1.64 |
| Drugs | SH-SY-5Y cell viability (%) | SK-N-AS cell viability (%) |
|---|---|---|
| ONC201 | 13.67 ± 6.23 | 17.5 ± 6.80 |
| Harmaline | 67.48 ± 13.91 | 44.24 ± 24.25 |
| Drugs | P-gp EC50, µM |
ATP | PappBA (nm/sec) |
PappAB (nm/sec) |
BCRP EC50, µM |
|---|---|---|---|---|---|
| ONC201 | 13.4 | NO | 2157 | 356 | >100 |
| Harmaline | >100 | NT | 2539 | 496 | 14.9 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).