Preprint
Review

This version is not peer-reviewed.

Plant-Derived Antimicrobial Peptides: A Plant Defense Weapon against Biotic and Abiotic Stresses

Submitted:

16 November 2023

Posted:

23 November 2023

You are already at the latest version

Abstract
Global agriculture has been forced to increase food production to feed the growing human population, while confronting various environmental obstacles such as global warming, resistance to pathogens, and constraints on arable land caused by soil salinity, drought, rising sea level, saltwater intrusion, and urbanization. Regarding abiotic stresses, salinity is a worldwide problem for agricultural production. Many efforts, therefore, have been made to cope with the environmental challenges, however, the progress of salinization, which is mainly caused and accelerated by anthropogenic activities, is likely faster than our progress in finding ways to deal with this problem. In addition, drought represents a global threat to the production of major crops. In addition, pests and pathogens cause significant crop losses and diminish global food security. Among the various strategies that have been investigated and applied in plant science, antimicrobial peptides derived from plants have caught widespread attention from scientists since these peptides exhibit beneficial biological activities. In agricultural science, there have been reports on the roles of antimicrobial peptides with active properties against biotic and abiotic stresses. Non-specific plant lipid transfer proteins, thionins, systemins, defensins, cyclotides, and heveins-like antimicrobial peptides are common antimicrobial peptides that have been found to be involved in the defense system against fungi and insect pests. Based on their potential ability to protect crops from pests, bacteria, and pathogenic fungi, the use of antimicrobial peptide genes in creating transgenic plants has been largely conducted during the last decades, and these studies have obtained positive results against the growth of fungi and bacteria. This review will focus on the latest progress in studies of antimicrobial peptides related to biotic and abiotic stress tolerance in plants. We will also update the current progress in the development of antimicrobial peptide-based transgenic crops.
Keywords: 
;  ;  ;  ;  ;  ;  ;  

1. Introduction

The world’s agricultural system needs to dramatically increase its productivity to satisfy the nutrient demands of an estimated 8.5 x 109 inhabitants in 2025 [1]. Furthermore, the increase in per capita income in various developing countries has intensified the requirement for food supply in terms of both quantity and quality [2]. In contrast, the global agricultural production is suffering from various environmental challenges such as pest pressure [3], soil pollution [4], ground water pollution [5], shortage of fresh water for irrigation [6], drought [7], and salinity stress [8]. Among these ecological threats, salinity has largely been considered as one of the crucial burdens on agriculture worldwide as it dramatically diminishes the productivity of crop plants or even destroys crop production [9]. Currently, the area of global land affected by salinity, to some extent, exceeds 8.31-11.73 million km2 [10]. Drought stress, which is caused by global warming and reduced precipitation, is becoming one of the main limiting factors of plant growth and yield [11]. In addition, the loss of global crop production caused by phytopathogens, and pests is 20–40%, which accounts for $290 billion per year [12]. The injudicious application of synthetic chemical pesticides and antibiotics poses a threat to human health, environmental pollution, and the development of pesticide resistance [13,14,15]. Furthermore, chemical agents adversely affect the population of beneficial soil microbes such as Enterobacter, Aeromonas, Comamonas, Stenotrophomonas, Bordetella, and Staphylococcus [16]. These severe circumstances urge agricultural scientists to find nonconventional sources for protecting important crops. The diversity, ubiquity, and versatility of plant-derived antimicrobial peptides (PAMPs) make them abundant pools for novel metabolite supply; these pools have potential applications in medicine, agriculture, and food industry [17,18,19]. Currently, a variety of strategies have been deployed to mitigate the adverse effects of biotic and abiotic stresses on plants. These strategies include plant breeding [20], acclimation[21], seed biopriming [22,23], plant growth-promoting rhizobacteria (PGPR) [24], and the application of non-protein amino acids (NPAAs) (e.g., 5-hydroxynorvaline, meta-tyrosine, GABA (c-aminobutyric acid), BABA (b-aminobutyric acid, Canavanine, L-DOPA, Mimosine, etc.) [25]. In addition to these approaches, research has focused on the effects of PAMPs on plant defense systems to improve resistance to phytopathogens [26], and on enhancing the adaptive mechanism to abiotic stresses [27] have been conducted. These studies have shown that PAMPs directly act as insecticidal molecules that inhibit the growth of insect larvae [28] or as inhibitors that suppress the growth of bacteria or pathogenic fungi [29]. Although the roles of PAMPs in the suppression of bacteria and fungi have been extensively investigated [30,31,32] their roles in reducing the negative effects of abiotic stresses appear to be neglected. In fact, not many papers have been found to work on the functions of PAMPs in improving plant tolerance to salinity and drought stress [33,34], heavy metals [35], and wound stress[36]. Transgenic crops have been developed over the past decades to integrate beneficial genes from bacteria, fungi, and other plant species into the host plant genomes. In addition to the well-known Bt genes from Bacillus thuringiensis, the PAMPs genes have also been widely used to provide new agronomic characteristics, including resistance to biotic and abiotic stresses [37]. In this review, we update the latest progress in the development of transgenic plants using PAMPs-encoding genes from different plant species to improve the resistance of important plants to biotic and abiotic stresses.

2. Thionins

2.1. Roles of thionins in mitigating biotic and abiotic stress

There are six major PAMP families, such as thionins, defensins, non-specific lipid transfer proteins, hevein, and knottin-like peptides, hairpinins and cyclotides. These families were classified based on the cysteine spacing motifs and 3-dimensional (3D) structures [38]. The family of thionins was the first PAMP whose antipathogenic properties were determined in vitro. These antimicrobial peptides are found only in some plant families of angiosperms and are composed of 6 or 8 cysteine residues (~5 kDa). The 3D folding pattern of thionins is stabilized by 6 to 8 disulfide-linked cysteines [38].
There are two action modes of thionins on pathogen cells: (i) Thionins interact with negatively charged phospholipids, such as phosphatidic acid or phosphatidyl serine, in the cell membrane [39]. The formation of a proteolipid complex induces membrane solubilization and lysis. Additionally, the withdrawal of phospholipids also interrupts the fluidity of the cell membrane, leading to irreparable lysis of the membrane [40]. (ii) Thionins insert into the membrane and act as a water channel through the α HTH double α -helix core. Water is allowed to pass through this narrow channel to the center of the bilayer membrane. However, it is then expelled from the center because of the random motion of phospholipids caused by repulsive interactions. This process frequently repeats, causing local membrane disintegration [41].
Decades ago, it was reported that a Thi2.1 cDNA from Arabidopsis thaliana, expressed in the BVE-E6E7 bovine endothelial cell line, inhibited the viability (> 97%) of Escherichia coli, Staphylococcus aureus, and Candida albicans [42]. A thionin-like peptide from Capsicum annuum, called CaThi, had a strong suppressive effect against Candida spp. with half-maximal inhibitory concentrations (IC50) of 10 to 40 µg/mL [43]. CaThi was also found to permeabilize the plasma membrane in all tested Candida species and to induce oxidative stress in C. tropicalis. The synergistic effect between CaThi and fluconazole significantly enhanced their candidacidal activity [43]. A 15 kDa-Thi2.4 protein from A. thaliana was found to interact with the virulence factor, fungal fruit body lectin (FFBL), of Fusarium graminearum, thereby reducing the toxicity of F. graminearum, in addition to the known antifungal property of Thi2.4 [44]. In the bird cherry oat aphid-resistant barley Hsp5 genotype, the transcript abundance of the thionin genes THIO1567 and THIO1570 was significantly greater than in the susceptible genotype Lina. Furthermore, the expression of THIO1570 and proteinase inhibitor (PI) genes in the resistant breeding line BC1 exceeded that in the susceptible breeding line BC2. These genes were found to be constitutively expressed in the resistant genotypes, contributing to the resistance trait against the aphid (Rhopalosiphum padi L.) [45]. Upon nematode infection, thionin genes were suppressed earlier and more strongly than in the susceptible genotype (Oryza sativa) Nipponbare than in the resistant (Oryza glaberrima) accession TOG5681 [46]. Under drought stress conditions, the susceptible barley cultivar Concerto showed increased expression of the HvTHIO1 gene [47]. A combination of osmotic and heat stress caused higher susceptibility of Arabidopsis plants to Botrytis cinerea, possibly due to the reduced expression of defense genes, including PLANT DEFENSIN 1.3 (PDF1.3), BOTRYTIS SUSCEPTIBLE 1 (BOS1), THIONIN2.2 (THI2.2), and cell wall-related genes [48]. Thio-60 protein extracted from transgenic onion (Allium cepa L.) showed a higher inhibitory effect on spore germination of the fungus Aspergillus niger, with an inhibition of 52% compared to 37% of the non-transgenic protein [49]. Thionins also play roles in plant defense by perceiving pathogens and initiating signal transduction pathways. These pathways interconnect with a variety of defense processes that are regulated by phytohormones, such as salicylic acid (SA), jasmonic acid (JA), and ethylene [50].

2.2. Transgenic plants with thionin genes for enhanced biotic and abiotic stress tolerance

Thionin gene Thi2.1, encoding 5 kDa cysteine-rich antimicrobial peptides, was upregulated in the resistant Arabidopsis ecotype UK-4 upon Fusarium oxysporum f. sp. matthiolae infection, and its overexpression in susceptible Col-2 seedlings delayed chlorophyll loss, inhibited fungal growth, and caused severe abnormalities of the fungal phenotype [51]. The thionin gene Thi2.1 was introduced into the tomato genome, generating transgenic plants with enhanced resistance to both Fusarium wilt (FW) (F. oxysporum f. sp. lycopersici) and bacterial wilt (BW) (Ralstonia solanacearum) [52]. In BW inoculation assay, the RB7/Thi2.1 transgenic lines exhibited disease incidence comparable to the BW resistant variety H7996. Similarly, in FW inoculation test, RB7/Thi2.1 transgenic lines R7 and R11 showed a disease severity similar to the FW resistant variety MH1 and significantly lower disease incidence than WT plants (Chan et al. 2005). β-purothionin, a member of thionins from wheat endosperm, is a 45-amino-acid residue peptide with 4 disulfide bonds and a high cationic charge, making it stable in environmental conditions. Transgenic Arabidopsis plants expressing the β-purothionin gene driven by a leaf-specific chloroplast carbonic anhydrase promoter displayed the highest resistance to Pseudomonas syringae strain DC3000 without any leaf infection symptoms. In vitro bioassays with F. oxysporum revealed that transgenic seedlings survived for 12–15 days with less necrosis and discoloration after fungal inoculation, compared to control seedlings which died within 6–8 days [53].
A barley 𝛼-hordothionin (𝛼-HT) gene with 384 bp in length, driven by a strong constitutive promoter El2𝛺 or 𝛽-amylase (𝛽-Amy) promoter (the 5'-UTR region), was transformed into the sweet potato cultivar Kokei No. 14, to confer the resistance trait to Ceratocystis fimbriata (Muramoto et al. 2012), the most damaging postharvest disease of sweet potato (Ipomoea batatas (L.) Lam.) [54]. To examine the resistance of the storage roots of the transgenic sweet potato to C. fimbriata, wounds were made and inoculated with a suspension of C. fimbriata spores. The black lesions of the transgenic El2𝛺: 𝛼-HT No. 1 (119 mm2) and 𝛽-Amy: 𝛼-HT No. 060201 (111 mm2) were much smaller than those of the non-transgenic Kokei No. 14 (283 mm2), indicating that the transgenic sweet potato lines acquired a new resistance trait to C. fimbriata [55]. Huanglongbing (HLB) is the most dangerous disease affecting global citrus production; thus, many efforts, including engineering plants with improved disease resistance, have been conducted extensively [56,57]. An endogenous citrus thionin gene was genetically modified to obtain Mthionin and transformed it into the Carrizo citrus genome to create transgenic Carrizo plants resistant to HLB disease and the citrus canker disease caused by Candidatus Liberibacter asiaticus (Las) and Xanthomonas citri, respectively [58]. Leaf infiltration assays showed that the Mthionin transgenic leaves displayed reduced or no canker development at low to high concentration of X. citri (104–107 CFU/mL). Compared to control plants, grafted plants with the transgenic Carrizo rootstock showed significantly lower Las titer young leaves and roots, indicating that Mthionin is a promising tool for HLB control [58]. In another study, the modified thionin (Mthionin) gene, driven by a double 35S promoter, was inserted into the A. thaliana genome using the floral dip method [59]. The transgenic lines A24 and A52 had the highest Mthionin expression levels and showed reduced water soaking, lesions, and fungal biomass in detached leaf assays. After being sprayed with F. graminearum (5 x 105 conidia/mL), GUS transgenic plants developed severe symptoms (dry flowers, dry siliques, and dead branches), while Mthionin transgenic plants remained asymptomatic. Furthermore, F. graminearum conidia failed to germinate normally on Mthionin Arabidopsis leaves. At 48 h after inoculation, the expression of DEFENSIN1.2 in Mthionin plants was significantly higher than in GUS plants, suggesting that Mthionin enhanced resistance to Fusarium spp. by regulating the defense genes and phytohormone signaling. Ectopic expression of two thionin genes AK252675.1 and AK359149 from barley in Nicotiana benthamiana reduced host susceptibility to Myzus persicae, which indicated the important role of thionin genes in resistance to aphids [60]. Recently, a Thio-60 gene from A. thaliana was transformed into three date palm (Phoenix dactylifera L.) cultivars (Barhy, Sakkoti, and Shamia), resulting in transgenic date palm with higher resistance to F. oxysporum, as shown by pathogenicity test with F. oxysporum suspension on detached leaves [61].
To date, most studies have focused on the role of thionins in biotic stress resistance. Only a few papers have investigated the role of thionins in mitigating the toxicity of heavy metals to plants. Liu et al. (2023) showed that the defensin-dissimilar thionin gene OsThi9 in rice was strongly expressed in roots, basal and middle stems, and growing seeds after exposure to 0.1 µM CdCl2 for up to 7 days [62]. Overexpression of OsThi9 in rice reduced the translocation of Cd from roots to shoots, thereby reducing Cd concentrations in the leaves, stems, and brown rice of the OsThi9-overexpressing plants grown in Cd-contaminated soil.

