Preprint
Article

This version is not peer-reviewed.

Truncated Equinine B Variants Reveal the Sequence Determinats of Antimicrobial Selectivity

A peer-reviewed version of this preprint was published in:
Marine Drugs 2026, 24(1), 46. https://doi.org/10.3390/md24010046

Submitted:

28 November 2025

Posted:

28 November 2025

You are already at the latest version

Abstract

Equinin B (GQCQRKCLGHCSKKCPKHPQCRKRCIRRCFGYCL), a marine peptide from Actinia equina exhibits antibacterial activity against both Gram-positive and Gram-negative bacteria. To identify a smaller active region, the peptide was cleaved into three fragments: GQCQRKCLGHCS (EB-1), KKCPKHPQCRK (EB-2) and RCIRRCFGYCL (EB-3). Only the 11-residue C-terminal fragment showed selective activity against Gram-positive bacteria, including Staphylococcus epidermidis, Bacillus subtilis, and Enterococcus hirae, while remaining inactive against Escherichia coli. Peptide modifications, achieved by replacing cysteine residues with arginine, generally did not enhance activity, but in the C-terminal fragment they reduced hemolytic activity and increased bacterial specificity. Membrane depolarization assays confirmed that the unmodified fragment strongly disrupts bacterial membranes, whereas the modified variant showed minimal depolarization, highlighting its markedly reduced membrane-disruptive potential. In silico modelling revealed that the unmodified fragment (EB-3) can adopt multiple membrane-disruption modes, from transient shallow pores to carpet-like mechanisms, while the cysteine-to-arginine variant interacts mainly via partial insertion anchored by arginine residues. Phenylalanine appears to interact with the membrane, and reducing hydrophobicity by its removal abolished antibacterial activity. These findings highlight the 11-residue C-terminal fragment as a tunable, membrane-targeting motif with mechanistic novelty, offering a blueprint for developing safer, selective antimicrobial peptides with reduced cytotoxicity.

Keywords: 
;  ;  ;  ;  ;  ;  

1. Introduction

Even though the discovery of antibiotics revolutionized medicine, their inappropriate use has enabled the spread of resistant bacteria and rendered commercially available antibiotics ineffective. Antibiotic resistance (AR) is one of the greatest threats, and the development of new molecules with antibacterial activity has become a global priority [1,2,3]. Antimicrobial peptides (AMPs), naturally occurring defense molecules found across many species, represent a powerful alternative antibacterial strategy against antibiotic-resistant pathogens [4]. As part of the innate immune response, they have low antigenicity and exhibit antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi, viruses, and parasites. Because AMPs are molecules with multiple mechanisms of action, they have a low potential for inducing resistance [5,6,7]. Terrestrial environments have been primarily studied for natural peptides useful to the pharmaceutical industry, even though the marine environment covers 70% of the earth’s surface [8,9]. Only in recent decades has the proven therapeutic and anti-infective potential of peptides from marine sources opened a wide field of interest for researchers and companies seeking valuable bioactive compounds from marine fauna and flora [10]. Peptides derived from marine sources have different functions and structures than those isolated from terrestrial sources, due to the distinct adaptive pressures these organisms have experienced during evolution. Most bioactive compounds isolated from marine environments originate from symbiotic microorganisms and organisms, especially mollusks and cnidarians [11,12]. One of these is Actinia equina (Linnaeus, 1758), a little-studied anthozoan coelenterate of the Actiniidae family, widespread from the Indo-Pacific to the Mediterranean and the Atlantic. It is exposed to harsh conditions since it lives mainly in intertidal zones but also up to a few meters deep, and has developed the capability of to remain out of the sea for hours [13]. From this cnidarian’s tentacle, two peptides called equinin A and B were isolated [13]. Equinin B (EB) showed promising antibacterial activity (minimum inhibitory concentrations (MIC) and bactericidal concentrations of 1 mg/mL and 0.25 mg/mL, respectively). The amino acid sequence: GQCQRKCLGHCSKKCPKHPQCRKRCIRRCFGYCL with 34 amino acids, shows a similarity of 37.78% with aurelin, a 40-residue AMP isolated from the mesoglea of the jellyfish Aurelia aurita which exhibits activity against Gram-positive and Gram-negative bacteria [14]. It was also found that truncated peptides derived from aurelin and other AMPs could have significant antimicrobial activity[15,16]. We set ourselves the challenge of preparing truncated peptides from equinin B and investigating their antimicrobial activity. The advantage of peptide-based drugs is that they can be easily designed and rapidly synthesized with optimal purity and high yield [17]. This is possible thanks to the development of solid-phase peptide synthesis (SPPS) by Merrifield back in 1963 [18]. This methodology has been improved and automated over the years, allowing the preparation of peptide sequences in large quantities and within short timescales [19]. The synthesis of smaller peptides is easier and faster than that of longer peptides, and truncated parts of bioactive peptides that still retain activity are valuable.
In this paper, we divided equinin B into three parts: the first part contains 12 residues, and the second and third parts contain 11 residues each: GQCQRKCLGHCS (EB-1), KKCPKHPQCRK (EB-2) and RCIRRCFGYCL (EB-3), respectively. In the second series, all Lys residues (if present in the peptide) were replaced by Arg (EB1-K and EB2-K), and in a third series, all Cys residues were replaced by Arg (EB1-C, EB2-C and EB3-C) (Figure 1). Some amino acids were removed from the peptides, resulting in EB1a-K (C3) and EB3a-C (F7). After evaluating the antimicrobial activity against Escherichia coli and Staphylococcus epidermidis, two active peptides, EB-3 and EB3-C, were identified with EB-3 displaying broad, non-specific activity, whereas EB3-C was active only against bacteria and showed no hemolytic effects. Their distinct activities appear to arise from structural differences, with EB3-C likely inducing only small membrane defects that selectively destabilize bacterial membranes.

