Corona viruses hijack human enzymes to assembly sugar coat on Spike glycoproteins. The mechanism that human antibodies may uncover the antigenic viral peptide epitopes hidden by sugar coat are unknown. In this study, we analyzed recombinant SARS-CoV-2 Spike protein secreted from BTI-Tn-5B1-4 cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We acquired MS/MS spectrums for glycopeptides of all 22 predicted N-glycosylated sites. We further analyzed the surface accessibility of Spike proteins according to Cryo-EM and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The results showed that all 22 N-glycosylated sites of SARS-CoV-2 are modified by high-mannose type of N-glycans. MS/MS fragmentation clearly established the glycopeptide identities. Electron densities of glycans cover most of the Spike receptor binding domain of SARS-CoV-2, except YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQ, similar to a region FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ in SARS-CoV-1. Other surface-exposed domains included those located on Central Helix, between amino acids 967 and 1016 of SARS-CoV-1, and 985 to 1034 of SARS-CoV-2 Spike protein. As the majority of antibody paratopes bind to peptide portion with or without sugar modification, we propose a snake-catcher model that a minimal length of peptide is first clamped by a paratope, and the binding is either strengthened by sugars close to peptide, or not interfered by sugar modification.

Aiming at the development of the application of massive and heterogeneous LEO constellations, the influence of typical perturbation forces on the orbit prediction of LEO satellites at different altitudes is analyzed. Firstly, the main perturbation force model of LEO satellites is introduced. Then experiments for analyzing the influence of orbit prediction on LEO satellites at different altitudes are designed. Finally, the influence of typical perturbation forces on the orbit prediction under different prediction durations by numerical analysis is assessed systematically, and the orbit prediction of LEO satellites with different non-spherical gravitational field orders, ocean tide orders and atmospheric density models were compared and calculated. The research results show that different orders of non-spherical gravitational fields should be considered when the altitude of satellites is different, the reasonable gravitational field orders for LEO satellites at 500km, 1000km, 1500km and 2000km under 1-hour forecast time are 140x140, 80x80, 60x60 and 40x40 orders, the reasonable orders of ocean tide perturbation for 1500km and 2000km satellites are 20x20 orders. Under the 24-hour forecast time, atmospheric resistance has a great influence on the precision of LEO satellites at orbit altitude below 1,000km. The forecast deviation of the LEO satellites orbit at 500km reaches 8751.576m. The difference of orbit precision between different atmospheric density models is in the meter level. The orbit deviation by the Standard Atmosphere 1976 and NRLMSISE 2000 atmospheric models respectively reaches 25.494m. Relevant conclusions provide support for the optimization and selection of dynamical models in high precision orbit determination and fast orbit prediction of LEO satellites.