3. Defensins

3.1. Antimicrobial activities of defensins and their roles in enhancing abiotic stress tolerance in plants

Defensins, a well-studied family of PAMPs found in Brassicaceae, Fabaceae, and Solanaceae families, are small amphipathic cationic peptides with 45 to 54 amino acids (aa) and 8 conserved cysteine residues that form 4 disulfide bridges [63]. These disulfide bonds contribute to their stability under protease attack, a wide range of pH, and extreme temperatures [64]. Plant-derived defensins are classified as cis-defensin superfamily, while mammalian defensins belong to trans-defensin superfamily [65]. Defensin genes are differentially expressed during growth and development, in biotic and abiotic stress conditions, and in harmony with phytohormones [66]. The transcription factor WRKY75 positively regulated the expression of defense-related genes in the JA signaling pathway, including OCTADECANOID-RESPONSIVE ARABIDOPSIS (ORA59) and PLANT DEFENSIN gene PDF1.2, as evidenced by the downregulation of these genes in wrky75 mutants and their upregulation in WRKY75-overexpressing plants [67].
Like thionins, defensins use two antimicrobial strategies: membrane disruption and inhibition of cellular machinery. The γ-core motif is essential for the antimicrobial properties of defensins, as thoroughly reviewed by Slezina and colleagues [68,69]. In plants, the expression of defensins is triggered by the mitogen-activated protein kinase (MAPK) cascade, which is activated by two main responses: effector-triggered immunity (ETI) and MAMP-triggered immunity (MTI), in response to fungal and bacterial infection [70]. The defensin gene CADEF1 was not expressed in healthy pepper leaves, but was induced by abiotic elicitors, such as H2O2, artificial wounding, salinity, and drought, stress hormones SA, methyl jasmonate (MeJA), JA, abscisic acid (ABA), and ET [70], and inoculation with virulent Xanthomonas campestris pv. vesicatoria [71]. The defensin genes OsDEF7 and OsDEF8 were highly upregulated by Xanthomonas oryzae pv. oryzae infection, and by abiotic stresses such as imbibition, anoxia, drought, cold, and dehydration [72]. In Arabidopsis leaves inoculated with Alternaria brassicicola or P. syringae, the expression of some defensin-like (DEFL) genes was highly upregulated, likely stimulated via JA signaling [73].
Protein Cp-thionin II, a plant defensin isolated from cowpea (Vigna unguiculata) seeds, exhibited bactericidal activity against S. aureus ATTC25923 (MIC of 128 μg/mL), E. coli ATTC 25922 (MIC of 64 μg/mL), and P. syringae (MIC of 42 μg/mL) [74]. DefSm2-D (KLCEKPSKTWFGNCGNPRHCGDQCKWEGVHGACHVRNGKHMCFCYFNCPQAE) is an antifungal protein from wild thistle (Silybum marianum) with a defensin domain [75]. To determine the antifungal activities of peptide fragments, truncated versions of DefSm2-D, such as SmAPα1-21 (KLCEKPSKTWFGNCGNPRHCG), SmAPα10-21 (WFGNCGNPRHCG), SmA-Pγ29-35 (GAVHGAC), and SmAPγ27-44 (WEGAVHGACHVRNGKHMC), were designed to determine the antifungal activities of peptide fragments. Among the truncated versions of DefSm2-D, SmAPγ27-44 exhibited the strongest antagonistic activity against F. graminearum with a MIC50 value of 20 μM, followed by SmAPα1-21 and SmAPα10-21 with MIC50 values of 32 μM and 70 μM, respectively. It was found that the Arg38 residue in the γ-core domain was dramatically important to the antifungal activity of defensin, which explained the highest antifungal effect of SmAPγ27-44 [76]. Additionally, the presence of 3 extra cationic Lysine (Lys) residues, 1 anionic Glutamic acid (Glu) residue, and one Tryptophan (Trp) residue in the SmAPα1-21 structure may account for its membrane interface capability. The site-specific binding targets on pathogen cell wall or cell membrane are critical for the further inhibition process of SmAPα1-21. Moreover, due to the difference in composition between fungal cell walls and host cells, SmAPα1-21 performs its selective activity only on the fungus, not on the host.
The scots pine (Pinus sylvestris L.) gene PsDef5.1 was expressed in mature and immature seeds, in the seedling and reproductive organs such as male cones and pollen. The recombinant PsDef5.1 protein fused with a thioredoxin (Trx) had a cysteine rich α-motif (CX5CX3CX7CX9CXC) and a γ-core motif (GXCX9C), and expressed inhibitory activity against F. sporotrichiella, B. cinerea, Phytophthora gonapodyides, Bacillus pumilus, Pectobacterium carotovorum and P. fluorescens [66]. Plant defensins have been rarely studied in abiotic responses such as heavy metal exposure, but they have been shown to play a role in zinc tolerance, iron homeostasis, and disease resistance. In the shoots of the zinc-tolerant plant Arabidopsis halleri ssp. halleri, defensin proteins accumulated at high concentrations and defensin gene expression increased in response to Zn treatment [77]. The defensin gene AtPDF1.1 was also upregulated in response to infection with the necrotropic bacterium P. carotovorum subsp. carotovorum (Pcc) [78]. AtPDF1.1 was also involved in iron homeostasis because its expression was highly upregulated by iron overloading[78]. It was found that AtPDF1.1 endowed plant tolerance to Pcc by disturbing iron homeostasis via iron chelation [78]. Consequently, iron deficiency activated the iron-deficiency-induced ethylene signaling pathway, resulting in enhanced tolerance to Pcc. In contrast to the susceptible variety JG62, six defensin and defensin-like genes CaDEF1.1B, CaDEF2.4, CaDEF2.5a, CaDEF3, CaDEF5, and CaDEFL2 were expressed at elevated levels in the resistant wild chickpea ICC17160 upon F. oxysporum f. sp. ciceris and Rhizoctonia bataticola infection [79]. These findings strongly suggest that these defensin genes play a role in both biotic and abiotic stress responses.

3.2. Transgenic plants with defensin genes for enhanced biotic and abiotic stress tolerance

The first attempt to transform defensin genes into plant genomes to increase resistance towards phytopathogenic fungi was made by Bondt et al. (1998) [80]. Since then, many defensins transgenic plants have been continuously generated by several research groups [81,82,83,84,85,86]. Recently, overexpression of the defensin gene NaD1 from Nicotiana alata in tobacco (Nicotiana tabacum) var. Xanthi tobacco enhanced drought stress tolerance by maintaining photo-synthetic pigments and increasing antioxidant enzyme activity [87]. Under drought conditions, the NaD1 transgenic tobacco lines showed a significant increase in the chlorophyll a, b contents, as well as the total chlorophyll content. In addition, the activities of the antioxidant enzymes catalase (CAT), peroxidase, ascorbate peroxidase (APX), and superoxide dismutase (SOD) in the transgenic lines were higher than in the non-transgenic line under drought stress. This resulted in a lower oxidative damage caused by elevated ROS accumulation.
Chelation is one of the main mechanisms for cadmium (Cd) detoxification in plants [88]. The defensin gene AhPDF1.1 from the zinc hyperaccumulating plant A. halleri ssp. halleri was transformed into the A. thaliana under the control of the 35S promoter, resulting in transgenic A. thaliana plants with increased Zn tolerance [77]. It was found that defensins AtPDF2.6 in Arabidopsis and defensin CAL2 in rice had Cd binding activity [88,89]. However, overexpression of CAL2 in Arabidopsis conferred a Cd-sensitive phenotype. Similarly, overexpression of CAL2 in rice did not enhance rice tolerance to Cd (Luo et al. 2020). In contrast, overexpression of AtPDF2.6 resulted in enhanced Cd tolerance in the transgenic Arabidopsis plants, while Atpdf2.6 knockout mutants expressed higher sensitivity to Cd than the wild type (WT). The results suggest that AtPDF2.6 detoxifies cytoplasmic Cd through Cd chelation [88]. All eight cysteine residues in AtPDF2.5 were required for Cd tolerance and chelation, and the disruption of AtPDF2.5 reduced Cd tolerance in plants [88]. Physiological analysis indicated that AtPDF2.5 promoted Cd efflux from the cytoplasm and regulated Cd accumulation in the cell wall [88].

4. Cyclotides

4.1. Antimicrobial activities of cyclotides and their roles in alleviating abiotic stress

Cyclotides are a series of plant-derived macrocyclic peptides, each with 28–37 aa and an embedded cystine knot. So far, cyclotides are found in five major plant families: Rubiaceae, Violaceae, Solanaceae, Cucurbitaceae, and Fabaceae [90]. Some cyclotide-like genes were also found in plants of the Poaceae family, i.e., O. sativa, Zea mays, Triticum aestivum, Agrostis stolonifera, Schedonorus arundinaceus, Pennisetum glaucum, Sorghum bicolor, Hordeum vulgare, Saccharum offificinarum, and Setaria italica. Cyclotides displayed high binding affinity to metals, and showed antiviral, antibacterial, and insecticidal properties [91]. The unique structure of cyclotides, e.g., a head-to-tail cyclic peptide backbone together with a cystine knot in which two disulfide bonds are linked by a third disulfide bond, allow them to dissolve in both organic and aqueous solvents, and to withstand extreme temperature, pH, and enzymatic degradation [92].
The cyclotide kalata B1 was isolated from 6 different plants, including Oldenlandia affinis, Viola tricolor, Viola yedoensis, Viola philippica, Viola baoshanensis, and Viola odorata and it was the first cyclotide reported and structurally characterized [92,93]. Historically, in some tribes in Congo, O. affinis was used as a medicinal tea to accelerate childbirth and was named after the name of the native medicine “kalata-kalata” in the Tsjiluba language [94]. Due to its remarkable stability, kalata B1 can resist boiling and harsh chemical and enzymatic conditions in the human digestive system. Cyclotides kalata B1 and kalata B2 from O. affinis were found to have insecticidal activity against Helicoverpa punctigera and Helicoverpa armigera, respectively [95,96]. Kalata B1 severely retarded the growth of H. armigera larvae at a low concentration (0.13% w/v) and caused a remarkable reduction in nutrient intake at a higher concentration (0.24% w/v). The ingestion of kalata B1 also caused severe changes in the midgut of H. armigera larvae, including the rupture of epithelial cells [97]. The changes in morphology of the midgut epithelial cells affected by kalata B1 resemble those induced by the 𝛿-endotoxins from B. thuringiensis (Bt), a commonly used endotoxin to control insect pests [98]. Golden apple snail (Pomacea canaliculata), a dangerous herbivore of rice and native aquatic plants, is controlled using mechanical, agricultural, and chemical methods, including metaldehyde. However, metaldehyde is toxic to nontarget species, such as mammals [99]. Kalata B2, the most abundant cyclotide in O. affinis leaves, is more effective at killing golden apple snails than metaldehyde (LC50 of 53 μM vs. 133 μM) [100]. Cyclotides from the butterfly pea plant (Clitoria ternatea) can be used as eco-friendly insecticides. For example, the cyclotide Cter M, isolated from C. ternatea leaves and flowers, exhibited insecticidal activity against the cotton budworm H. armigera. In 2017, Sero-X®, a commercial bioinsecticide made from C. ternatea extracts, was approved for large-scale use in Australia [101]. Cycloviolacin (CyO2), a cyclopeptide produced by sweet violet (Viola odorata L.), has antagonistic activity against a variety of fungi and bacteria, including Colletotrichum utrechtense, Alternaria alternata, F. oxysporum, Fusarium graminearum, Fusarium culmorum, Mycosphaerella fragariae, B. cinerea, P. syringae pv. syringae, Dickeya dadantii, and Pseudomonas atrosepticum, with MICs varying from 0.8 to 100 µM. CyO2 uses two modes of action to control fungal and bacterial growth: membrane disruption and intracellular target interference [101].
Cyclotides are promising plant proteins with the potential to improve abiotic stress tolerance. However, their role in abiotic stress responses is still poorly understood and needs further investigation. V. baoshanensis, a plant species of the genus Viola, is a Cd hyperaccumulator [102]. The average Cd levels accumulated in the shoots and roots of this plant grown on lead-zinc mine were 1168 and 981 mg/kg biomass, respectively [103]. In V. baoshanensis leaves, the mRNA of the cyclotide precursor VbCP7S and its spliced version VbCP6S showed Cd-dependent upregulation patterns [104]. Similarly, the cyclotide-like genes Zmcyc1 and Zmcyc5 were induced by pathogenic fungi (e.g., F. graminearum, and Ustilago maydis), aphid infection (Rhopalosiphum maydis), abiotic stress (e.g., drought, salinity, and mechanical wounding), and phytohormones (e.g., SA and MeJA) in the maize leaves and stems [105]. The upregulation of cyclotide-like genes in maize after MeJA and SA treatment suggests that they are likely involved in plant defense systems like cyclotide genes.

4.2. The use of cyclotide genes in transgenic plant development to alleviate biotic and abiotic stresses

Five cyclotide precursor genes (VbCP1-VbCP5), together with a cysteine-rich small protein gene Vb40 from V. baoshanensis, conferred copper (Cu) tolerance in the transgenic Saccharomyces cerevisiae YL36 [106]. This finding suggests that metal-binding proteins protect plants from heavy metal toxicity, thus endowing a higher metal tolerance to their hosts. The heavy metal binding capacity and metal tolerance of Chlamydomonas reinhardtii could be improved by transforming it with a class-II metallothionein (MT-II) from chicken[107]. As a result, the transgenic C. reinhardtii sequestered more Cd from the growth medium than the WT (9% vs. 5.5%) [107]. The kalata B1 (Oak1) gene from Oldenlandia affinis was transformed into seed-derived rice calli to produce transgenic rice plants that express the molluscicidal cyclotide kalata B1, which is toxic to the golden apple snail (Pomacea canaliculata) [108].

5. Hevein-like antimicrobial peptides

5.1. Antimicrobial activities and their roles in regulating abiotic stress response

Hevein-like antimicrobial peptides are a family of peptides that shares structural similarity with hevein, an AMP from the latex of rubber tree (Hevea brasiliensis) [109]. These peptides constitute a group of structurally related cysteine- and glycine-rich peptides in different plant families, including both monocots and dicots[110]. Hevein-like antimicrobial peptides have a chitin-binding domain that is involved in the binding to chitin and related oligosaccharides. The 40-aa Pn-AMP2 exhibited its antifungal proper-ties against chitin-containing and nonchitin-containing fungi [111]. A hevein-like protein PMAPI isolated from paper mulberry (Broussonetia papyrifera) displayed antifungal activity against Trichoderma viride with IC50 of 0.1 μg/μL [112]. Hevein-like plant peptides WAMP1 and WAMP2 in wheat (T. kiharae Dorof. et Migush) seeds were speculated to be involved in a defense response to biotic stress because they expressed antifungal activity, and their transcriptional patterns were highly upregulated in response to F. oxysporum infection [113]. The expression of the wamp genes was greatly induced by elevated NaCl levels (100–200 mM), suggesting the involvement of these WAMP peptides in the salinity stress response[114]. Plants protect themselves against the negative effects of fungal proteases by producing WAMPs, which inhibit fungalysin, a secreted Zn-metalloproteinase from F. verticillioides that cuts plant IV chitinases at the chitin-binding site and catalytic domains, thereby degrading plant defense proteins [115]. The WAMP2-derived peptides from the central (WAMP-G1, WAMP-G2), N- (WAMP-N) and C-terminals (WAMP-C) of the WAMP2 structure intensified the activity of commercial fungicide Folicur® EC 250 (25% tebuconazole) against five fungi including Fusarium culmorum, F. oxysporum, Bipolaris sorokininana, A. alternata, and Cladosporium cucumerinum [116]. In addition, the combination of WAMP2-derived peptides, specifically WAMP-C, and Folicur® EC 250 had a synergistic effect on the suppression of spore germination, dramatically inhibiting the germination of the fungal spores (≥ 90%) [116]. Ginkgotide gB5, an 8C-hevein-like peptide from Ginkgo biloba leaves, showed an ability to hinder the growth of A. niger, Curvularia lunata, Rhizoctonia solani, and F. oxysporum with the IC50 values of 6.8, 10, 20, and 69.2 μg/mL, respectively [117].