2. Results and Discussion

2.1. Structure-Function Guided Design of the Peptide Library

In order to identify biologically active regions in the equinin B sequence, we generated a set of peptides and applied structure–function–driven modifications to enhance their antimicrobial activity, as shown in Figure 1. In the initial set of peptide syntheses, we prepared three truncated peptides, EB(13), derived from EB (Figure 1). The residues are identical to those in equinin B, but the sequence was cleaved twice: after 12 (Ser) and after 23 (Lys), resulting in three peptides, EB-1, EB-2 and EB-3 (Figure 1). We first evaluated their antimicrobial activity against Escherichia coli and Staphylococcus epidermidis over a concentration range of 0.8 to 100 µM (Table 1). Determination of their MICs in cation-adjusted Mueller–Hinton broth (MHB) revealed that none of the peptides exhibited inhibitory activity against E. coli or S. epidermidis within this range, except for peptide EB-3, which had a MIC of 25 µM against S. epidermidis. Assuming the EB-3 region is associated with antimicrobial activity, we analyzed its amino acid composition. Since it lacked lysines, we replaced all lysines in EB-1 and EB-2 with arginine, a modification expected to enhance hydrogen-bonding capacity and strengthen interactions with membrane phospholipids, thereby improving membrane-disruptive activity—a hallmark of classical antimicrobial peptides. This step led to the generation of the modified peptides EB1-K and EB2-K. However, this modification did improve activity against either E.coli nor S.epidermidis. To further enhance membrane interactions, we replaced all cysteines with arginines in all three peptides. Cysteines can form disulfide bridges, which may constrain peptide flexibility and affect membrane interactions; replacing them with arginine was expected to increase positive charge, reduce disulfide bond formation, and enhance peptide–membrane interactions. Despite these modifications, the antimicrobial activity of all peptides remained unchanged. Nevertheless, only EB3-C retained antimicrobial activity, and this activity was observed solely against S. epidermidis. We also investigated whether removing the cysteine at position 3 in EB1-K would affect activity, resulting in the peptide EB1a-K; however, this modification did not improve antimicrobial activity. Notably, the EB-3 peptide had the highest hydrophobic content at 27%, whereas all other peptides ranged between 8% and 18%. To evaluate whether hydrophobicity contributes to antimicrobial activity, we removed the phenylalanine at position 7 in EB3-C, generating the peptide EB3a-C. This modification abolished activity against S. epidermidis, confirming that hydrophobicity is likely the driving force behind the antimicrobial activity of EB-3.
Peptides were synthesized using an automated Fmoc-SPPS approach from the C-terminus to the N-terminus.
The peptides were synthesized on Wang resin with the C-terminal amino acid attached as follows: Fmoc-Ser-Wang resin, Fmoc-Lys(Boc)-Wang resin, Fmoc-Arg(Pbf)-Wang resin, and Fmoc-Leu-Wang resin (Table 2). Synthesis was performed in dimethylformamide using HBTU/OxymaPure® as coupling reagents. The Fmoc group from the first amino acid and subsequent residues after coupling was removed with 20% piperidine in DMF. For activation of carbonyl groups, 0.4 M N-methylmorpholine (NMM) was used. After completing the peptide sequence, the peptide was cleaved from the resin and the protecting groups were removed with 95:2.5:2.5 TFA:TIS:H2O. After deprotection, peptides were precipitated in diisopropyl ether and centrifuged. Following HPLC purification, the compounds were desalted on SPE C18 columns and lyophilized.

