Submitted:
20 July 2026
Posted:
22 July 2026
You are already at the latest version
Abstract
Keywords:
Introduction
Materials and Methods
2.1. Dataset Construction and Candidate Peptide Identification
2.2. Structure Prediction and Comparative Structural Analyses
2.3. Structure-Guided Machine Learning Prioritization
2.4. Structural Atlas Construction
Results
3.1. Large-Scale Discovery of Toxin-like Peptide Candidates Across Coleoptera
3.2. Physicochemical Landscape of Coleoptera Toxin-like Peptides
3.3. Structural Landscape of Coleoptera Toxin-like Peptides
3.4. Structural Convergence Reveals Recurrent Peptide Architectures
3.5. Structural Features Enable the Prioritization of High-Confidence Toxin-like Peptides
3.6. A Structural Atlas of Coleoptera Toxin-like Peptides
Discussion
4.1. Coleoptera Harbor an Overlooked Structural Diversity of Toxin-like Peptides
4.2. Structural Convergence Shapes the Diversity of Coleoptera Bioactive Peptide Scaffolds
4.3. Structural Information Enhances Computational Discovery and Prioritization of Bioactive Peptides
4.4. Biological Significance and Biotechnological Opportunities of the Structural Atlas
4.5. Structural Bioinformatics Expands Functional Annotation Beyond Sequence Similarity
4.6. Limitations and Future Perspectives
Conclusions
Supplementary Materials
Funding
CRediT Author Statement
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
Declaration of generative AI use
References
- Besharati, M.; Lackner, M. Bioactive peptides: A review. EuroBiotech J. 2023, 7, 176–188. [Google Scholar] [CrossRef]
- Tang, Y.; Zhang, Y.; Zhang, D.; Liu, Y.; Nussinov, R.; Zheng, J. Exploring pathological link between antimicrobial and amyloid peptides. Chem. Soc. Rev. 2024, 53, 8713–8763. [Google Scholar] [CrossRef] [PubMed]
- Gao, B.; Yang, N.; Teng, D.; Hao, Y.; Wang, J.; Mao, R. Marine Antimicrobial Peptides: Advances in Discovery, Multifunctional Mechanisms, and Therapeutic Translation Challenges. Mar. Drugs 2025, 23, 463. [Google Scholar] [CrossRef] [PubMed]
- Craik, D. J.; Daly, N. L.; Bond, T.; Waine, C. Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif. J. Mol. Biol. 1999, 294, 1327–1336. [Google Scholar] [CrossRef] [PubMed]
- King, G. F.; Hardy, M. C. Spider-Venom Peptides: Structure, Pharmacology, and Potential for Control of Insect Pests. Annu. Rev. Entomol. 2013, 58, 475–496. [Google Scholar] [CrossRef] [PubMed]
- Wu, C. Motif-directed oxidative folding to design and discover multicyclic peptides for protein recognition. Acc. Chem. Res. 2025, 58, 1620–1631. [Google Scholar] [CrossRef] [PubMed]
- Kini, M.; Doley, R. Excitement ahead: Structure, function and mechanism of snake venom phospholipase A2 enzymes. Toxicon 2003, 42, 827–840. [Google Scholar] [CrossRef] [PubMed]
- Linial, M.; Rappoport, N.; Ofer, D. Overlooked short toxin-like proteins: a shortcut to drug design. Toxins 2017, 9, 350. [Google Scholar] [CrossRef] [PubMed]
- Raoelijaona, F.; Szczepaniak, J.; Schahl, A.; Bray, J. E.; Zhou, J. C.; Baker, L.; Seiradake, E. Ancestral neuronal receptors are bacterial accessory toxins. Nat. Commun. 2026. [Google Scholar] [CrossRef] [PubMed]
- van Kempen, M.; Kim, S. S.; Tumescheit, C.; Mirdita, M.; Lee, J.; Gilchrist, C. L.; Steinegger, M. Fast and accurate protein structure search with Foldseek. Nat. Biotechnol. 2024, 42, 243–246. [Google Scholar]
- Abramson, J.; Adler, J.; Dunger, J.; Evans, R.; Green, T.; Pritzel, A.; Jumper, J. M. Accurate structure prediction of biomolecular interactions with AlphaFold 3. Nature 2024, 630, 493–500. [Google Scholar] [CrossRef] [PubMed]