5.2. The use of hevein-like antimicrobial peptide genes in transgenic plant development

To confer an improved resistance to P. parasitica, cDNA of pnAMP-h2 (583 bp) from Pharbitis nil (L.) Choisy seeds was transformed into the tobacco genome [118]. WjAMP1 protein purified from wasabi (Wasabia japonica L.) leaves demonstrated suppressive activities against fungi and bacteria [119]. The expression of WjAMP1 was induced by fungal challenge with A. alternata, B. cinerea, and MeJA. Furthermore, the recombinant WjAMP1 was successfully expressed in N. benthamiana using the potato virus X vector. It inhibited the growth of various fungi in a dose-dependent fashion, including A. alternata (IC50 = 5.8 μg/mL), B. cinerea (IC50 = 15 μg/mL), F. solani (IC50 = 8.4 μg/mL), Magnaporte grisea (IC50 = 80 μg/mL). It also suppressed the growth of bacteria such as E. coli (IC50 = 27.5 μg/mL), P. cichorii (IC50 = 13.8 μg/mL), P. glumae (IC50 = 20 μg/mL), P. plantarii (IC50 = 22.5 μg/mL), and A. tumefaciens (IC50 = 12.5 μg/mL). A hevein-like AMP WAMP-1a from T. kiharae Dorof. et Migusch seed was expressed in E. coli. It exhibited antifungal activity against chitin-containing and chitin-free fungi (F. solani, F. oxysporum, Bipolaris sorokiniana) and antibacterial properties against Gram-negative (e.g., P. syringae, Erwinia carotovora) and Gram-positive bacteria (Clavibacter michiganense), and oomycete Phytophthora infestans [120]. Two genes encoding hevein-like antimicrobial peptides amp1 and amp2 were transformed into the tomato genome to obtain P. infestans-resistant plants[121]. The binary vector pB-AMP2 carrying a full length of SmAMP2 from the chickweed (Stellaria media) was used for genetic transformation of tomato. Consequently, the lesion area in the AMP2 transgenic tomato plants was much smaller than that in the non-transgenic plants (0.1 cm2 vs. 0.96 cm2). Stem wilt caused by Phoma asponaqi Sacc brings about severe disease on asparagus (Asparagus officinalis L.), resulting in dramatic economic losses. The hevein-like gene driven by the 35S promoter was introduced into the asparagus genome using A. tumefaciens EHA105 [122]. The disease index of the transgenic asparagus plants was 42 ± 2.35% while that of non-transgenic plants was 75 ± 2.78%, suggesting that the hevein-like gene conferred an enhanced resistance to stem wilt. In addition, in the transgenic asparagus, the activities of antioxidant enzymes such as SOD, CAT, and phenylalanine ammonia lyase (PAL) were positively correlated with disease resistance, while the level of malondialdehyde was negatively correlated with the disease resistance. The 56-kDa MLX56 protein from the latex of mulberry plants has an extensin domain that is flanked by two hevein domains in its N region and C region[123]. MLX56 transgenic tomato plants expressed antagonistic activity against Spodoptera litura larvae, western flower thrips Frankliniera occidentalis, and hadda beetle (Henosepilachna vigintioctopunctata), which suggest that the MLX56 gene could be used as an anti-herbivory toxin in transgenic crops, along with the traditional Bt gene.

6. Systemins

6.1. Roles of systemins in plant immunity

Systemin (SYS) is an 18-aa hormone that is processed from a 200-aa prosystemin (PS) [124]. In tomato plants, the SYS went through a long distance (40 cm) from the injection site to the top at a spread speed of 2.5 cm/h [125]. SYS from tomato triggered resistance to the necrotrophic fungus Plectosphaerella cucumerina via JA-signaling pathway [126]. When infected with P. cucumerina, the activity of JA-biosynthesis gene LOX2 was significantly induced by SYS. BAK1 and BIK1 are membrane receptors that can be used as PAMP-triggered immunity markers [127]. In the normal condition, neither BAK1 nor BIK1 was regulated by SYS. Upon P. cucumerina treatment, however, the SYS-treated plants demonstrated elevated expression levels of BAK1 and BIK1. Likewise, an increased production of H2O2 was observed in the SYS-treated plants after the treatment of flagellin 22 (flg22). This suggests that SYS is perceived by Arabidopsis in a novel mode of perception, unlike classical damage-associated molecular patterns. In the 10-day-old Arabidopsis seedlings treated with 5 𝜇M SYS, the JA-responsive gene JASMONATE ZIM-DOMAIN PROTEIN 10 (JAZ10), the pathogen-responsive gene DEFENSIN1.2 (PDF1.2), and DEFENSIN1.3 (PDF1.3) were notably induced relative to those in untreated control [128]. Additionally, Zhang et al. (2018) noticed that the expression of PDF1.2 occurred concurrently with the activation of the JA-signaling pathway and with an enhanced resistance to B. cinerea [128]. Furthermore, the overexpression of the tomato prosystemin (PS) gene in Arabidopsis conferred higher resistance to B. cinerea than that in WT plants, suggesting that the PS gene acted as a modulator of JA-responsive genes to activate plant immune response to necrotrophic fungi [128]. The exogenous supply of SYS peptide to tomato plants via foliar spraying or root uptake through hydroponic culture constrained the growth and development of Spodoptera littoralis larvae over several generations [129]. The application of non-self SYS also reduced leaf colonization caused by B. cinerea and attracted more natural enemies by a blend of volatile compounds [129]. More recently, the exogenous application of PS peptide to tomato plants has been shown to increase the mortality of S. littoralis and reduce the colonization of B. cinerea [130]. These findings indicate that PS, in addition to SYS, can protect plants from the attack of insects and fungi.
Hydroxyproline-rich systemins (HypSys) are small defense signaling glycopeptides that were first isolated in the Solanaceae family [131]. HypSys isolated from tobacco (N. tabacum) and tomato (Solanum lycopersicum) were found to induce defense genes against herbivore attack [132]. These defense-signaling glycopeptides were also found in petunia (Petunia hybrida) leaves, where they were named PhHypSys. Although PhHypSys did not induce antiherbivore protease and polyphenol oxidase activities like tobacco and tomato HypSys peptides, they instead triggered the elevated regulation of defensin I gene, which is involved in inducible defense responses against pathogens [133].

6.2. The use of systemin genes in transgenic plant development

PS, previously regarded as simply a precursor to SYS, has recently been discovered to contain biologically active regions. A truncated PS (tPS) cDNA, with the SYS sequence deleted, was transformed into tomato genome to confer resistance to insects and pathogenic fungi [130]. As a result, S. littoralis larvae that fed on tPS transgenic tomato leaf disks had impaired growth and higher mortality rates than the control group [130]. The tPS transgenic tomato plants also showed the suppressive effect on B. cinerea growth, thereby reducing necrosis areas on leaves [130]. Moreover, microarray and RT-qPCR showed that the tPS tomato had high expression levels of cell wall-related genes, as well as cytoskeletal element genes. Previously, a tPS cDNA from tomato was successfully transformed into tobacco cv. Samsun to confer an enhanced resistance to B. cinerea [134]. RT-qPCR revealed that, at 6 h after mechanical wounding, genes encoding heat shock protein (HSP), glutathione S-transferase (GST), and proteinase inhibitor (PI) II, were highly upregulated in the tPS tomato compared to the non-transgenic tomato[134]. The roles of HSP, GST, and PIs in plant protection have been widely established [135,136,137]. For example, proteinase inhibitors have largely been used to protect plants from the attack of insects [138]. GSTs play roles in detoxification of toxic substances, transport of auxins, and attenuation of oxidative stress [139]. Under biotic stress, HSP helps to accumulate and stabilize pathogenesis-related (PR) proteins [140].

7. Plant non-specific lipid transfer proteins

7.1. Antimicrobial activities and their roles in regulating abiotic stress response

Plant non-specific lipid transfer proteins (nsLTPs) play crucial roles in plant growth, development, and biotic and abiotic stress responses. nsLTPs are a member of the PR-14 family. They are small proteins (6.5–10.5 kDa) with a hydrophobic nature and a conserved motif of eight cysteines. The eight-cysteine motif is shown as C-Xn-C-Xn-CC-CXC-Xn-C-Xn-C, where "X" represents any amino acid and "n" indicates the number of amino acid residues. These amino acids are linked by four disulfide bonds to form conserved alpha helices in nsLTPs. The structure of nsLTPs renders stability, enhances capability to bind to, and transports diverse hydrophobic molecules. C-terminal calmodulin (CaM) and calmodulin-like proteins (CMLs) are ubiquitous Ca2+ sensors that bind to Ca2+ ions to regulate cellular processes and molecules involved in plant stress responses, in response to fluctuations in intracellular Ca2+ concentration, which are cell signals for plants to react appropriately to environmental stimuli [141]. nsLTPs contain a calmodulin (CaM)-binding domain and phosphorylation sites. When CaM binds to the CaM-binding domain on nsLTPs, it triggers a signal transduction cascade that regulates important processes in plants [142]. The transcription of the wheat genes TaLTPIb.1, TaLTPIb.5, and TaLTPId.1 was regulated by a variety of stress hormones, including salicylic acid (SA), methyl jasmonate (MeJA), indole-3-acetic acid (IAA), and ABA. TaLTPIb.1 and TaLTPIb.5 were induced by wound, drought, cold stress, and SA, but repressed by MeJA, IAA, and ABA, respectively. TaLTPId.1 was triggered by dark treatment, SA, and MeJA, but depressed by IAA [143]. The SiLTP gene from foxtail millet (Setaria italica) is involved in plant responses to salt and drought stress via an ABA-dependent pathway. SiLTP transcription is highly upregulated by ABA, polyethylene glycol, and NaCl. Electrophoretic mobility shift assays, and yeast one-hybrids showed that the transcription factor SiARDP binds to the dehydration-responsive element (DRE) of the SiLTP promoter to activate its transcription [144].
Sterols are essential for the growth and sporulation of oomycetes [145], and elicitins, secreted by Phytophthora spp. and Pythium spp., can deliver sterols to oomycetes by scavenging them from synthetic liposomes and plant plasma membranes. A tobacco LTP1 was found to compete with the elicitin cryptogein from P. cryptogea for a common binding site on oomycetes, and this binding mitigated ROS accumulation caused by cryptogein [146]. ScNsLTP from sugarcane was found to be highly expressed at low temperature and in PEG treatment. However, its expression did not change upon Sporisorium scitamineum infection, indicating that ScNsLTP is more sensitive to abiotic challenge [147].
Brassica rapa nectar contains BrLTP2.1, a nsLTP with direct antimicrobial activity against P. syringae pv. tomato and antifungal activity against T. viride, Bipolaris oryzae, Colletotrichum trifolii, and A. solani [148]. The low IC50 values and the high concentration of BrLTP2.1 in nectar strongly suggest that BrLTP2.1 is secreted into the nectar to protect Brassica rapa from bacteria and fungi attack [148]. ABA treatment induces the accumulation of ABA and LTP in phlo-em cells and root suberization in pea plants, and molecular modeling and fluorescence spectroscopy confirm that Ps-LTP1 can bind ABA, suggesting the involvement of plant LTPs in ABA transport in stress responses[149]. Xue et al. reported that 238 nsLTP genes in rapeseed (Brassica napus) were randomly distributed in the rapeseed genome, and their RNA-seq analysis showed that the expression of nsLTP genes were tissue-specific and were involved in response to various stresses (e.g., drought, heat, salinity, and cold), phytohormones (IAA and ABA), as well as in the phytopathogenic fungi attack (Sclerotinia sclerotiorum), white stem rot and Leptosphaeria maculans, blackleg) [150]. Among the 72 nsLTP genes that responded to white stem rot disease, 4 genes BnLTP033, BnLTP129, BnLTP161, and BnLTP264 might have a major function in resistance to this disease, meanwhile BnLTP161 and BnLTP015 may play important role in plant defense against blackleg. The inhibitory effect of nsLTPs on microbial growth remains largely unknown, however, previous studies suggested that nsLTPs might increase cell permeability, leading to the disruption of structure of the cell membrane.