2.2. Evaluation of Peptide Specificity

To assess whether the peptides exhibit activity against other cell types, such as human erythrocytes, and to estimate their specificity and therapeutic index, we performed hemolysis assays (Figure 2). None of the peptides showed hemolytic activity up to 400 µM, except for EB-3, which caused significant lysis at concentrations lower than its MIC. Interestingly, replacing cysteine in EB-3 improved its cytotoxic profile, as EB3-C did not induce hemolysis. This modification resulted in a notable therapeutic index of higher than 16, calculated as 400 µM (no hemolysis) divided by 25 µM (MIC against S. epidermidis).

2.3. In Silico Structural Profiling

In silico structural profiling revealed poorly defined secondary structures in most of the peptides, with a general tendency toward alpha-helix formation (Figure 3). Among them, EB-3 adopts the most well-defined alpha-helix, featuring less flexible termini and a distinct segregation of charged and hydrophobic residues—hallmarks of an amphipathic helix. This structural arrangement is reflected in its high amphipathic character, as indicated by the highest hydrophobic moment (µ) among the peptides analyzed. Moreover, EB-3 exhibits the lowest ΔG for partitioning from water to octanol, suggesting a strong potential for membrane interaction (Table 3). Altogether, these features are consistent with key characteristics commonly observed in antimicrobial peptides [20,21]. High µ values are often associated with increased cytotoxicity toward eukaryotic membranes due to stronger and less selective membrane interactions. In this context, it is noteworthy that EB3 exhibited hemolytic activity, whereas its analog EB3a did not. This suggests that reducing amphipathicity may enhance peptide specificity toward bacterial membranes. Interestingly, the modification from EB-3 to EB3-C also resulted in a complete loss of α-helical structure when modeled with AlphaFold [22], whereas PepFold predicted only a small remaining α-helical segment. Whether this difference in secondary structure contributes to the observed increase in selectivity remains an open question. Nevertheless, the larger, contiguous hydrophobic patch in the EB-3 peptide compared with the more distributed hydrophobicity of the EB3-C may explain why the EB-3 shows activity against both bacteria and erythrocytes, whereas the EB3-C remains selective for bacteria.
The bilayer partitioning free energy (ΔG) describes the energetic cost of transferring peptide residues from an aqueous environment into the hydrophobic core of a membrane. It is typically estimated using the water-to-octanol scale, which serves as an experimental proxy for membrane partitioning. Lower (more negative) ΔG values indicate a higher tendency of the peptide to insert into the lipid bilayer, promoting membrane association and potential disruption. Conversely, higher (less negative or positive) ΔG values suggest limited membrane affinity and lower antimicrobial potential [23]. Accordingly, the more favorable (negative) ΔG values observed for EB-3 and its analogs suggest a potential for stronger membrane activity compared to EB-1 and EB-2.