- Agoni, C.; Fernández-Díaz, R.; Timmons, P. B.; Adelfio, A.; Gómez, H.; Shields, D. C. Molecular modelling in bioactive peptide discovery and characterisation. Biomolecules 2025, 15, 524. [Google Scholar] [CrossRef] [PubMed]
- Gonçalves, T. C.; Cortez, E. H. T.; Amaral, D. T. A Structure-Informed Atlas of Venom-Derived Peptides Reveals the Organization of Chemical Space. Mol. Inform. 2026, 45, e70039. [Google Scholar] [CrossRef] [PubMed]
- Grabherr, M. G.; Haas, B. J.; Yassour, M.; Levin, J. Z.; Thompson, D. A.; Amit, I.; Regev, A. Full-length transcriptome assembly from RNA-Seq data without a reference genome. Nat. Biotechnol. 2011, 29, 644–652. [Google Scholar] [CrossRef] [PubMed]
- Li, W.; Godzik, A. Cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics 2006, 22, 1658–1659. [Google Scholar] [CrossRef] [PubMed]
- Almagro Armenteros, J. J.; Tsirigos, K. D.; Sønderby, C. K.; Petersen, T. N.; Winther, O.; Brunak, S.; Nielsen, H. SignalP 5.0 improves signal peptide predictions using deep neural networks. Nat. Biotechnol. 2019, 37, 420–423. [Google Scholar] [CrossRef] [PubMed]
- Hegde, R. S.; Bernstein, H. D. The surprising complexity of signal sequences. Trends Biochem. Sci. 2006, 31, 563–571. [Google Scholar] [CrossRef] [PubMed]
- Boon, L.; Ugarte-Berzal, E.; Vandooren, J.; Opdenakker, G. Protease propeptide structures, mechanisms of activation, and functions. Crit. Rev. Biochem. Mol. Biol. 2020, 55, 111–165. [Google Scholar] [CrossRef] [PubMed]
- Löwik, D. W.; van Hest, J. C. Peptide based amphiphiles. Chem. Soc. Rev. 2004, 33, 234–245. [Google Scholar] [CrossRef] [PubMed]
- Eddy, S. R. Accelerated profile HMM searches. PLoS Comput. Biol. 2011, 7, e1002195. [Google Scholar] [CrossRef] [PubMed]
- Hekkelman, M. L.; Salmoral, D. Á.; Perrakis, A.; Joosten, R. P. DSSP 4: FAIR annotation of protein secondary structure. Protein Sci. 2025, 34, e70208. [Google Scholar] [CrossRef] [PubMed]
- Mitternacht, S. FreeSASA: An open source C library for solvent accessible surface area calculations. F1000Research 2016, 5, 189. [Google Scholar] [CrossRef] [PubMed]
- McGibbon, R. T.; Beauchamp, K. A.; Harrigan, M. P.; Klein, C.; Swails, J. M.; Hernández, C. X.; Pande, V. S. MDTraj: a modern open library for the analysis of molecular dynamics trajectories. Biophys. J. 2015, 109, 1528–1532. [Google Scholar] [CrossRef] [PubMed]
- Kramer, O. Scikit-learn. In Machine learning for evolution strategies; Springer International Publishing: Cham, 2016; pp. 45–53. [Google Scholar]
- Saito, T.; Rehmsmeier, M. The precision-recall plot is more informative than the ROC plot when evaluating binary classifiers on imbalanced datasets. PLoS ONE 2015, 10, e0118432. [Google Scholar] [CrossRef] [PubMed]
- Gajda, S.; Chlebus, M. A probability-based models ranking approach: an alternative method of machine-learning model performance assessment. Sensors 2022, 22, 6361. [Google Scholar] [CrossRef] [PubMed]
- Lundberg, S. M.; Lee, S. I. A unified approach to interpreting model predictions. Adv. Neural Inf. Process. Syst. 2017, 30. [Google Scholar]
- Lundberg, S. M.; Erion, G.; Chen, H.; DeGrave, A.; Prutkin, J. M.; Nair, B.; Lee, S. I. From local explanations to global understanding with explainable AI for trees. Nat. Mach. Intell. 2020, 2, 56–67. [Google Scholar] [CrossRef] [PubMed]
- Chamberlain, S. A.; Szöcs, E. taxize: taxonomic search and retrieval in R. F1000Research 2013, 2, 191. [Google Scholar] [CrossRef] [PubMed]
- R Core Team. R: A language and environment for statistical computing. R Foundation for Statistical Computing, Vienna, Austria; 2025. Available online: <u>https://www.R-project.org/.