7.2. The use of plant non-specific lipid transfer protein genes in transgenic plant development

Overexpression of TaLTPIb.1, TaLTPIb.5, or TaLT-PId.1 in Arabidopsis promoted longer roots and faster growth in chilling conditions, which suggests that these genes played a supportive role in improving chilling tolerance [143]. In a study by Julke and Ludwig-Muller (2016), overexpression of LTP1 and LTP3 in transgenic Arabidopsis enhanced salt stress tolerance[151]. The study also observed a reduction in clubroot susceptibility, which is caused by the obligate biotrophic protist Plasmodiophora brassicae, in LTP3 transgenic Arabidopsis plants [151]. However, this study contrasted with Gao et al.'s study, which found that overexpression of LTP3 increased susceptibility to P. syringae pv. tomato[152]. These contradictory results indicate that the defensive functions of LTPs may vary between different pathogens. The accumulation of LTPs was observed in the phloem tissue of pea (Pisum sativum L.) under salinity stress, which implies the formation of water-impermeable barrier or the transport of phloem signaling [153]. In other studies, SiLTP was found to localize in the cytoplasm [144], while TaLTP3 signal was mainly detected in the cell membrane [154]. Due to their important roles in various developmental and physiological processes, mediation, and manipulation of nsLTPs expression are promising ways to increase plant resistance to different types of stress [155]. A heat-responsive gene Lipid Transfer Protein 3 (TaLTP3) from wheat (T. aestivum L.) involved in the response to salinity, drought, ABA, and heat stress [154]. The TaLTP3 transgenic Arabidopsis plants exhibited higher heat tolerance than the control plants at the seedling stage [154]. It is evident that TaLTP3 confers heat stress tolerance via ROS scavenging mechanism, thereby reducing the accumulation of H2O2 and membrane injury caused by heat stress [156]. Similarly, the overexpression of TdLTP4, a LTP gene from durum wheat (Triticum turgidum L. subsp. Durum Desf.), maintained plant growth in salinity, H2O2, ABA, and JA treatments [157]. The enhanced resistance to oxidative stress would be explained by the accumulation of ABA that facilitated ROS scavenging in plant cells. In addition, the detached leaf assay revealed that leaves from the TdLTP4 transgenic Arabidopsis line expressed an enhanced resistance against A. solani and B. cinerea [156]. Tobacco seeds expressing SiLTP had higher germination ratios than the WT on the medium supplemented with 100 mM NaCl, 200 mM and 250 mM mannitol [144]. In addition, the SiLTP transgenic tobacco plants had longer roots and shoots than the WT plants on 100 mM NaCl or 200 mM mannitol treatment [144]. The tobacco expressing SiLTP also had greater proline and soluble sugar contents than those in the WT under drought and salinity conditions. This implies the ectopic activity of SiLTP enhanced plant tolerance to abiotic stress. In a report by Gangadhar et al. (2016), StnsLTP1 transgenic potato plants exhibited enhanced cell membrane integrity, reduced lipid peroxidation, and hydrogen peroxide, compared to non-transgenic plants under heat, drought, and salt stress conditions [158]. An increase in the accumulation of ascorbates and in the expression of defensive genes StCAT, StAPX, StSOD, StHsfA3, StsHSP20, and StHSP70 were observed in the StnsLTP1 transgenic potato plants. These results infer that the StnsLTP1 plants tolerated better to abiotic stress through the scavenging of ROS by enhanced antioxidant enzyme activities [158]. The transgenic wheat Bobwhite and RB07 lines carrying an overexpressed AtLTP4.4 gene demonstrated inhibitory effects on the growth of F. graminearum in the greenhouse and minimized fungal lesion size in leaf assays [31]. Moreover, the accumulation of deoxynivalenol (DON), a virulence factor of F. graminearum, was noticeably decreased in the AtLTP4.4 transgenic Bobwhite lines [31].
Table 1. PAMPs-based Transgenic Plants.
Table 1. PAMPs-based Transgenic Plants.
Gene Origin Transgenic
organisms
Promoter Targeting pathogens or abiotic agents Transformation method References
Thionins
𝛼-thionin Barley (Hordeum vulgare L.) Tobacco (N. tabacum L.) CAMV35S P. syringae pv. tabaci 153
P. syringae pv. syringae
Leaf-disc infection Carmona et al. (1993) [159]
β-purothionin Wheat (T. aestivum L.) A. thaliana Carbonic anhydrase (CA) promoter P. syringae strain DC3000
F. oxysporum f. sp. matthiolae
Vacuum infiltration method Oard and Enright (2006) [53]
Hordothionin Barley (H. vulgare) Apple (Malus domestica) CaMV35S P. syringae pv. tobacco
P. syringae pv. syringae
Agrobacterium tumefaciens AGL0 Krens et al. (2011) [160]
𝛼-hordothionin Barley (H. vulgare L.) Sweet potato (Ipomoea batatas (L.) Lam.) E12𝛺 Ceratocystis fimbriata A. tumefaciens Muramoto et al. (2012) [55]
Modified thionin (Mthionin) Citrus (Citrus L.) Carrizo citrange Double 35S (D35S) Candidatus Liberibacter asiaticus (Las)
Xanthomonas citri
Agrobacterium tumefaciens EHA105 Hao et al. (2016) [58]
Modified thionin (Mthionin) A. thaliana A. thaliana Double 35S (D35S) Fusarium graminearum Agrobacterium-mediated floral dip method Hao et al. (2020) [59]
Thio-60 and Thio-63 A. thaliana Paulownia tomentosa SP6 E. carotovora
Pseudomonas aeruginosa
Chitosan nanoparticles Hussien (2020) [161]
Thio-60 A. thaliana Onion (Allium cepa L.) SP6 A. niger Chitosan nanoparticles Tawfik et al. (2022) [49]
Thio-60 A. thaliana Date palm (Phoenix dactylifera L.) SP6 F. oxysporum Chitosan nanoparticles Allah et al. (2023) [61]
Defensins
OsDEF7, OsDEF8 Rice (O. sativa L.) Rosetta-gami E. coli (DE3) Tac Xanthomonas oryzae pv. oryzae
X. oryzae pv. oryzicola
E. carotovora subsp. atroseptica
Not mentioned Tantong et al. (2016) [162]
AtPDF1.1 A. thaliana Col-0 A. thaliana CAMV35S Pectobacterium carotovorum subsp. carotovorum Agrobacterium-mediated floral dip method Hsiao et al. (2017) [78]
Ca-AFP Chickpea (Cicer arietinum L.) A. thaliana CAMV35S Water-deficit stress Agrobacterium-mediated floral dip method Kumar et al. (2019) [34]
ZmDEF1 Maize (Zea mays L.) Maize (Z. mays L.) pBetaPhaso Sitophilus zeamais Motsch A. tumefaciens C58 Vi et al. (2019) [163]
PnDEFL1 Panax notoginseng A. cepa L., N. tabacum L. CaMV35S Fusarium solani
F. oxysporum
Botrosphaeria dothidea
S. sclerotiorum
A. tumefaciens EHA105 Wang et al. (2019) [164]
PtDef Populus trichocarpa Populus trichocarpa CAMV35S Septotis populiperda A. tumefaciens EHA105 Wei et al. (2019) [165]
MsDef1 Medicago sativa N. tabacum M24 P. aeruginosa
R. solanacearum
Xanthomonas campestris
A. niger
Pyricularia oryzae
R. solani
P. syringae pv tabaci
A. tumefaciens GV3850 Deb et al. (2020) [166]
CAL2 Rice (O. sativa L.) O. sativa L. var. ZH11, A. thaliana CAMV35S Cadmium detoxification Agrobacterium-mediated floral dip method Luo et al. (2020) [89]
α-TvD1 Shrub (Tephrosia villosa (L.) Pers) N. tabacum CAMV35S Phytophthora parasitica var. nicotianae
A. alternata
R. solani
Spodoptera litura
A. tumefaciens LBA4404 Sharma et al. (2020) [167]
Chitinase I, defensin Solanum tuberosum chitinase I, Vigna radiata defensin Tea (Camellia sinensis L.) CAMV35S Blister blight (Exobasidium vexans) A. tumefaciens LBA4404 Singh et al. (2020) [168]
NmDef02 Nicotiana megalosiphon Soybean (Glycine max L.) CAMV35S Phakopsora pachyrhizi
Colletotrichum truncatum
Bombardement Soto et al. (2020) [169]
pgDEF Panax ginseng A. thaliana CAMV35S F. solani A. tumefaciens AGL0 Sun et al. (2021) [170]
Tfgd2-RsAFP2 Impatiens balsamina L. Pigeonpea (Cajanus cajan (L.) Huth) CAMV35S H. armigera A. tumefaciens EHA105 Nalluri and Karri (2023) [171]
NaD1 Nicotiana alata N. tabacum cv. Xanthi tobacco CAMV35S Drought stress A. tumefaciens GV3101 Royan et al. (2023) [87]
RsAFP2 Radish (Raphanus sativus L.) Chickpea (C. arietinum) CAMV35S F. oxysporum f. sp. Cicero A. tumefaciens LBA4404 Sadhu et al. (2023) [172]
Hevein-like antimicrobial peptides
Pn-AMP1, Pn-AMP2 Pharbitis nil L. Tobacco (N. tabacum) CAMV35S Phytophthora parasitica A. tumefaciens EHA101 Koo et al. (2002) [118]
Pro-SmAmp1 Chickweed (Stellaria media) A. thaliana CAMV35S B. cinerea
B. sorokiniana
A. tumefaciens AGL0 Shukurov et al. (2010) [173]
AMP1, AMP2 Chickweed (S. media) Tomato (S. lycopersicum L.) CAMV35S Phytophthora infestance A. tumefaciens AGL0 Khaliluev et al. (2011) [121]
Pro-SmAMP1, Pro-SmAMP2 Chickweed (S. media) Tobacco (N. tabacum) cv. Samsun-NN, A. thaliana Col-0 CAMV35S B. sorokiniana
Thielaviopsis basicola
A. tumefaciens AGL0 Shukurov et al. (2012) [174]
Pro-SmAmp2 Chickweed (S. media) Potato (S. tuberosum L.) var. Yubiley Zhukova CAMV35S, pro-SmAMP2 Alternaria spp.
Fusarium spp.
A. tumefaciens AGL0 Vetchinkina et al. (2016) [175]
Hevein-like gene not mentioned Asparagus (Asparagus officinalis L.) var. Jing Kang 701 CAMV35S Phoma asponaqi Sacc A. tumefaciens EHA105 Chen et al. (2019) [176]
Pro-SmAmp1 Chickweed (S. media) Potato (S. tuberosum L.) var. Zhukovsky ranny and Udacha CAMV35S A. alternata
Alternaria solani
A. tumefaciens Beliaev et al. (2021) [177]
Cyclotides
Oak1 (kalata B1), asparaginyl endopeptidase O. affinis Nicotiana benthamiana CAMV35S In planta kalata B1 production A. tumefaciens LBA4404 Poon et al. (2018) [178]
Systemins
Pro-systemin cDNA not mentioned Tomato (S. lycopersicum L.) CAMV35S Systemic signal propagation
proteinase inhibitor accumulation
A. tumefaciens LBA4404 McGurl et al. (1994) [179]
Pro-systemin cDNA not mentioned Tomato (S. lycopersicum L.) cv. Red Setter CAMV35S Macrosiphum euphorbiae)
B. cinerea
A. alternata
Spodoptera littoralis
A. tumefaciens C5851 Coppola et al. (2015) [180]
Pro-systemin cDNA not mentioned Tomato (S. lycopersicum L.) CAMV35S Cucumber mosaic virus, Necrosis satRNA, Non-necrogenic mutant "NNmut-satRNA" A. tumefaciens LBA4404 Bubici et al. (2017) [181]
Pro-systemin cDNA Tomato A. thaliana Col-0 Shoot- or root-specific promoter, CAMV35S B. cinerea Agrobacterium-mediated floral dip method Zhang et al. (2018) [128]
Truncated pro-systemin CDNA Tomato Tomato (S. lycopersicum L.) cv. Red Setter CAMV35S Spodoptera littoralis
B. cinerea
A. tumefaciens C5851 Molisso et al. (2022) [182]
Non-specific lipid transfer protein genes
Ace-AMP1 Allium cepa Rice PAL
maize ubiquitin (UbI)
R. solani
Xanthomonas oryzae
Magnaporthe grisea
Bombardment, A. tumefaciens LBA4404 Patkar and Chattoo (2006) [183]
TaLTP3 Wheat (T. aestivum L.) cv. Chinese Spring A. thaliana CAMV35S Heat stress Agrobacterium-mediated floral dip method Wang et al. (2014) [154]
TaLTPIb.1, TaLTPIb.5, TaLTPId.1 Wheat Nicotiana benthamiana CAMV35S Cold, drought, wounding Agrobacterium-mediated transformation Yu et al. (2014) [143]
TdLTP4 Durum wheat (T. turgidum L. subsp. Durum Desf.) A. thaliana CAMV35S A. solani
B. cinerea
Agrobacterium-mediated floral dip method Safi et al. (2015) [184]
StnsLTP1 Potato (S. tuberosum L.) Potato (S. tuberosum L.) Double 35S (D35S) Heat, water deficit, salt stress Agrobacterium-mediated transformation Gangadhar et al. (2016) [158]
SiLTP Foxtail millet (Setaria italica) cv. Jigu11 A. thaliana Col-0 SiLTP endogenous promoter Salt and drought stress Agrobacterium-mediated transformation Pan et al. (2016) [144]
NtLTP4 Tobacco (N. tabacum L.) Tobacco (N. tabacum L.) CAMV35S Salt and drought stress A. tumefaciens-mediated leaf disc Xu et al. (2018) [185]
GmLtpI.3 Soybean cv. Zhonghuang 39 Soybean cv. Williams 82, Arabidopsis CAMV35S Salt and drought stress Agrobacterium-mediated transformation Zhang et al. (2022) [186]
NtLTPI.38 Tobacco (N. tabacum) Tobacco (N. tabacum) cv. K326 Not mentioned Heat stress Agrobacterium-mediated transformation Song et al. (2023) [187]
AT14A A. thaliana Col-0 Tomato (S. lycopersicum L.) cv. Yaxin 87-5 CAMV35S Drought stress Agrobacterium-mediated transformation Xin et al. (2023) [188]

8. Conclusion

From the agricultural standpoint, most studies on PAMPs have focused on their antifungal and antibacterial potentials. Previous studies have also indicated that PAMPs might play crucial roles in regulating plant responses to abiotic stress. However, there is a significant need for a large volume of evidence to elucidate mechanisms underlying the involvement of PAMPs in abiotic stress response. This evidence should encompass molecular features, signaling pathways, interactions between PAMPs signaling and other phytohormones, as well as greenhouse and in-field tests to assess the effects of PAMPs. Thus far, published studies and known properties of PAMPs bode well for developing biocontrol substances through direct spray or transgenic approach. Nevertherless, the utilization of PAMPs-based elicitors to induce plant tolerance to abiotic stress demands additional efforts. Bridging this gap of knowledge is imperative to provide insights into the mechanisms of induced abiotic stress tolerance in crop plants using these elicitors, thereby bolstering our crop productivity amidst rising environmental challenges. Furthermore, the release of bioactive compounds to the environment from genetically modified crops has raised concern for both human health and the environment. The well-established stability of PAMPs suggests that these peptides could be highly persistent in soil and water. Consequently, a comprehensive assessment of the fate of PAMPs in soil and water, their interaction with other soil components, and their degradation is essential.

Author Contributions

Conceptualization, T.T.M.N, D.M.H.-T and C-CH; Writing-Original draft: T.T.M.N, D.M.H.-T, BVT, S-HWH, and C-CH; Supervision: C-CH. All authors have read and agreed to the published version of the manuscript.

Funding

This work received no external funding.

Data Availability Statement

Not applicable.

Acknowledgments

We would like to express our gratitude to Dr. Tan Phong Nguyen, Faculty of Environment and Labour Safety, Ton Duc Thang University, Vietnam, and Dr. Nhuan Nghiem, Department of Environmental Engineering and Earth Sciences, Clemson University, Clemson, South Carolina, USA for helping us find the latest papers used in this work.

Conflicts of Interest

The authors declare no conflict of interest.

Abbreviation

ABA, abscisic acid; A. alternata, Alternaria alternata; APX, Ascorbate peroxidase; A. thaliana, Arabidopsis thaliana; B. cinerea, Botrytis cinerea; CAT, catalase; E. carotovora, Erwinia carotovora; F. oxysporum, Fusarium oxysporum; HypSys, Hydroxyproline-rich systemins; JA, Jasmonic acid; MIC, Minimum inhibitory concentration; N. tabacum, Nicotiana tabacum; O. sativa, Oryza sativa; PAL, Phenylalanine ammonia lyase; PAMPs: plant-derived antimicrobial peptides; P. infestans, Phytophthora infestans; PR, Pathogenesis-related; P. syringae, Pseudomonas syringae; R. solanacearum, Ralstonia solanacearum; R. solani, Rhizoctonia solani; S. aureus, Staphylococcus aureus; S. lycopersicum, Solanum lycopersicum; S. tuberosum, Solanum tuberosum; SOD, Superoxide dismutase; S. sclerotiorum, Sclerotinia sclerotiorum; T. aestivum, Triticum aestivum; T. turgidum, Triticum turgidum.