2.4. Evaluation of Membrane Permeability and Activity

To further evaluate the antimicrobial activity and specificity of EB-3 and EB3-C, we determined their MIC values against Bacillus subtilis and Enterococcus hirae, using LL-37 as a reference peptide (Figure 4A). Both EB-3 and EB3-C exhibited antimicrobial activity against these strains. The MIC was in the range of 25.6-102.4, showing the following order of activity for both peptides: S. epidermidis > B. subtilis > E. hirae for both peptides. To investigate whether their mode of action involves membrane permeabilization, we performed propidium iodide (PI) uptake assays (Figure 4B), in which the fluorescent dye penetrates cells only when the membrane integrity is compromised. While LL-37 caused extensive membrane permeabilization in B. subtilis, the EB peptides did not induce significant membrane damage even at concentrations up to 400 µM. A slight increase in permeability was observed for both EB peptides, representing only about 20% of the level induced by LL-37. Interestingly, none of the peptides permeabilized E. hirae or S. epidermidis. On one hand, these results suggest that the EB peptides may act through a more specific, possibly non-lytic mechanism, and that B. subtilis may be more sensitive to their activity. On the other hand, considering that LL-37, a peptide with a well-established membrane-disruptive mechanism, was also unable to permeabilize E. hirae and S. epidermidis, it is likely that smaller or transient membrane perturbations, undetectable by PI staining, could still be sufficient to cause bacterial death. To test whether small defects in the membrane contribute to the antimicrobial effect, we performed a membrane depolarization assay using the voltage-sensitive dye DiSC₃(5). The results revealed that all peptides induced slight depolarization of the bacterial membrane, with EB-3 showing a markedly stronger signal than the other variants. These data support the idea that EB-3’s antimicrobial effect is closely tied to its ability to disrupt membrane potential. Nevertheless, although some degree of membrane depolarization is detectable for EB3-C, the effect is relatively modest, and it remains unclear whether EB3-C alters or depolarizes the membrane sufficiently for its antimicrobial activity to be directly attributed to membrane disruption. This pattern points toward a non-membranolytic or intracellular mode of action for EB3-C.

2.5. In Silico Evaluation of Peptide-Membrane Interactions

To predict the molecular interactions of the peptides with bacterial membranes, we performed Alphafold modeling using membrane compositions resembling B. subtilis, S.epidermidis and E. hirae (Figure 5). For EB-3 interacting with Bacillus membranes, the peptide exhibited transient pore-like insertion accompanied by the formation of a short α-helix. This insertion was relatively shallow, correlating with limited membrane permeability observed experimentally. Notably, hydrogen bonds formed between the backbone of residues R1 and R5, where the N-terminal NH₃ group interacts with the carbonyl oxygen of R5, alongside similar interactions involving the amide nitrogen and residue C2. In contrast, interaction with E. hirae membranes showed peptide helix formation with surface association but no membrane insertion. Here, binding was primarily to phosphate (PO₄) groups on the membrane surface, with residue Y9 oriented outward. For S. epidermidis, the peptide appeared to act via a detergent-like carpet mechanism, forming short aliphatic helices. Residue F7 inserted into the lipid bilayer along with L11 and I7, while R1 and R5 residues interacted with surface PO₄ groups. Although no similar interactions were observed for R4, they remain possible. Consistent with E. hirae, Y9 faced outward, suggesting a conserved orientation.
EB3-C interacts with all Gram-positive membrane mimics through a consistent mechanism involving the formation of a short amphipathic helix, followed by membrane insertion primarily mediated by residue F7 and stabilized through interactions between R4/R6 and phosphate groups. In B. subtilis mimics, insertion occurs via F7 alone, whereas in E. hirae membranes both F7 and Y9 contribute to anchoring the peptide more deeply. For S. epidermidis mimics, insertion is supported by F7 together with L11, again combined with the characteristic R4/R6–phosphate interactions. These conserved electrostatic contacts, together with slight variations in hydrophobic anchoring residues, likely underpin EB3-C’s selective and non-hemolytic membrane-destabilizing activity.
Overall, the modeling indicates that EB-3 lacks membrane selectivity because it does not adopt a stable, deeply inserted conformation in any of the Gram-positive membrane mimics. Instead, it interacts in multiple, non-specific ways—ranging from shallow, transient insertion in B. subtilis, to purely surface binding in E. hirae, and a carpet-like mode in S. epidermidis. This variability, together with its inconsistent hydrophobic anchoring and reliance on general phosphate interactions, prevents EB-3 from targeting a specific membrane architecture and explains its broad, non-selective activity. Interestingly, EB-3 also displays greater peptide–peptide interactions during membrane simulations, which along with its larger hydrophobic patch may underlie its reduced specificity and ability to disrupt both bacterial and erythrocyte membranes.
In addition, we performed structure predictions for EB3a-C to assess whether the F residue in EB-3C is important for membrane interaction. Modelling with Bacillus membranes revealed fish-hook-like structures on the surface, characterized by a backward-bent end forming a short β-sheet, with no deep membrane insertion. The peptide showed strong binding to phosphoglycolohydroxamic acid (PGH) on the membrane surface. For E. hirae and S. epidermidis, EB3a-C appeared mostly unfolded, with deep insertion of the C-terminal leucine (L10) into the membrane and association of arginine residues with phosphate (PO₄) groups; notably, R1 was oriented outward. These observations suggest that EB3a-C interacts predominantly via surface binding and shallow insertion, relying on specific lipid interactions rather than deep membrane penetration. The structural differences from EB-3, including the β-sheet formation and altered insertion depth, likely contribute to its lack of activity.