- Fisher, R. A. On the interpretation of χ 2 from contingency tables, and the calculation of P. J. R. Stat. Soc. 1922, 85, 87–94. [Google Scholar] [CrossRef]
- Benjamini, Y.; Hochberg, Y. Controlling the false discovery rate: a practical and powerful approach to multiple testing. J. R. Stat. Soc. Ser. B (Methodological) 1995, 57, 289–300. [Google Scholar] [CrossRef]
- Yarberry, W. Dplyr. CRAN recipes: DPLYR, stringr, lubridate, and regex in R; Apress: Berkeley, CA, 2021; pp. 1–58. [Google Scholar]
- Wickham, H.; Wickham, M. H. Package ‘tidyr’. Easily Tidy Data With’spread’and’gather () ’Functions 2017, 10. [Google Scholar]
- Coassolo, L.; Wiggenhorn, A.; Svensson, K. J. Understanding peptide hormones: from precursor proteins to bioactive molecules. Trends Biochem. Sci. 2025. [Google Scholar] [CrossRef] [PubMed]
- Fry, B. G.; Roelants, K.; Champagne, D. E.; Scheib, H.; Tyndall, J. D. A.; King, G. F.; Nevalainen, T. J.; Norman, J. A.; Lewis, R. J.; Norton, R. S.; Renjifo, C.; De La Vega, R. C. R. The Toxicogenomic Multiverse: Convergent Recruitment of Proteins Into Animal Venoms. Annu. Review Genom. Hum. Genet.> 2009, 10, 483–511. [Google Scholar] [CrossRef]
- Van Thiel, J.; Khan, M. A.; Wouters, R. M.; Harris, R. J.; Casewell, N. R.; Fry, B. G.; Richardson, M. K. Convergent evolution of toxin resistance in animals. Biol. Rev. 2022, 97, 1823–1843. [Google Scholar] [CrossRef] [PubMed]
- de Oliveira, J. L.; Roman-Ramos, H. Coevolution Between Three-Finger Toxins and Target Receptors. Receptors 2026, 5, 7. [Google Scholar] [CrossRef]
- Beltrán, J. F.; Herrera-Belén, L.; Parraguez-Contreras, F.; Farías, J. G.; Machuca-Sepúlveda, J.; Short, S. MultiToxPred 1.0: a novel comprehensive tool for predicting 27 classes of protein toxins using an ensemble machine learning approach. BMC Bioinform. 2024, 25, 148. [Google Scholar] [CrossRef]






| Step | N | (%) |
|---|---|---|
| Initial candidates | 291 | 100.0 |
| Predicted secreted (Signal peptide) | 155 | 53.3 |
| Valid mature peptide length (8-80 aa) | 273 | 93.8 |
| Out-of-range mature peptides | 18 | 6.2 |