References

  1. Timmusk, S.; Behers, L.; Muthoni, J.; Muraya, A.; Aronsson, A.C. Perspectives and Challenges of Microbial Application for Crop Improvement. Front Plant Sci 2017, 8. [Google Scholar] [CrossRef]
  2. Brooks, J.; Deconinck, K.; Giner, C. Three Key Challenges Facing Agriculture and How to Start Solving Them 2019.
  3. Gagic, V.; Holding, M.; Venables, W.N.; Hulthen, A.D.; Schellhorn, N.A. Better Outcomes for Pest Pressure, Insecticide Use, and Yield in Less Intensive Agricultural Landscapes. Proceedings of the National Academy of Sciences 2021, 118, e2018100118. [Google Scholar] [CrossRef]
  4. Sasakova, N.; Gregova, G.; Takacova, D.; Mojzisova, J.; Papajova, I.; Venglovsky, J.; Szaboova, T.; Kovacova, S. Pollution of Surface and Ground Water by Sources Related to Agricultural Activities. Front Sustain Food Syst 2018, 2, 42. [Google Scholar] [CrossRef]
  5. Syafiuddin, A.; Boopathy, R.; Hadibarata, T. Challenges and Solutions for Sustainable Groundwater Usage: Pollution Control and Integrated Management. Curr Pollut Rep 2020, 6, 310–327. [Google Scholar] [CrossRef]
  6. FAO Water for Sustainable Food and Agriculture. FAODocuments 2017.
  7. Orimoloye, I.R. Agricultural Drought and Its Potential Impacts: Enabling Decision-Support for Food Security in Vulnerable Regions. Front Sustain Food Syst 2022, 6. [Google Scholar] [CrossRef]
  8. Kumar, P.; Sharma, P.K. Soil Salinity and Food Security in India. Front Sustain Food Syst 2020, 4. [Google Scholar] [CrossRef]
  9. Parida, A.K.; Das, A.B. Salt Tolerance and Salinity Effects on Plants: A Review. Ecotoxicol Environ Saf 2005, 60, 324–349. [Google Scholar] [CrossRef]
  10. Hassani, A.; Azapagic, A.; Shokri, N. Global Predictions of Primary Soil Salinization under Changing Climate in the 21st Century. Nat Commun 2021, 12, 6663. [Google Scholar] [CrossRef]
  11. Salehi-Lisar, S.; Bakhshayeshan-Agdam, H. Chapter 1: Drought Stress in Plants: Causes, Consequences, and Tolerance. In Drought Stress Tolerance in Plants, Vol 1 Physiology and Biochemistry; Hossain, M.A., Wani, S.H., Bhattacharjee, S., Burritt, D.J., Tran Phan, L.-S., Eds.; Springer, 2016; pp. 1–16 ISBN ISBN 978-3-319-28899-4.
  12. Sarkozi, A. New Standards to Curb the Global Spread of Plant Pests and Diseases. FAO CN - (+39) 06 570 52537 2020.
  13. Cycoń, M.; Mrozik, A.; Piotrowska-Seget, Z. Antibiotics in the Soil Environment—Degradation and Their Impact on Microbial Activity and Diversity. Front Microbiol 2019, 10. [Google Scholar] [CrossRef]
  14. Kulik, K.; Lenart-Boroń, A.; Wyrzykowska, K. Impact of Antibiotic Pollution on the Bacterial Population within Surface Water with Special Focus on Mountain Rivers. Water (Basel) 2023, 15, 975. [Google Scholar] [CrossRef]
  15. Aktar, W.; Sengupta, D.; Chowdhury, A. Impact of Pesticides Use in Agriculture: Their Benefits and Hazards. Interdiscip Toxicol 2009, 2, 1–12. [Google Scholar] [CrossRef]
  16. Onwona-Kwakye, M.; Plants-Paris, K.; Keita, K.; Lee, J.; Van den Brink, P.J.; Hogarh, J.N.; Darkoh, C. Pesticides Decrease Bacterial Diversity and Abundance of Irrigated Rice Fields. Microorganisms 2020, 8, 318. [Google Scholar] [CrossRef]
  17. Campos, M.L.; Liao, L.M.; Alves, E.S.; Migliolo, L.; Dias, S.C.; Franco, O.L. A Structural Perspective of Plant Antimicrobial Peptides. Biochemical Journal 2018, 475. [Google Scholar] [CrossRef]
  18. Bakare, O.O.; Gokul, A.; Fadaka, A.O.; Wu, R.; Niekerk, L.-A.; Barker, A.M.; Keyster, M.; Klein, A. Plant Antimicrobial Peptides (PAMPs): Features, Applications, Production, Expression, and Challenges. Molecules 2022, 27, 3703. [Google Scholar] [CrossRef]
  19. Simonsen, S.M.; Sando, L.; Ireland, D.C.; Colgrave, M.L.; Bharathi, R.; Göransson, U.; Craik, D.J. A Continent of Plant Defense Peptide Diversity: Cyclotides in Australian Hybanthus (Violaceae). Plant Cell 2005, 17, 3176–3189. [Google Scholar] [CrossRef]
  20. Hill, J.; Becker, H.C.; Tigerstedt, P.M.A. Breeding for Biotic and Abiotic Stress. In Quantitative and Ecological Aspects of Plant Breeding; Springer Netherlands: Dordrecht, 1998; pp. 212–234.
  21. Pandolfi, C.; Azzarello, E.; Mancuso, S.; Shabala, S. Acclimation Improves Salt Stress Tolerance in Zea Mays Plants. J Plant Physiol 2016, 201, 1–8. [Google Scholar] [CrossRef]
  22. Corbineau, F.; Taskiran-Özbingöl, N.; El-Maarouf-Bouteau, H. Improvement of Seed Quality by Priming: Concept and Biological Basis. Seeds 2023, 2, 101–115. [Google Scholar] [CrossRef]
  23. Aizaz, M.; Ahmad, W.; Asaf, S.; Khan, I.; Saad Jan, S.; Salim Alamri, S.; Bilal, S.; Jan, R.; Kim, K.-M.; Al-Harrasi, A. Characterization of the Seed Biopriming, Plant Growth-Promoting and Salinity-Ameliorating Potential of Halophilic Fungi Isolated from Hypersaline Habitats. Int J Mol Sci 2023, 24, 4904. [Google Scholar] [CrossRef]
  24. Vaishnav, A.; Shukla, A.K.; Sharma, A.; Kumar, R.; Choudhary, D.K. Endophytic Bacteria in Plant Salt Stress Tolerance: Current and Future Prospects. J Plant Growth Regul 2019, 38, 650–668. [Google Scholar] [CrossRef]
  25. da Silva Rodrigues-Corrêa, K.C.; Fett-Neto, A.G. Abiotic Stresses and Non-Protein Amino Acids in Plants. CRC Crit Rev Plant Sci 2019, 38, 411–430. [Google Scholar] [CrossRef]
  26. Maximiano, M.R.; Rios, T.B.; Campos, M.L.; Prado, G.S.; Dias, S.C.; Franco, O.L. Nanoparticles in Association with Antimicrobial Peptides (NanoAMPs) as a Promising Combination for Agriculture Development. Front Mol Biosci 2022, 9. [Google Scholar] [CrossRef]
  27. Kulaeva, O.; Kliukova, M.; Afonin, A.; Sulima, A.; Zhukov, V.; Tikhonovich, I. The Role of Plant Antimicrobial Peptides (AMPs) in Response to Biotic and Abiotic Environmental Factors. Biological Communications 2020, 65, 187–199. [Google Scholar] [CrossRef]
  28. Mulla, J.A.; Tamhane, V.A. Novel Insights into Plant Defensin Ingestion Induced Metabolic Responses in the Polyphagous Insect Pest Helicoverpa Armigera. Sci Rep 2023, 13, 3151. [Google Scholar] [CrossRef]
  29. Huang, C.-Y.; Araujo, K.; Sánchez, J.N.; Kund, G.; Trumble, J.; Roper, C.; Godfrey, K.E.; Jin, H. A Stable Antimicrobial Peptide with Dual Functions of Treating and Preventing Citrus Huanglongbing. Proceedings of the National Academy of Sciences 2021, 118. [Google Scholar] [CrossRef]
  30. Leannec-Rialland, V.; Atanasova, V.; Chereau, S.; Tonk-Rügen, M.; Cabezas-Cruz, A.; Richard-Forget, F. Use of Defensins to Develop Eco-Friendly Alternatives to Synthetic Fungicides to Control Phytopathogenic Fungi and Their Mycotoxins. Journal of Fungi 2022, 8, 229. [Google Scholar] [CrossRef]
  31. McLaughlin, J.E.; Darwish, N.I.; Garcia-Sanchez, J.; Tyagi, N.; Trick, H.N.; McCormick, S.; Dill-Macky, R.; Tumer, N.E. A Lipid Transfer Protein Has Antifungal and Antioxidant Activity and Suppresses Fusarium Head Blight Disease and DON Accumulation in Transgenic Wheat. Phytopathology 2021, 111, 671–683. [Google Scholar] [CrossRef]
  32. Nawrot, R.; Barylski, J.; Nowicki, G.; Broniarczyk, J.; Buchwald, W.; Goździcka-Józefiak, A. Plant Antimicrobial Peptides. Folia Microbiol (Praha) 2014, 59, 181–196. [Google Scholar] [CrossRef]
  33. Li, J.; Hu, S.; Jian, W.; Xie, C.; Yang, X. Plant Antimicrobial Peptides: Structures, Functions, and Applications. Bot Stud 2021, 62. [Google Scholar] [CrossRef]
  34. Kumar, M.; Yusuf, M.A.; Yadav, P.; Narayan, S.; Kumar, M. Overexpression of Chickpea Defensin Gene Confers Tolerance to Water-Deficit Stress in Arabidopsis Thaliana. Front Plant Sci 2019, 10. [Google Scholar] [CrossRef]
  35. Mirakhorli, N.; Norolah, Z.; Foruzandeh, S.; Shafizade, F.; Nikookhah, F.; Saffar, B.; Ansari, O. Multi-Function Plant Defensin, Antimicrobial and Heavy Metal Adsorbent Peptide. Iran J Biotechnol 2019, 17, 43–49. [Google Scholar] [CrossRef]
  36. Rawat, S.; Ali, S.; Nayankantha, N.N.C.; Chandrashekar, N.; Mittra, B.; Grover, A. Isolation and Expression Analysis of Defensin Gene and Its Promoter from Brassica Juncea. Journal of Plant Diseases and Protection 2017, 124, 591–600. [Google Scholar] [CrossRef]
  37. Su, Q.; Wang, K.; Zhang, Z. Ecotopic Expression of the Antimicrobial Peptide DmAMP1W Improves Resistance of Transgenic Wheat to Two Diseases: Sharp Eyespot and Common Root Rot. Int J Mol Sci 2020, 21, 647. [Google Scholar] [CrossRef]
  38. Odintsova, T.I.; Slezina, M.P.; Istomina, E.A. Plant Thionins: Structure, Biological Functions and Potential Use in Biotechnology. Vavilov Journal of Genetics and Breeding 2018, 22, 667–675. [Google Scholar] [CrossRef]
  39. Ji, H.; Gheysen, G.; Ullah, C.; Verbeek, R.; Shang, C.; De Vleesschauwer, D.; Höfte, M.; Kyndt, T. The Role of Thionins in Rice Defence against Root Pathogens. Mol Plant Pathol 2015, 16, 870–881. [Google Scholar] [CrossRef]
  40. Stec, B.; Markman, O.; Rao, U.; Heffron, G.; Henderson, S.; Vernon, L.P.; Brumfeld, V.; Teeter, M.M. Proposal for Molecular Mechanism of Thionins Deduced from Physico-chemical Studies of Plant Toxins. The Journal of Peptide Research 2004, 64, 210–224. [Google Scholar] [CrossRef]
  41. Oard, S. V. Deciphering a Mechanism of Membrane Permeabilization by α-Hordothionin Peptide. Biochimica et Biophysica Acta (BBA) - Biomembranes 2011, 1808, 1737–1745. [Google Scholar] [CrossRef]
  42. Loeza-Ángeles, H.; Sagrero-Cisneros, E.; Lara-Zárate, L.; Villagómez-Gómez, E.; López-Meza, J.E.; Ochoa-Zarzosa, A. Thionin Thi2.1 from Arabidopsis Thaliana Expressed in Endothelial Cells Shows Antibacterial, Antifungal and Cytotoxic Activity. Biotechnol Lett 2008, 30, 1713–1719. [Google Scholar] [CrossRef]
  43. Taveira, G.B.; Carvalho, A.O.; Rodrigues, R.; Trindade, F.G.; Da Cunha, M.; Gomes, V.M. Thionin-like Peptide from Capsicum Annuum Fruits: Mechanism of Action and Synergism with Fluconazole against Candida Species. BMC Microbiol 2016, 16, 12. [Google Scholar] [CrossRef]
  44. Asano, T.; Miwa, A.; Maeda, K.; Kimura, M.; Nishiuchi, T. The Secreted Antifungal Protein Thionin 2.4 in Arabidopsis Thaliana Suppresses the Toxicity of a Fungal Fruit Body Lectin from Fusarium Graminearum. PLoS Pathog 2013, 9, e1003581. [Google Scholar] [CrossRef]
  45. Mehrabi, S.; Åhman, I.; Jonsson, L.M. V. Transcript Abundance of Resistance- and Susceptibility-Related Genes in a Barley Breeding Pedigree with Partial Resistance to the Bird Cherry-Oat Aphid (Rhopalosiphum Padi L.). Euphytica 2014, 198, 211–222. [Google Scholar] [CrossRef]
  46. Petitot, A.-S.; Kyndt, T.; Haidar, R.; Dereeper, A.; Collin, M.; de Almeida Engler, J.; Gheysen, G.; Fernandez, D. Transcriptomic and Histological Responses of African Rice (Oryza Glaberrima) to Meloidogyne Graminicola Provide New Insights into Root-Knot Nematode Resistance in Monocots. Ann Bot 2017, 119, 885–899. [Google Scholar] [CrossRef]
  47. Leybourne, D.J.; Valentine, T.A.; Binnie, K.; Taylor, A.; Karley, A.J.; Bos, J.I.B. Drought Stress Increases the Expression of Barley Defence Genes with Negative Consequences for Infesting Cereal Aphids. J Exp Bot 2022, 73, 2238–2250. [Google Scholar] [CrossRef]
  48. Sewelam, N.; El-Shetehy, M.; Mauch, F.; Maurino, V.G. Combined Abiotic Stresses Repress Defense and Cell Wall Metabolic Genes and Render Plants More Susceptible to Pathogen Infection. Plants 2021, 10, 1946. [Google Scholar] [CrossRef]
  49. Tawfik, E.; Hammad, I.; Bakry, A. Production of Transgenic Allium Cepa by Nanoparticles to Resist Aspergillus Niger Infection. Mol Biol Rep 2022, 49, 1783–1790. [Google Scholar] [CrossRef]
  50. Künstler, A.; Gullner, G.; Ádám, A.L.; Kolozsváriné Nagy, J.K.; Király, L. The Versatile Roles of Sulfur-Containing Biomolecules in Plant Defense—A Road to Disease Resistance. Plants 2020, 9, 1705. [Google Scholar] [CrossRef]
  51. Epple, P.; Apel, K.; Bohlmann, H. Overexpression of an Endogenous Thionin Enhances Resistance of Arabidopsis against Fusarium Oxysporum. Plant Cell 1997, 9, 509–520. [Google Scholar] [CrossRef]
  52. Chan, Y.-L.Y.-L.; Prasad, V.; Sanjaya; Chen, K.H.; Liu, P.C.; Chan, M.-T.M.-T.; Cheng, C.-P.C.-P. Transgenic Tomato Plants Expressing an Arabidopsis Thionin (Thi2.1) Driven by Fruit-Inactive Promoter Battle against Phytopathogenic Attack. Planta 2005, 221, 386–393. [CrossRef]