3. Materials and Methods

3.1. General

Commercial reagents and solvents were obtained as follows: Fmoc-Ser(tBu)-Wang resin, Fmoc-Lys(Boc)-Wang resin, Fmoc-Leu-Wang resin, Fmoc-Cys(tBu)-OH, Fmoc-Gly-OH, Fmoc-Phe-OH, Fmoc-Lys(Boc)-OH, Fmoc-Leu-OH, Fmoc-Gln(Trt)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Pro-OH and Fmoc-Ile-OH all purchased from Merck (Darmstadt, Germany).
NMR spectra were recorded on a Bruker AV 600 spectrometer, operating at 150.91 MHz for 13C and 600.13 MHz for 1H nuclei. The spectra were measured in deuterated dimethyl sulfoxide (DMSO-d6) at 25 °C. Chemical shifts in parts per million (ppm) were referenced to tetrametylsilane (TMS). Spectra were assigned based on one dimensional 1H, 13C and APT (Attached Proton Test) and 2D homonuclear COSY (Correlation Spectroscopy) and heteronuclear HMQC (Heteronuclear Multiple-Quantum Correlation) and HMBC (Heteronuclear Multiple Bond Correlation) experiments.
Solid phase peptide synthesis was carried out on SPPS PS3 (Protein Technologies, Inc., Tucson, Arizona, USA) in dimethylformamide (DMF) as solvent, and 20 % piperidine as deprotecting reagent and 0.4 M NMM as activating reagent in combination of coupling reagents HBTU and OximePure.
RP-HPLC analysis and purification was perfomed on analytical column Zorbax C18 (4.6 × 150 mm, 5 μm, Agilent Technologies, Waldbronn, Germany) and preparative column Zorbax (21.2 × 150 mm, 5 μm, Agilent Technologies, Waldbronn, Germany). The analyses were performed on an Agilent 1200 Series System (Agilent Technologies, Waldbronn, Germany), equipped with a vacuum degasser, a quaternary pump, a thermostated column compartment, an autosampler and a variable wavelength detector. The method used was gradient A as follows: 0.1% TFA/water (eluent 1); MeOH (eluent 2); 0-30 min 100 % eluent 1 to 100 % eluent 2; 30-35 min 100% eluent 2; 35-35.1 min 100 % eluent 2 to 100 % eluent 1; 35.1-40 min 100 % eluent 1; flow rate: 1 mL min−1 (analytical) and 10 mL min-1 (preparative); detection wavelength: 210 and 215 nm; injection volume: 20-50 μL (analytical), 5 mL (preparative).