| Candidates with dibasic cleavage motifs | 127 | 43.6 |
| Rank | Candidate | Species | Sequence | Length (aa) | Net charge (pH 7) | Cysteines (n) | Disulfide bonds (n) | Fold cluster | Mean pLDDT | PU score | Seed stability |
| 1 | diphucephala_sp_2 | Diphucephala sp | MKFIYFLLVLVILIVSTVVAPPPCGENEERKTCGPACHPTCANPNVSTVSCPKPCISGCFCKADFLTNSKGKCVPKNQCS | 80 | 4.1 | 10 | 5 | geotrupes_spiniger_2 | 91.08 | 9.98 | 5/5 |
| 2 | eophileurus_sp_1 | Eophileurus sp | MLCAGLAKGGKDACQGDSGGPMVTTGKLTGVISWGIGCAREGYPGIYTQVSKFRNWIKQNSNI | 63 | 4.0 | 3 | 1 | dastarcus_helophoroides_2 | 94.48 | 9.90 | 5/5 |
| 3 | aromia_moschata_1 | Aromia moschata | MSNVECRKTGYGYKITDNMLCAGYHDGKKDSCQGDSGGPLHVVNGSVHQVVGIVSWGEGCAQANFPGVYTRVNRYISWIKSNTRDACYC | 89 | 2.3 | 6 | 2 | dastarcus_helophoroides_2 | 93.15 | 9.90 | 5/5 |
| 4 | platycerus_caraboides_1 | Platycerus caraboides | MFCAGWKSGIADTCAGDSGGGLMCPVNRTLISTAYAVQGITSFGDGCGRKNKYGIYTKVNNYLKWIQNTIEKYS | 74 | 4.0 | 4 | 1 | dastarcus_helophoroides_2 | 93.62 | 9.90 | 4/5 |
| 5 | platycerus_caraboides_2 | Platycerus caraboides | MKVRLNLFQNSRCDKAYKGQYFPNGLPKTMMCVGELAGGKDTCQGDSGGPITITKSDDPCVFYTVGITSFGKACAAENTPAVYTRVSEFVSWIEKTVW | 98 | 2.0 | 5 | 2 | dastarcus_helophoroides_2 | 93.13 | 9.89 | 3/5 |
| 6 | onthophagus_curvicornis_3 | Onthophagus curvicornis | MICAKDLTGGRKDTCQGDSGSGFVVDGKLFGITSWGIGCGRLNKAGVYTKVSLYREWIKLYTKV | 64 | 5.0 | 3 | 1 | dastarcus_helophoroides_2 | 91.56 | 9.88 | 5/5 |
| 7 | microcara_testacea_2 | Microcara testacea | MVCAGDIKEAKDTCQGDSGGPIVVTDKKNQCLFHVIGVTSFGKGCGIKLPAIYTRVSSFVPWIESVVWP | 69 | 1.1 | 4 | 1 | dastarcus_helophoroides_2 | 91.46 | 9.86 | 4/5 |
| 8 | onthophagus_curvicornis_1 | Onthophagus curvicornis | MKLFYLVVIFAALLASVFAAQTCGPNEEYRTCGSACEPTCAQKNPRACAFNCIPGCYCKSGYLHDSKGQCVKEKDC | 76 | 2.1 | 10 | 5 | geotrupes_spiniger_2 | 87.9 | 9.86 | 4/5 |
| 9 | dichotomius_satanas_3 | Dichotomius satanas | MKYRASRITNYMLCAGRGSHDSCQGDSGGPLIINNGERYEIVGIVSWGVGCGRPGYPGVYTRIAKYISWLKYNLEDACLC | 80 | 3.1 | 5 | 1 | dastarcus_helophoroides_2 | 93.05 | 9.85 | 4/5 |
| 10 | sisyphus_schaefferi_1 | Sisyphus schaefferi | MCAGESAGGKDACQGDSGGPLVAGGKLRGIVSWGYGCARPAYPGVYASVSNLRSYITQVAGI | 62 | 2.0 | 3 | 1 | dastarcus_helophoroides_2 | 94.05 | 9.83 | 2/5 |