  53. Oard, S. V.; Enright, F.M. Expression of the Antimicrobial Peptides in Plants to Control Phytopathogenic Bacteria and Fungi. Plant Cell Rep 2006, 25, 561–572. [Google Scholar] [CrossRef]
  54. Zhang, M.; Liu, M.; Pan, S.; Pan, C.; Li, Y.; Tian, J. Perillaldehyde Controls Postharvest Black Rot Caused by Ceratocystis Fimbriata in Sweet Potatoes. Front Microbiol 2018, 9. [Google Scholar] [CrossRef]
  55. Muramoto, N.; Tanaka, T.; Shimamura, T.; Mitsukawa, N.; Hori, E.; Koda, K.; Otani, M.; Hirai, M.; Nakamura, K.; Imaeda, T. Transgenic Sweet Potato Expressing Thionin from Barley Gives Resistance to Black Rot Disease Caused by Ceratocystis Fimbriata in Leaves and Storage Roots. Plant Cell Rep 2012, 31, 987–997. [Google Scholar] [CrossRef]
  56. Hao, G.; Zhang, S.; Stover, E. Transgenic Expression of Antimicrobial Peptide D2A21 Confers Resistance to Diseases Incited by Pseudomonas Syringae Pv. Tabaci and Xanthomonas Citri, but Not Candidatus Liberibacter Asiaticus. PLoS One 2017, 12, e0186810. [Google Scholar] [CrossRef]
  57. Zou, X.; Jiang, X.; Xu, L.; Lei, T.; Peng, A.; He, Y.; Yao, L.; Chen, S. Transgenic Citrus Expressing Synthesized Cecropin B Genes in the Phloem Exhibits Decreased Susceptibility to Huanglongbing. Plant Mol Biol 2017, 93, 341–353. [Google Scholar] [CrossRef]
  58. Hao, G.; Stover, E.; Gupta, G. Overexpression of a Modified Plant Thionin Enhances Disease Resistance to Citrus Canker and Huanglongbing (HLB). Front Plant Sci 2016, 7. [Google Scholar] [CrossRef]
  59. Hao, G.; Bakker, M.G.; Kim, H.-S. Enhanced Resistance to Fusarium Graminearum in Transgenic Arabidopsis Plants Expressing a Modified Plant Thionin. Phytopathology 2020, 110, 1056–1066. [Google Scholar] [CrossRef]
  60. Escudero-Martinez, C.M.; Morris, J.A.; Hedley, P.E.; Bos, J.I.B. Barley Transcriptome Analyses upon Interaction with Different Aphid Species Identify Thionins Contributing to Resistance. Plant Cell Environ 2017, 40, 2628–2643. [Google Scholar] [CrossRef]
  61. Allah, K.W.A.; Alabasey, E.E.D.G.H.; Ahmed, K.Z.; Hussien, E.T.; Razik, A.B.A. Phoenix Dactylifera in Vitro Culture and Transformation of Thio-60 Antifungal Gene via Chitosan Nanoparticle. Plant Cell, Tissue and Organ Culture (PCTOC). [CrossRef]
  62. Liu, X.; Gong, X.; Zhou, D.; Jiang, Q.; Liang, Y.; Ye, R.; Zhang, S.; Wang, Y.; Tang, X.; Li, F.; et al. Plant Defensin-Dissimilar Thionin OsThi9 Alleviates Cadmium Toxicity in Rice Plants and Reduces Cadmium Accumulation in Rice Grains. J Agric Food Chem 2023, 71, 8367–8380. [Google Scholar] [CrossRef]
  63. Azmi, S.; Hussain, M.K. Analysis of Structures, Functions, and Transgenicity of Phytopeptides Defensin and Thionin: A Review. Beni Suef Univ J Basic Appl Sci 2021, 10, 5. [Google Scholar] [CrossRef]
  64. Kovaleva, V.; Bukhteeva, I.; Kit, O.Y.; Nesmelova, I. V Plant Defensins from a Structural Perspective. Int J Mol Sci 2020, 21, 5307. [Google Scholar] [CrossRef]
  65. Parisi, K.; Shafee, T.M.A.; Quimbar, P.; van der Weerden, N.L.; Bleackley, M.R.; Anderson, M.A. The Evolution, Function and Mechanisms of Action for Plant Defensins. Semin Cell Dev Biol 2019, 88, 107–118. [Google Scholar] [CrossRef]
  66. Shalovylo, Y.I.; Yusypovych, Y.M.; Hrunyk, N.I.; Roman, I.I.; Zaika, V.K.; Krynytskyy, H.T.; Nesmelova, I. V.; Kovaleva, V.A. Seed-Derived Defensins from Scots Pine: Structural and Functional Features. Planta 2021, 254, 129. [Google Scholar] [CrossRef]
  67. Chen, L.; Zhang, L.; Xiang, S.; Chen, Y.; Zhang, H.; Yu, D. The Transcription Factor WRKY75 Positively Regulates Jasmonate-Mediated Plant Defense to Necrotrophic Fungal Pathogens. J Exp Bot 2021, 72, 1473–1489. [Google Scholar] [CrossRef]
  68. Slezina, M.P.; Istomina, E.A.; Kulakovskaya, E. V; Korostyleva, T. V; Odintsova, T.I. The γ-Core Motif Peptides of AMPs from Grasses Display Inhibitory Activity against Human and Plant Pathogens. Int J Mol Sci 2022, 23, 8383. [Google Scholar] [CrossRef]
  69. Slezina, M.P.; Istomina, E.A.; Korostyleva, T. V; Odintsova, T.I. The γ-Core Motif Peptides of Plant AMPs as Novel Antimicrobials for Medicine and Agriculture. Int J Mol Sci 2023, 24, 483. [Google Scholar] [CrossRef]
  70. Contreras, G.; Shirdel, I.; Braun, M.S.; Wink, M. Defensins: Transcriptional Regulation and Function beyond Antimicrobial Activity. Dev Comp Immunol 2020, 104. [Google Scholar] [CrossRef]
  71. Mee Do, H.; Chul Lee, S.; Won Jung, H.; Hoon Sohn, K.; Kook Hwang, B. Differential Expression and in Situ Localization of a Pepper Defensin (CADEF1) Gene in Response to Pathogen Infection, Abiotic Elicitors and Environmental Stresses in Capsicum Annuum. Plant Science 2004, 166, 1297–1305. [Google Scholar] [CrossRef]
  72. Weerawanich, K.; Webster, G.; Ma, J.K.-C.; Phoolcharoen, W.; Sirikantaramas, S. Gene Expression Analysis, Subcellular Localization, and in Planta Antimicrobial Activity of Rice (Oryza Sativa L.) Defensin 7 and 8. Plant Physiology and Biochemistry 2018, 124, 160–166. [Google Scholar] [CrossRef]
  73. Tesfaye, M.; Silverstein, K.AT.; Nallu, S.; Wang, L.; Botanga, C.J.; Gomez, S.K.; Costa, L.M.; Harrison, M.J.; Samac, D.A.; Glazebrook, J.; et al. Spatio-Temporal Expression Patterns of Arabidopsis Thaliana and Medicago Truncatula Defensin-Like Genes. PLoS One 2013, 8, e58992. [Google Scholar] [CrossRef]
  74. Franco, O.L.; Murad, A.M.; Leite, J.R.; Mendes, P.A.M.; Prates, M. V; Bloch Jr., C. Identification of a Cowpea γ-Thionin with Bactericidal Activity. FEBS J 2006, 273, 3489–3497. [Google Scholar] [CrossRef]
  75. Fernández, A.; Colombo, M.L.; Curto, L.M.; Gómez, G.E.; Delfino, J.M.; Guzmán, F.; Bakás, L.; Malbrán, I.; Vairo-Cavalli, S.E. Peptides Derived From the α-Core and γ-Core Regions of a Putative Silybum Marianum Flower Defensin Show Antifungal Activity Against Fusarium Graminearum. Front Microbiol 2021, 12. [Google Scholar] [CrossRef]
  76. Sagaram, U.S.; Pandurangi, R.; Kaur, J.; Smith, T.J.; Shah, D.M. Structure-Activity Determinants in Antifungal Plant Defensins MsDef1 and MtDef4 with Different Modes of Action against Fusarium Graminearum. PLoS One 2011, 6, e18550. [Google Scholar] [CrossRef]
  77. Mirouze, M.; Sels, J.; Richard, O.; Czernic, P.; Loubet, S.; Jacquier, A.; François, I.E.J.A.; Cammue, B.P.A.; Lebrun, M.; Berthomieu, P.; et al. A Putative Novel Role for Plant Defensins: A Defensin from the Zinc Hyper-accumulating Plant, Arabidopsis Halleri, Confers Zinc Tolerance. The Plant Journal 2006, 47, 329–342. [Google Scholar] [CrossRef]
  78. Hsiao, P.-Y.; Cheng, C.-P.; Koh, K.W.; Chan, M.-T. The Arabidopsis Defensin Gene, AtPDF1.1, Mediates Defence against Pectobacterium Carotovorum Subsp. Carotovorum via an Iron-Withholding Defence System. Sci Rep 2017, 7, 9175. [Google Scholar] [CrossRef]
  79. Nitnavare, R.B.; Pothana, A.; Yeshvekar, R.K.; Bhattacharya, J.; Sapara, V.; Reddy, P.S.; Ramtirtha, Y.; Tarafdar, A.; Sharma, M.; Bhatnagar-Mathur, P. Chickpea Defensin Gene Family: Promising Candidates for Resistance Against Soil-Borne Chickpea Fungal Pathogens. J Plant Growth Regul 2023, 42, 6244–6260. [Google Scholar] [CrossRef]
  80. Bondt, A.; Zaman, S.; Broekaert, W.; Cammue, B.; Keulemans, J. GENETIC TRANSFORMATION OF APPLE (MALUS PUMILA MILL.) FOR INCREASED FUNGAL RESISTANCE: IN VITRO ANTIFUNGAL ACTIVITY IN PROTEIN EXTRACTS OF TRANSGENIC APPLE EXPRESSING RS-AFP2 OR ACE-AMP1. Acta Hortic. [CrossRef]
  81. Wang, Y.; Nowak, G.; Culley, D.; Hadwiger, L.A.; Fristensky, B. Constitutive Expression of Pea Defense Gene DRR206 Confers Resistance to Blackleg (Leptosphaeria Maculans) Disease in Transgenic Canola (Brassica Napus). Molecular Plant-Microbe Interactions® 1999, 12, 410–418. [Google Scholar] [CrossRef]
  82. Lebedev, V.G.; Dolgov, S.V.; Lavrova, N.; Lunin, V.G.; Naroditski, B.S. PLANT-DEFENSIN GENES INTRODUCTION FOR IMPROVEMENT OF PEAR PHYTOPATHOGEN RESISTANCE. Acta Hortic 2002, 167–172. [Google Scholar] [CrossRef]
  83. Cary, J.W.; Rajasekaran, K.; Jaynes, J.M.; Cleveland, T.E. Transgenic Expression of a Gene Encoding a Synthetic Antimicrobial Peptide Results in Inhibition of Fungal Growth in Vitro and in Planta. Plant Science 2000, 154, 171–181. [Google Scholar] [CrossRef]
  84. Park, H.C.; Hwan Kang, Y.; Jin Chun, H.; Choon Koo, J.; Hwa Cheong, Y.; Young Kim, C.; Chul Kim, M.; Sik Chung, W.; Cheol Kim, J.; Hyuk Yoo, J.; et al. Characterization of a Stamen-Specific CDNA Encoding a Novel Plant Defensin in Chinese Cabbage. Plant Mol Biol 2002, 50, 57–68. [Google Scholar] [CrossRef]
  85. Swathi Anuradha, T.; Divya, K.; Jami, S.K.; Kirti, P.B. Transgenic Tobacco and Peanut Plants Expressing a Mustard Defensin Show Resistance to Fungal Pathogens. Plant Cell Rep 2008, 27, 1777–1786. [Google Scholar] [CrossRef]
  86. Abdallah, N.A.; Shah, D.; Abbas, D.; Madkour, M. Stable Integration and Expression of a Plant Defensin in Tomato Confers Resistance to Fusarium Wilt. GM Crops 2010, 1, 344–350. [Google Scholar] [CrossRef]
  87. Royan, S.; Shirzadian-Khorramabad, R.; Zibaee, A.; Bagherieh-Najjar, M.B.; Firouzabadi, F.N. Tobacco Plants Expressing the Defensin NaD1 Enhance Drought Tolerance Characteristics in Transgenic Lines. Plant Growth Regul 2023, 101, 503–518. [Google Scholar] [CrossRef]
  88. Luo, J.-S.; Gu, T.; Yang, Y.; Zhang, Z. A Non-Secreted Plant Defensin AtPDF2.6 Conferred Cadmium Tolerance via Its Chelation in Arabidopsis. Plant Mol Biol 2019, 100, 561–569. [Google Scholar] [CrossRef]
  89. Luo, J.-S.; Xiao, Y.; Yao, J.; Wu, Z.; Yang, Y.; Ismail, A.M.; Zhang, Z. Overexpression of a Defensin-Like Gene CAL2 Enhances Cadmium Accumulation in Plants. Front Plant Sci 2020, 11. [Google Scholar] [CrossRef]
  90. Slazak, B.; Haugmo, T.; Badyra, B.; Goransson, U. The Life Cycle of Cyclotides: Biosynthesis and Turnover in Plant Cells. Plant Cell Rep 2020, 39, 1359–1367. [Google Scholar] [CrossRef]
  91. Zhang, J.; Li, J.; Huang, Z.; Yang, B.; Zhang, X.; Li, D.; Craik, D.J.; Baker, A.J.M.; Shu, W.; Liao, B. Transcriptomic Screening for Cyclotides and Other Cysteine-Rich Proteins in the Metallophyte Viola Baoshanensis. J Plant Physiol 2015, 178, 17–26. [Google Scholar] [CrossRef]
  92. de Veer, S.J.; Kan, M.-W.; Craik, D.J. Cyclotides: From Structure to Function. Chem Rev 2019, 119, 12375–12421. [Google Scholar] [CrossRef]
  93. Saether, O.; Craik, D.J.; Campbell, I.D.; Sletten, K.; Juul, J.; Norman, D.G. Elucidation of the Primary and Three-Dimensional Structure of the Uterotonic Polypeptide Kalata B1. Biochemistry 1995, 34, 4147–4158. [Google Scholar] [CrossRef]
  94. Gran, L.; Sandberg, F.; Sletten, K. Oldenlandia Affinis (R&S) DC: A Plant Containing Uteroactive Peptides Used in African Traditional Medicine. J Ethnopharmacol 2000, 70, 197–203. [Google Scholar] [CrossRef]
  95. Jennings, C.; West, J.; Waine, C.; Craik, D.; Anderson, M. Biosynthesis and Insecticidal Properties of Plant Cyclotides: The Cyclic Knotted Proteins from Oldenlandia Affinis. Proceedings of the National Academy of Sciences 2001, 98, 10614–10619. [Google Scholar] [CrossRef]
  96. Jennings, C. V.; Rosengren, K.J.; Daly, N.L.; Plan, M.; Stevens, J.; Scanlon, M.J.; Waine, C.; Norman, D.G.; Anderson, M.A.; Craik, D.J. Isolation, Solution Structure, and Insecticidal Activity of Kalata B2, a Circular Protein with a Twist: Do Möbius Strips Exist in Nature?, Biochemistry 2005, 44, 851–860. [Google Scholar] [CrossRef]
  97. Barbeta, B.L.; Marshall, A.T.; Gillon, A.D.; Craik, D.J.; Anderson, M.A. Plant Cyclotides Disrupt Epithelial Cells in the Midgut of Lepidopteran Larvae. Proceedings of the National Academy of Sciences 2008, 105, 1221–1225. [Google Scholar] [CrossRef]
  98. English, L.; Slatin, S.L. Mode of Action of Delta-Endotoxins from Bacillus Thuringiensis: A Comparison with Other Bacterial Toxins. Insect Biochem Mol Biol 1992, 22, 1–7. [Google Scholar] [CrossRef]
  99. Tan, Y.; Khoo, S.Q.; Tan, S. Acute Metaldehyde Poisoning from Ingestion: Clinical Features and Implications for Early Treatment. Acute Medicine & Surgery 2022, 9, e766. [Google Scholar] [CrossRef]
  100. Plan, M.R.R.; Saska, I.; Cagauan, A.G.; Craik, D.J. Backbone Cyclised Peptides from Plants Show Molluscicidal Activity against the Rice Pest Pomacea Canaliculata (Golden Apple Snail). J Agric Food Chem 2008, 56, 5237–5241. [Google Scholar] [CrossRef]