3.2. Peptide Synthesis

All peptides were synthesized on Wang resin by automated SPPS on a PS3 peptide synthesizer (Protein Technologies, Inc., Tucson, Arizona, USA), following the Fmoc-strategy. The following Fmoc-amino acids were used: Fmoc-Ser(tBu)-Wang resin, Fmoc-Lys(Boc)-Wang resin, Fmoc-Leu-Wang resin, Fmoc-Cys(tBu)-OH, Fmoc-Gly-OH, Fmoc-Phe-OH, Fmoc-Lys(Boc)-OH, Fmoc-Leu-OH, Fmoc-Gln(Trt)-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Pro-OH and Fmoc-Ile-OH. Fmoc deprotections were performed with a solution of 20% piperidine in DMF. Peptide assembly was performed with the SPPS standard coupling cycle using commercial Wang resin with anchoring first (C-terminus) amino acid and following Fmoc-protected amino acids (4 eq in DMF), OxymaPure (4 equiv in DMF), and HBTU (4 equiv in DMF). Briefly, the resin charged with the all-protected Fmoc-peptide was treated with a mixture of TFA/TIS/H2O (95:2.5:2.5, v/v/v) at room temperature for cleavage from resin and deprotection of side amino acid chains. After 3 h, the resin was filtered off. The peptides were precipitated with cold diisopropyl ether, centrifuged and lyophilized. Purification and subsequent analysis of peptides was performed using HPLC as explained in Section 3.1. NMR spectra are shown in Supplementary Materials (SM): Figure S1.1.-S1.20.
EB-1,Gly-Gln-Cys-Gln-Arg-Lys-Cys-Leu-Gly-His-Cys-Ser (GQCQRKCLGHCS)
Yield: 86%; C50H86N20O18S3. tR (A) = 20.23 min. 1H NMR (600 MHz, DMSO) δ 8.58 - 7.31 NH, 6.94 (s, 0.3H) NH-His, 6.83 (s, 0.7H) NH-His, 4.53 (dd, J = 12.8, 7.5 Hz, 1H) α-Gln, 4.42 (dt, J = 9.8, 6.4 Hz, 1H) α-Gln, 4.39 – 4.33 (m), 4.31 – 4.22 (m, 3H) α-His, α-Ser, α-Leu, 3.73 (d, J = 6.2 Hz, H) α-Gly, 3.70 (dd, J = 11.0, 5.4 Hz, 1H) β-Ser, 3.64 (dd, J = 11.0, 4.5 Hz, 1H) β-Ser, 3.60 (s, 2H) δ-Arg, 3.08 (d, J = 5.9 Hz, 2H) δ-Arg, 3.02 – 2.96 (m) β-His, 2.94 – 2.89 (m) β-Ser, 2.89 – 2.82 (m) β-His, 2.78 – 2.73 (m) ε-Lys, 2.71 – 2.66 (m) ε-Lys, 2.18 – 2.06 (m, 4H) γ-Gln, 1.95 – 1.85 (m, 2H) β-Cys, 1.79 – 1.68 (m, 4H) β-Cys, 1.60 (dd, J = 13.6, 6.9 Hz, 2H) γ-Leu, 1.56 – 1.42 (m, 8H) β-Lys, β-Leu, β-Cys, 1.37 – 1.28 (m, 2H) γ-Lys, 0.86 (d, J = 6.6 Hz, 3H) δ-Leu, 0.81 (d, J = 6.5 Hz, 3H) δ’-Leu. 13C NMR (151 MHz, DMSO) δ 174.08 - 165.85 CO, 156.8 ε-Arg, 134.4 ε-His, 132.5 γ-His, 118.10 δ-His, 61.23 Ser-β, 54.9 α-His, 53.3 α-Ser, 53.0 α-Gln, 52.8 α-Cys, 52.3 α-Gln, 52.2 α-Cys, 52.1 α-Cys, 52.1 α-Lys, 52.0 α-Arg, 51.2 α-Leu, 42.0 α-Gly, 41.9 α-Gly, 41.87, 40.6 β-Leu, 40.4 δ-Arg, 40.1 δ-Arg, 40.0 - 39.0 DMSO, 38.7 ε-Lys, 31.6 β-His, 31.4 γ-Gln, 31.2 γ-Gln, 30.63, 30.6 t-Bu-OH, 29.9 β-Arg, 29.7 β-Arg, 29.1 β-Cys, 28.5 β-Cys, 27.9 β-Cys, 26.6 β-Lys, 24.9 γ-Arg, 24.0 γ-Leu, 23.1 Leu-δ, 22.1 γ-Lys, 21.4 Leu-δ’ MS: m/z [M + H]+ (calc: 1318.58); [M+2H]2+ calc. m/z 660.2925; exp. m/z 660.2924.