| 11 | hydroscapha_redfordi_2 | Hydroscapha redfordi | MMCAGQDNRDSCSGDSGGPLMINNGRWVQVGVVSWGIGCGKGQYPGVYSRVTSFLSWIVKNLK | 63 | 3.0 | 3 | 1 | dastarcus_helophoroides_2 | 94.39 | 9.83 | 3/5 |
| 12 | ceutorhynchus_napi_2 | Ceutorhynchus napi | MMCAGYKNGGRDSCQGDSGGPLMLQKTGRWFLIGIVSAGYSCAQAGQPGIYHRVAHTVDWITRAIGS | 67 | 3.2 | 3 | 1 | dastarcus_helophoroides_2 | 94.25 | 9.83 | 3/5 |
| 13 | tenebrio_molitor_1 | Tenebrio molitor | MMCAGYKNGGRDSCQGDSGGPLMLQKQGRWFLIGIVSAGYSCAQPGQPGIYHRVAHTVDWITRAIGV | 67 | 3.2 | 3 | 1 | dastarcus_helophoroides_2 | 94.32 | 9.81 | 2/5 |
| 14 | pleurophorus_caesus_1 | Pleurophorus caesus | MLCAGEANKDSCSGDSGGPLMITNQQGRYVQAGVVSWGIGCGKGQYPGVYSRVESFLPWINKNLKD | 66 | 1.0 | 3 | 1 | dastarcus_helophoroides_2 | 93.94 | 9.80 | 3/5 |
| 15 | neoserica_sp_2 | Neoserica sp | MICAGFTAGGRDACQGDSGGPLVVGNTLVGIVSWGHGCAKPNFPGVYACVGNLRNWIRTNSGV | 63 | 2.1 | 4 | 1 | dastarcus_helophoroides_2 | 93.91 | 9.80 | 2/5 |
| 16 | dichotomius_satanas_5 | Dichotomius satanas | MICAGFAAGGRDACQGDSGGPLAVGNTLVGVVSWGRGCARPNFPGVYACTGNLRNWISSATGI | 63 | 2.0 | 4 | 1 | dastarcus_helophoroides_2 | 94.5 | 9.80 | 2/5 |
| 17 | dichotomius_satanas_1 | Dichotomius satanas | MKLFYLVVIFAALLASVFAAQTCGPNEEYRTCGSACEPTCAQKNPRACAFNCIPGCYCKSGYLHDSKGQCVKEKDC | 76 | 2.1 | 10 | 5 | geotrupes_spiniger_2 | 87.45 | 9.79 | 4/5 |
| 18 | alurnus_ornatus_2 | Alurnus ornatus | MFWVSAANTWCSKYRAESLKLRILTGYHSPGQFRVQGPLSNSDDFASDFGCPVGSKMNPEKKCRIW | 66 | 4.1 | 3 | 0 | elateroides_flabellicornis_2 | 94.19 | 9.79 | 2/5 |
| 19 | micromalthus_debilis_1 | Micromalthus debilis | MIPVVSIDECKRAYANFKTTTIDQRVICAGYAKGGKDACQGDSGGPLMWGKTQASSTSLTYYLIGVVSYGFRCAEEGYPGVYSRVTQFVDWIQKNLN | 97 | 2.0 | 4 | 2 | dastarcus_helophoroides_2 | 94.1 | 9.79 | 3/5 |
| 20 | spercheus_emarginatus_3 | Spercheus emarginatus | MFLRAGRHEFIPDIFLCAGHEGGGRDSCQGDSGGPLQVKGKDGRYFLAGIISWGIGCAEANLPGVCTRISKFVPWILKNVK | 81 | 3.2 | 4 | 1 | dastarcus_helophoroides_2 | 92.92 | 9.78 | 2/5 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2026 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).