  101. Oguis, G.K.; Gilding, E.K.; Jackson, M.A.; Craik, D.J. Butterfly Pea (Clitoria Ternatea), a Cyclotide-Bearing Plant With Applications in Agriculture and Medicine. Front Plant Sci 2019, 10. [Google Scholar] [CrossRef]
  102. Shu; Zhang; Liu; Bian; Liang; Liang; Liang; Lin; Shu; Li; et al. Comparative Transcriptomic Studies on a Cadmium Hyperaccumulator Viola Baoshanensis and Its Non-Tolerant Counterpart V. Inconspicua. Int J Mol Sci 2019, 20, 1906. [CrossRef]
  103. Liu, W.; Shu, W.; Lan, C. Viola Baoshanensis, a Plant That Hyperaccumulates Cadmium. Chinese Science Bulletin 2004, 49, 29–32. [Google Scholar] [CrossRef]
  104. Zhang, J.; Liao, B.; Craik, D.J.; Li, J.-T.; Hu, M.; Shu, W.-S. Identification of Two Suites of Cyclotide Precursor Genes from Metallophyte Viola Baoshanensis: CDNA Sequence Variation, Alternative RNA Splicing and Potential Cyclotide Diversity. Gene 2009, 431, 23–32. [Google Scholar] [CrossRef]
  105. Salehi, H.; Bahramnejad, B.; Majdi, M. Induction of Two Cyclotide-like Genes Zmcyc1 and Zmcyc5 by Abiotic and Biotic Stresses in Zea Mays. Acta Physiol Plant 2017, 39, 131. [Google Scholar] [CrossRef]
  106. Zhang, J.; Hu, M.; Li, J.-T.; Guan, J.-P.; Yang, B.; Shu, W.-S.; Liao, B. A Transcriptional Profile of Metallophyte Viola Baoshanensis Involved in General and Species-Specific Cadmium-Defense Mechanisms. J Plant Physiol 2009, 166, 862–870. [Google Scholar] [CrossRef]
  107. Cai, X.-H.; Brown, C.; Adhiya, J.; Traina, S.J.; Sayre, R.T. Growth and Heavy Metal Binding Properties of Transgenic Chlamydomonas Expressing a Foreign Metallothionein Gene. Int J Phytoremediation 1999, 1, 53–65. [Google Scholar] [CrossRef]
  108. Lim, Y.Y.; Lai, K.S. Generation of Transgenic Rice Expressing Cyclotide Precursor Oldenlandia Affinis Kalata B1 Protein. The Journal of Animal & Plant Sciences 2017, 27, 667–671. [Google Scholar]
  109. Van Parijs, J.; Broekaert, W.F.; Goldstein, I.J.; Peumans, W.J. Hevein: An Antifungal Protein from Rubber-Tree (Hevea Brasiliensis) Latex. Planta 1991, 183, 258–264. [Google Scholar] [CrossRef]
  110. Slavokhotova, A.A.; Shelenkov, A.A.; Andreev, Ya.A.; Odintsova, T.I. Hevein-like Antimicrobial Peptides of Plants. Biochemistry (Moscow) 2017, 82, 1659–1674. [Google Scholar] [CrossRef]
  111. Koo, J.C.; Lee, S.Y.; Chun, H.J.; Cheong, Y.H.; Choi, J.S.; Kawabata, S.; Miyagi, M.; Tsunasawa, S.; Ha, K.S.; Bae, D.W.; et al. Two Hevein Homologs Isolated from the Seed of Pharbitis Nil L. Exhibit Potent Antifungal Activity. Biochimica et Biophysica Acta (BBA) - Protein Structure and Molecular Enzymology 1998, 1382, 80–90. [Google Scholar] [CrossRef]
  112. Zhao, M.; Ma, Y.; Pan, Y.-H.; Zhang, C.-H.; Yuan, W.-X. A Hevein-like Protein and a Class I Chitinase with Antifungal Activity from Leaves of the Paper Mulberry. Biomedical Chromatography 2011, 25, 908–912. [Google Scholar] [CrossRef]
  113. Andreev, Y.A.; Korostyleva, T. V.; Slavokhotova, A.A.; Rogozhin, E.A.; Utkina, L.L.; Vassilevski, A.A.; Grishin, E. V.; Egorov, T.A.; Odintsova, T.I. Genes Encoding Hevein-like Defense Peptides in Wheat: Distribution, Evolution, and Role in Stress Response. Biochimie 2012, 94, 1009–1016. [Google Scholar] [CrossRef]
  114. Andreev, Y.A.; Korostyleva, T. V; Slavokhotova, A.A.; Rogozhin, E.A.; Utkina, L.L.; Vassilevski, A.A.; Grishin, E. V; Egorov, T.A.; Odintsova, T.I. Genes Encoding Hevein-like Defense Peptides in Wheat: Distribution, Evolution, and Role in Stress Response. Biochimie 2012, 94, 1009–1016. [Google Scholar] [CrossRef]
  115. Slavokhotova, A.A.; Naumann, T.A.; Price, N.P.; Rogozhin, E.A.; Andreev, Y.A.; Vassilevski, A.A.; Odintsova, T.I. Novel Mode of Action of Plant Defense Peptides – Hevein-like Antimicrobial Peptides from Wheat Inhibit Fungal Metalloproteases. FEBS J 2014, 281, 4754–4764. [Google Scholar] [CrossRef]
  116. Odintsova, T.; Shcherbakova, L.; Slezina, M.; Pasechnik, T.; Kartabaeva, B.; Istomina, E.; Dzhavakhiya, V. Hevein-Like Antimicrobial Peptides Wamps: Structure–Function Relationship in Antifungal Activity and Sensitization of Plant Pathogenic Fungi to Tebuconazole by WAMP-2-Derived Peptides. Int J Mol Sci 2020, 21, 7912. [Google Scholar] [CrossRef]
  117. Wong, K.H.; Tan, W.L.; Serra, A.; Xiao, T.; Sze, S.K.; Yang, D.; Tam, J.P. Ginkgotides: Proline-Rich Hevein-Like Peptides from Gymnosperm Ginkgo Biloba. Front Plant Sci 2016, 7. [Google Scholar] [CrossRef]
  118. Choon Koo, J.; Jin Chun, H.; Cheol Park, H.; Chul Kim, M.; Duck Koo, Y.; Cheol Koo, S.; Mi Ok, H.; Jeong Park, S.; Lee, S.-H.; Yun, D.-J.; et al. Over-Expression of a Seed Specific Hevein-like Antimicrobial Peptide from Pharbitis Nil Enhances Resistance to a Fungal Pathogen in Transgenic Tobacco Plants. Plant Mol Biol 2002, 50, 441–452. [Google Scholar] [CrossRef]
  119. Kiba, A.; Saitoh, H.; Nishihara, M.; Omiya, K.; Yamamura, S. C-Terminal Domain of a Hevein-Like Protein from Wasabia Japonica Has Potent Antimicrobial Activity. Plant Cell Physiol 2003, 44, 296–303. [Google Scholar] [CrossRef]
  120. Odintsova, T.I.; Vassilevski, A.A.; Slavokhotova, A.A.; Musolyamov, A.K.; Finkina, E.I.; Khadeeva, N. V.; Rogozhin, E.A.; Korostyleva, T. V.; Pukhalsky, V.A.; Grishin, E. V.; et al. A Novel Antifungal Hevein-type Peptide from Triticum Kiharae Seeds with a Unique 10-cysteine Motif. FEBS J 2009, 276, 4266–4275. [Google Scholar] [CrossRef]
  121. Khaliluev, M.R.; Mamonov, A.G.; Smirnov, A.N.; Kharchenko, P.N.; Dolgov, S. V. Expression of Genes Encoding Chitin-Binding Proteins (PR-4) and Hevein-like Antimicrobial Peptides in Transgenic Tomato Plants Enhanced Resistanse to Phytophthora Infestance. Russ Agric Sci 2011, 37, 297–302. [Google Scholar] [CrossRef]
  122. Chen, H.; Guo, A.; Lu, Z.; Tan, S.; Wang, J.; Gao, J.; Zhang, S.; Huang, X.; Zheng, J.; Xi, J.; et al. Agrobacterium Tumefaciens-Mediated Transformation of a Hevein-like Gene into Asparagus Leads to Stem Wilt Resistance. PLoS One 2019, 14, e0223331. [Google Scholar] [CrossRef]
  123. Murata, M.; Konno, K.; Wasano, N.; Mochizuki, A.; Mitsuhara, I. Expression of a Gene for an MLX56 Defense Protein Derived from Mulberry Latex Confers Strong Resistance against a Broad Range of Insect Pests on Transgenic Tomato Lines. PLoS One 2021, 16, e0239958. [Google Scholar] [CrossRef]
  124. Zhang, H.; Zhang, H.; Lin, J. Systemin-mediated Long-distance Systemic Defense Responses. New Phytologist 2020, 226, 1573–1582. [Google Scholar] [CrossRef]
  125. Mucha, P.; Ruczynski, J.; Dobkowski, M.; Backtrog, E.; Rekowski, P. Capillary Electrophoresis Study of Systemin Peptides Spreading in Tomato Plant. Electrophoresis 2019, 40, 336–342. [Google Scholar] [CrossRef]
  126. Pastor-Fernández, J.; Gamir, J.; Pastor, V.; Sanchez-Bel, P.; Sanmartín, N.; Cerezo, M.; Flors, V. Arabidopsis Plants Sense Non-Self Peptides to Promote Resistance Against Plectosphaerella Cucumerina. Front Plant Sci 2020, 11. [Google Scholar] [CrossRef]
  127. Lin, W.; Li, B.; Lu, D.; Chen, S.; Zhu, N.; He, P.; Shan, L. Tyrosine Phosphorylation of Protein Kinase Complex BAK1/BIK1 Mediates Arabidopsis Innate Immunity. Proceedings of the National Academy of Sciences 2014, 111, 3632–3637. [Google Scholar] [CrossRef]
  128. Zhang, H.; Yu, P.; Zhao, J.; Jiang, H.; Wang, H.; Zhu, Y.; Botella, M.A.; Samaj, J.; Li, C.; Lin, J.; et al. Expression of Tomato Prosystemin Gene in Arabidopsis Reveals Systemic Translocation of Its MRNA and Confers Necrotrophic Fungal Resistance. New Phytologist 2018, 217, 799–812. [Google Scholar] [CrossRef]
  129. Coppola; Lelio; Romanelli; Gualtieri; Molisso; Ruocco; Avitabile; Natale; Cascone; Guerrieri; et al. Tomato Plants Treated with Systemin Peptide Show Enhanced Levels of Direct and Indirect Defense Associated with Increased Expression of Defense-Related Genes. Plants 2019, 8, 395. [CrossRef]
  130. Molisso, D.; Coppola, M.; Buonanno, M.; Di Lelio, I.; Monti, S.M.; Melchiorre, C.; Amoresano, A.; Corrado, G.; Delano-Frier, J.P.; Becchimanzi, A.; et al. Tomato Prosystemin Is Much More than a Simple Systemin Precursor. Biology (Basel) 2022, 11, 124. [Google Scholar] [CrossRef]
  131. Pearce, G.; Strydom, D.; Johnson, S.; Ryan, C.A. A Polypeptide from Tomato Leaves Induces Wound-Inducible Proteinase Inhibitor Proteins. Science (1979) 1991, 253, 895–897. [Google Scholar] [CrossRef]
  132. Pearce, G.; Ryan, C.A. Systemic Signaling in Tomato Plants for Defense against Herbivores-ISOLATION AND CHARACTERIZATION OF THREE NOVEL DEFENSE-SIGNALING GLYCOPEPTIDE HORMONES CODED IN A SINGLE PRECURSOR GENE. J Biol Chem 2003, 278, 30044–30050. [Google Scholar] [CrossRef]
  133. Pearce, G.; Siems, W.F.; Bhattacharya, R.; Chen, Y.-C.; Ryan, C.A. Three Hydroxyproline-Rich Glycopeptides Derived from a Single Petunia Polyprotein Precursor Activate Defensin I, a Pathogen Defense Response Gene. Journal of Biological Chemistry 2007, 282, 17777–17784. [Google Scholar] [CrossRef]
  134. Corrado, G.; Arena, S.; Araujo-Burgos, T.; Coppola, M.; Rocco, M.; Scaloni, A.; Rao, R. The Expression of the Tomato Prosystemin in Tobacco Induces Alterations Irrespective of Its Functional Domain. Plant Cell, Tissue and Organ Culture (PCTOC) 2016, 125, 509–519. [Google Scholar] [CrossRef]
  135. Al-Whaibi, M.H. Plant Heat-Shock Proteins: A Mini Review. J King Saud Univ Sci 2011, 23, 139–150. [Google Scholar] [CrossRef]
  136. Hasanuzzaman, M.; Nahar, K.; Anee, T.I.; Fujita, M. Glutathione in Plants: Biosynthesis and Physiological Role in Environmental Stress Tolerance. Physiology and Molecular Biology of Plants 2017, 23, 249–268. [Google Scholar] [CrossRef]
  137. Rehman, S.; Jørgensen, B.; Rasmussen, S.K.; Aziz, E.; Akhtar, W.; Mahmood, T. Expression Analysis of Proteinase Inhibitor-II under OsRGLP2 Promoter in Response to Wounding and Signaling Molecules in Transgenic Nicotiana Benthamiana. 3 Biotech 2018, 8, 51. [Google Scholar] [CrossRef]
  138. Hamza, R.; Pérez-Hedo, M.; Urbaneja, A.; Rambla, J.L.; Granell, A.; Gaddour, K.; Beltrán, J.P.; Cañas, L.A. Expression of Two Barley Proteinase Inhibitors in Tomato Promotes Endogenous Defensive Response and Enhances Resistance to Tuta Absoluta. BMC Plant Biol 2018, 18, 24. [Google Scholar] [CrossRef]
  139. Gullner, G.; Komives, T.; Király, L.; Schröder, P. Glutathione S-Transferase Enzymes in Plant-Pathogen Interactions. Front Plant Sci 2018, 9. [Google Scholar] [CrossRef]
  140. ul Haq; Khan; Ali; Khattak; Gai; Zhang; Wei; Gong Heat Shock Proteins: Dynamic Biomolecules to Counter Plant Biotic and Abiotic Stresses. Int J Mol Sci 2019, 20, 5321. [CrossRef]
  141. Zeng, H.; Xu, L.; Singh, A.; Wang, H.; Du, L.; Poovaiah, B.W. Involvement of Calmodulin and Calmodulin-like Proteins in Plant Responses to Abiotic Stresses. Front Plant Sci 2015, 6. [Google Scholar] [CrossRef]
  142. Wang, Z.; Xie, W.; Chi, F.; Li, C. Identification of Non-Specific Lipid Transfer Protein-1 as a Calmodulin-Binding Protein in Arabidopsis. FEBS Lett 2005, 579, 1683–1687. [Google Scholar] [CrossRef]
  143. Yu, G.; Hou, W.; Du, X.; Wang, L.; Wu, H.; Zhao, L.; Kong, L.; Wang, H. Identification of Wheat Non-Specific Lipid Transfer Proteins Involved in Chilling Tolerance. Plant Cell Rep 2014, 33, 1757–1766. [Google Scholar] [CrossRef]
  144. Pan, Y.; Li, J.; Jiao, L.; Li, C.; Zhu, D.; Yu, J. A Non-Specific Setaria Italica Lipid Transfer Protein Gene Plays a Critical Role under Abiotic Stress. Front Plant Sci 2016, 7. [Google Scholar] [CrossRef]
  145. Wang, W.; Liu, X.; Govers, F. The Mysterious Route of Sterols in Oomycetes. PLoS Pathog 2021, 17, e1009591. [Google Scholar] [CrossRef]
  146. Buhot, N.; Douliez, J.-P.; Jacquemard, A.; Marion, D.; Tran, V.; Maume, B.F.; Milat, M.-L.; Ponchet, M.; Mikès, V.; Kader, J.-C.; et al. A Lipid Transfer Protein Binds to a Receptor Involved in the Control of Plant Defence Responses. FEBS Lett 2001, 509, 27–30. [Google Scholar] [CrossRef]
  147. Chen, Y.; Ma, J.; Zhang, X.; Yang, Y.; Zhou, D.; Yu, Q.; Que, Y.; Xu, L.; Guo, J. A Novel Non-Specific Lipid Transfer Protein Gene from Sugarcane (NsLTPs), Obviously Responded to Abiotic Stresses and Signaling Molecules of SA and MeJA. Sugar Tech 2017, 19, 17–25. [Google Scholar] [CrossRef]
  148. Schmitt, A.J.; Sathoff, A.E.; Holl, C.; Bauer, B.; Samac, D.A.; Carter, C.J. The Major Nectar Protein of Brassica Rapa Is a Non-Specific Lipid Transfer Protein, BrLTP2.1, with Strong Antifungal Activity. J Exp Bot. [CrossRef]
  149. Akhiyarova, G.R.; Ivanov, R.S.; Ivanov, I.I.; Finkina, E.I.; Melnikova, D.N.; Bogdanov, I. V.; Nuzhnaya, T.; Ovchinnikova, T. V.; Veselov, D.S.; Kudoyarova, G.R. Effects of Salinity and Abscisic Acid on Lipid Transfer Protein Accumulation, Suberin Deposition and Hydraulic Conductance in Pea Roots. Membranes (Basel) 2021, 11, 762. [Google Scholar] [CrossRef]
  150. Xue, Y.; Zhang, C.; Shan, R.; Li, X.; Tseke Inkabanga, A.; Li, L.; Jiang, H.; Chai, Y. Genome-Wide Identification and Expression Analysis of NsLTP Gene Family in Rapeseed (Brassica Napus) Reveals Their Critical Roles in Biotic and Abiotic Stress Responses. Int J Mol Sci 2022, 23, 8372. [Google Scholar] [CrossRef]
  151. Jülke, S.; Ludwig-Müller, J. Response of Arabidopsis Thaliana Roots with Altered Lipid Transfer Protein (LTP) Gene Expression to the Clubroot Disease and Salt Stress. Plants 2015, 5, 2. [Google Scholar] [CrossRef]
  152. Gao, S.; Guo, W.; Feng, W.; Liu, L.; Song, X.; Chen, J.; Hou, W.; Zhu, H.; Tang, S.; Hu, J. LTP3 Contributes to Disease Susceptibility in Arabidopsis by Enhancing Abscisic Acid (ABA) Biosynthesis. Mol Plant Pathol 2016, 17, 412–426. [Google Scholar] [CrossRef]
  153. Akhiyarova, G.R.; Finkina, E.I.; Ovchinnikova, T. V.; Veselov, D.S.; Kudoyarova, G.R. Role of Pea LTPs and Abscisic Acid in Salt-Stressed Roots. Biomolecules 2019, 10, 15. [Google Scholar] [CrossRef]
  154. Wang, F.; Zang, X.; Kabir, M.R.; Liu, K.; Liu, Z.; Ni, Z.; Yao, Y.; Hu, Z.; Sun, Q.; Peng, H. A Wheat Lipid Transfer Protein 3 Could Enhance the Basal Thermotolerance and Oxidative Stress Resistance of Arabidopsis. Gene 2014, 550, 18–26. [Google Scholar] [CrossRef]
  155. Missaoui, K.; Gonzalez-Klein, Z.; Pazos-Castro, D.; Hernandez-Ramirez, G.; Garrido-Arandia, M.; Brini, F.; Diaz-Perales, A.; Tome-Amat, J. Plant Non-Specific Lipid Transfer Proteins: An Overview. Plant Physiology and Biochemistry 2022, 171, 115–127. [Google Scholar] [CrossRef]
  156. Wang, F.; Zang, X.; Kabir, M.R.; Liu, K.; Liu, Z.; Ni, Z.; Yao, Y.; Hu, Z.; Sun, Q.; Peng, H. A Wheat Lipid Transfer Protein 3 Could Enhance the Basal Thermotolerance and Oxidative Stress Resistance of Arabidopsis. Gene 2014, 550, 18–26. [Google Scholar] [CrossRef]
  157. Safi, H.; Saibi, W.; Alaoui, M.M.; Hmyene, A.; Masmoudi, K.; Hanin, M.; Brini, F. A Wheat Lipid Transfer Protein (TdLTP4) Promotes Tolerance to Abiotic and Biotic Stress in Arabidopsis Thaliana. Plant Physiology and Biochemistry 2015, 89, 64–75. [Google Scholar] [CrossRef]
  158. Gangadhar, B.H.; Sajeesh, K.; Venkatesh, J.; Baskar, V.; Abhinandan, K.; Yu, J.W.; Prasad, R.; Mishra, R.K. Enhanced Tolerance of Transgenic Potato Plants Over-Expressing Non-Specific Lipid Transfer Protein-1 (StnsLTP1) against Multiple Abiotic Stresses. Front Plant Sci 2016, 7. [Google Scholar] [CrossRef]
  159. Carmona, M.J.; Molina, A.; Fernández, J.A.; López-Fando, J.J.; García-Olmedo, F. Expression of the A-thionin Gene from Barley in Tobacco Confers Enhanced Resistance to Bacterial Pathogens. The Plant Journal 1993, 3, 457–462. [Google Scholar] [CrossRef]
  160. Krens, F.A.; Schaart, J.G.; Groenwold, R.; Walraven, A.E.; Hesselink, T.; Thissen, J.T. Performance and Long-Term Stability of the Barley Hordothionin Gene in Multiple Transgenic Apple Lines. Transgenic Res 2011, 20, 11123–11133. [Google Scholar] [CrossRef]
  161. Hussein, E. Production of Transgenic Paulownia Tomentosa (Thunb.) Steud. Using Chitosan Nanoparticles to Express Antimicrobial Genes Resistant to Bacterial Infection. Mol Biol Res Commun 2020, 9, 55–62. [Google Scholar]
  162. Tantong, S.; Pringsulaka, O.; Weerawanich, K.; Meeprasert, A.; Rungrotmongkol, T.; Sarnthima, R.; Roytrakul, S.; Sirikantaramas, S. Two Novel Antimicrobial Defensins from Rice Identified by Gene Coexpression Network Analyses. Peptides (N.Y.) 2016, 84, 7–16. [Google Scholar] [CrossRef]
  163. Vi, T.X.T.; Nguyen, T.N.L.; Pham, T.T.N.; Nguyen, H.Q.; Nguyen, T.H.Y.; Tu, Q.T.; Le, V.S.; Chu, H.M. Overexpression of the ZmDEF1 Gene Increases the Resistance to Weevil Larvae in Transgenic Maize Seeds. Mol Biol Rep 2019, 46, 2177–2185. [Google Scholar] [CrossRef]
  164. WANG, Q.; QIU, B.L.; LI, S.; ZHANG, Y.P.; CUI, X.M.; GE, F.; LIU, D.Q. A Methyl Jasmonate Induced Defensin like Protein from Panax Notoginseng Confers Resistance against Fusarium Solani in Transgenic Tobacco. Biol Plant 2019, 63, 797–807. [Google Scholar] [CrossRef]
  165. Wei, H.; Movahedi, A.; Xu, C.; Sun, W.; Li, L.; Li, D.; Zhuge, Q. Characterization, Expression Profiling, and Functional Analysis of a Populus Trichocarpa Defensin Gene and Its Potential as an Anti-Agrobacterium Rooting Medium Additive. Sci Rep 2019, 9, 15359. [Google Scholar] [CrossRef]
  166. Deb, D.; Shrestha, A.; Sethi, L.; Das, N.C.; Rai, V.; Das, A.B.; Maiti, I.B.; Dey, N. Transgenic Tobacco Expressing Medicago Sativa Defensin (Msdef1) Confers Resistance to Various Phyto-Pathogens. The Nucleus 2020, 63, 179–190. [Google Scholar] [CrossRef]
  167. Sharma, A.; Sambasivam, V.; Shukla, P.; Rampuria, S.; Kirti, P.B. An in Vitro Generated Variant of Tephrosia Villosa Defensin (α-TvD1) Enhances Biotic Stress Tolerance in Transgenic Tobacco. Journal of Plant Pathology 2020, 102, 1133–1143. [Google Scholar] [CrossRef]
  168. Singh, H.R.; Hazarika, P.; Deka, M.; Das, S. Study of Agrobacterium-Mediated Co-Transformation of Tea for Blister Blight Disease Resistance. J Plant Biochem Biotechnol 2020, 29, 24–35. [Google Scholar] [CrossRef]
  169. Soto, N.; Hernández, Y.; Delgado, C.; Rosabal, Y.; Ortiz, R.; Valencia, L.; Borrás-Hidalgo, O.; Pujol, M.; Enríquez, G.A. Field Resistance to Phakopsora Pachyrhizi and Colletotrichum Truncatum of Transgenic Soybean Expressing the NmDef02 Plant Defensin Gene. Front Plant Sci 2020, 11. [Google Scholar] [CrossRef]
  170. Sun, T.; Zhang, Y.; Wang, Q.; Jiang, Y.; Li, H.; Ma, R.; Wang, S.; Zhao, Y. Overexpression of Panax Ginseng Defensin Enhances Resistance to Fusarium Solani in Transgenic Arabidopsis Thaliana. Australasian Plant Pathology 2021, 50, 705–714. [Google Scholar] [CrossRef]
  171. Nalluri, N.; Karri, V. Over-Expression of Trigonella Foenum-Graecum Defensin (Tfgd2) and Raphanus Sativus Antifungal Protein (RsAFP2) in Transgenic Pigeonpea Confers Resistance to the Helicoverpa Armigera. Plant Cell, Tissue and Organ Culture (PCTOC) 2023, 152, 569–582. [Google Scholar] [CrossRef]
  172. Sadhu, S.; Jogam, P.; Gande, K.; Marapaka, V.; Penna, S.; Peddaboina, V. Expression of Radish Defensin (RsAFP2) Gene in Chickpea (Cicer Arietinum L.) Confers Resistance to Fusarium Wilt Disease. Mol Biol Rep 2023, 50, 11–18. [Google Scholar] [CrossRef]
  173. Shukurov, R.R.; Voblikova, V.D.; Nikonorova, A.K.; Egorov, Ts.A.; Grishin, E. V.; Babakov, A. V. Increase of Resistance of Arabidopsis Thaliana Plants to Phytopathogenic Fungi Expressing Hevein-like Peptides from Weed Plant Stellaria Media. Russ Agric Sci 2010, 36, 265–267. [Google Scholar] [CrossRef]
  174. R. Shukurov, R.; D. Voblikova, V.; Nikonorova, A.K.; Komakhin, R.A.; V. Komakhina, V.; A. Egorov, T.; V. Grishin, E.; V. Babakov, A. Transformation of Tobacco and Arabidopsis Plants with Stellaria Media Genes Encoding Novel Hevein-like Peptides Increases Their Resistance to Fungal Pathogens. Transgenic Res 2012, 21, 313–325. [Google Scholar] [CrossRef]
  175. Vetchinkina, E.M.; Komakhina, V. V.; Vysotskii, D.A.; Zaitsev, D. V.; Smirnov, A.N.; Babakov, A. V.; Komakhin, R.A. Expression of Plant Antimicrobial Peptide Pro-SmAMP2 Gene Increases Resistance of Transgenic Potato Plants to Alternaria and Fusarium Pathogens. Russ J Genet 2016, 52, 939–951. [Google Scholar] [CrossRef]
  176. Chen, H.; Guo, A.; Lu, Z.; Tan, S.; Wang, J.; Gao, J.; Zhang, S.; Huang, X.; Zheng, J.; Xi, J.; et al. Agrobacterium Tumefaciens-Mediated Transformation of a Hevein-like Gene into Asparagus Leads to Stem Wilt Resistance. PLoS One 2019, 14, e0223331. [Google Scholar] [CrossRef]
  177. Beliaev, D. V.; Yuorieva, N.O.; Tereshonok, D. V.; Tashlieva, I.I.; Derevyagina, M.K.; Meleshin, A.A.; Rogozhin, E.A.; Kozlov, S.A. High Resistance of Potato to Early Blight Is Achieved by Expression of the Pro-SmAMP1 Gene for Hevein-Like Antimicrobial Peptides from Common Chickweed (Stellaria Media). Plants 2021, 10, 1395. [Google Scholar] [CrossRef]
  178. Poon, S.; Harris, K.S.; Jackson, M.A.; McCorkelle, O.C.; Gilding, E.K.; Durek, T.; van der Weerden, N.L.; Craik, D.J.; Anderson, M.A. Co-Expression of a Cyclizing Asparaginyl Endopeptidase Enables Efficient Production of Cyclic Peptides in Planta. J Exp Bot 2018, 69, 633–641. [Google Scholar] [CrossRef]
  179. McGurl, B.; Orozco-Cardenas, M.; Pearce, G.; Ryan, C.A. Overexpression of the Prosystemin Gene in Transgenic Tomato Plants Generates a Systemic Signal That Constitutively Induces Proteinase Inhibitor Synthesis. Proceedings of the National Academy of Sciences 1994, 91, 9799–9802. [Google Scholar] [CrossRef]
  180. Coppola, M.; Corrado, G.; Coppola, V.; Cascone, P.; Martinelli, R.; Digilio, M.C.; Pennacchio, F.; Rao, R. Prosystemin Overexpression in Tomato Enhances Resistance to Different Biotic Stresses by Activating Genes of Multiple Signaling Pathways. Plant Mol Biol Report 2015, 33, 1270–1285. [Google Scholar] [CrossRef]
  181. Bubici, G.; Carluccio, A.V.; Stavolone, L.; Cillo, F. Prosystemin Overexpression Induces Transcriptional Modifications of Defense-Related and Receptor-like Kinase Genes and Reduces the Susceptibility to Cucumber Mosaic Virus and Its Satellite RNAs in Transgenic Tomato Plants. PLoS One 2017, 12, e0171902. [Google Scholar] [CrossRef]
  182. Molisso, D.; Coppola, M.; Buonanno, M.; Di Lelio, I.; Aprile, A.M.; Langella, E.; Rigano, M.M.; Francesca, S.; Chiaiese, P.; Palmieri, G.; et al. Not Only Systemin: Prosystemin Harbors Other Active Regions Able to Protect Tomato Plants. Front Plant Sci 2022, 13. [Google Scholar] [CrossRef]
  183. Patkar, R.N.; Chattoo, B.B. Transgenic Indica Rice Expressing Ns-LTP-Like Protein Shows Enhanced Resistance to Both Fungal and Bacterial Pathogens. Molecular Breeding 2006, 17, 159–171. [Google Scholar] [CrossRef]
  184. Safi, H.; Saibi, W.; Alaoui, M.M.; Hmyene, A.; Masmoudi, K.; Hanin, M.; Brini, F. A Wheat Lipid Transfer Protein (TdLTP4) Promotes Tolerance to Abiotic and Biotic Stress in Arabidopsis Thaliana. Plant Physiology and Biochemistry 2015, 89, 64–75. [Google Scholar] [CrossRef]
  185. Xu, Y.; Zheng, X.; Song, Y.; Zhu, L.; Yu, Z.; Gan, L.; Zhou, S.; Liu, H.; Wen, F.; Zhu, C. NtLTP4, a Lipid Transfer Protein That Enhances Salt and Drought Stresses Tolerance in Nicotiana Tabacum. Sci Rep 2018, 8, 8873. [Google Scholar] [CrossRef]
  186. Zhang, P.-G.; Hou, Z.-H.; Chen, J.; Zhou, Y.-B.; Chen, M.; Fang, Z.-W.; Ma, Y.-Z.; Ma, D.-F.; Xu, Z.-S. The Non-Specific Lipid Transfer Protein GmLtpI.3 Is Involved in Drought and Salt Tolerance in Soybean. Environ Exp Bot 2022, 196, 104823. [Google Scholar] [CrossRef]
  187. Song, H.; Yao, P.; Zhang, S.; Jia, H.; Yang, Y.; Liu, L. A Non-Specific Lipid Transfer Protein, NtLTPI.38, Positively Mediates Heat Tolerance by Regulating Photosynthetic Ability and Antioxidant Capacity in Tobacco. Plant Physiology and Biochemistry 2023, 200, 107791. [Google Scholar] [CrossRef]
  188. Xin, H.; Li, Q.; Wu, X.; Yin, B.; Li, J.; Zhu, J. The Arabidopsis Thaliana Integrin-like Gene AT14A Improves Drought Tolerance in Solanum Lycopersicum. J Plant Res 2023, 136, 563–576. [Google Scholar] [CrossRef]
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
Copyright: This open access article is published under a Creative Commons CC BY 4.0 license, which permit the free download, distribution, and reuse, provided that the author and preprint are cited in any reuse.
Prerpints.org logo

Preprints.org is a free preprint server supported by MDPI in Basel, Switzerland.

Subscribe

© 2026 MDPI (Basel, Switzerland) unless otherwise stated

Accessibility

Disclaimer

Terms of Use

Privacy Policy

Privacy Settings