EB-2,Lys-Lys-Cys-Pro-Lys-His-Pro-Gln-Cys-Arg-Lys (KKCPKHPQCRK)
Yield: 77%; C57H101N21O13S2. tR (A) = 14.52 min. 1H NMR (600 MHz, DMSO) δ 8.42 - 7.10 NH, 4.75 (s, 1H), 4.62 (d, J = 7.1 Hz, 1H), 4.46 – 4.32 (m, 4H) α-Pro, α-Lys 4.28 (m, 1H) α-Gln, 4.20 (dd, J = 13.5, 8.2 Hz, 2H) α-Lys, 3.84 (t, J = 6.5 Hz, 2H) α-Lys, 3.61 (m, 2H) δ-Pro, 3.40 (m) δ-Pro, 3.15 – 3.03 (m) δ-Arg, 2.93 (dd, J = 12.9, 5.9 Hz, 2H) β-Pro, 2.89 – 2.84 (m) β-Pro, 2.77 (m) β-Pro, ε-Lys, 2.68 (dd, J = 13.0, 7.3 Hz, 1H) β-Pro, 2.20 (t, J = 7.6 Hz, 2H) γ-Gln, 2.09 (m, 1H) β-Gln, 1.99 (m) β-Cys, 1.91 (m) β-Gln, 1.84 (m, 2H) β-Cys, 1.76 (m, 4H) δ-Lys, 1.64 (m, 2H) δ-Lys, 1.63 – 1.49 (m) β-Lys, 1.46 – 1.31 (m) δ-Lys, γ-Lys. 13C NMR (151 MHz, DMSO) δ 174.3 - 169.9 CO, 157.11 ε-Arg, 59.9 α-Pro, 59.6 α-Pro, 53.3 α-His 52.6 α-Arg, 52.5 α-Gln, 52.4, 52.13 α-Cys, α-Cys, 52.1 α-Lys, 51.8 α-Lys, 51.5 Lys, 50.5 α-Lys, 47.00 δ-Pro, 40.6 δ-Arg, 40.0 - 39.4 DMSO, 38.8 ε-Lys, 38.7 ε-Lys, 38.6 ε-Lys, 31.5 γ-Gln, 31.4 β-Gln, 31.0 β-His, 30.7 t-Bu-OH, 30.6 -δ-Lys, 30.5 δ-Lys, 30.0 δ-, 29.6 β-Pro 29.1 β-Pro, 27.5 β-Cys, 26.6 β-Lys, 26.5 β-Lys, 26.5 β-Lys, 26.4 β-Lys, 24.7 γ-Arg, 24.4 γ-Pro, 24.3 γ-Pro 22.3 γ-Lys, 22.1 γ-Lys, 21.0 γ-Lys. MS: m/z [M + H]+ (calc: 1352.74); [M+2H]2+ calc. m/z 676.8743; exp. m/z 676.8730.
EB-3,Arg-Cys-Ile-Arg-Arg-Cys-Phe-Gly-Tyr-Cys-Leu (RCIRRCFGYCL)
Yield: 77%; C59H96N20O13S3. tR (A) = 23.34 min. 1H NMR (600 MHz, DMSO) δ 8.94 NH-Leu, 8.05-7.50 NH, (8.16 d, NH-Arg, NH-Cys; 7.99 d, NH-Arg; 7.94 dd, NH-Gly; 7.92 d, NH-Tyr; 7.89 NH-Ile; 7.84 d, NH-Phe; 7.79 d, NH-Cys; 7.74 d, NH-Leu; 7.24- 7.17 (m) δ-Phe, ε-Phe, ξ-Phe, 7.16- 7.10 NH, 7.02-7.00 (d, J = 8.4 Hz) δ-Tyr; 6.65-6.63 (d, J = 8.4 Hz) ε-Tyr, 4.54-4.47 (m) α-Cys, α-Arg, 4.42-4.38 (m) α-Arg, 4.36-4.30 (m) α-Tyr, α-Phe, 4.25-4.21 (m) α-Ile, α-Leu, 3.78-3.71 (m) α-Gly, 3.67-3.62 (m) α-Gly, 3.59-3.58 α-Arg, 3.14-3.05 δ-Arg, β-Phe, 2.97-2.86 (m) β-Tyr, β-Phe, β-Cys, β-Arg, 2.80-2.66 (m) β-Arg, β-Cys, β-Tyr, β-Ile, 1.81-1.65 (m) β-Ile, 1.62-1.41 (m) γ-Ile, γ-Leu, γ-Arg, γ-Ile, 1.19 -1.08 (m) γ-Ile, 0.95-0.81 (m) δ-Leu, δ-Ile, CH3-(β-Ile). 13C NMR (151 MHz, DMSO) δ 171.1 CO-Phe, Tyr, 170.8 CO- Ile, Arg, 170.8 CO-Arg, 169.9, 169.7 CO-Cys, 169.5 CO-Leu, 168.2 CO-Gly, 157.0 ε-Arg, 156.9 ε-Arg, 156.9 ε-Arg, 155.8 ξ-Tyr, 137.6 γ-Phe, 130.1 δ-Phe, 129.2 ε-Phe, 127.9 δ-Tyr, 127.6 γ-Ty, 126.2, 114.8 ε-Tyr, 57.0 α-Ile, 54.3 α-Cys, 54.2 α-Phe, 53,3 α-Arg, 53.2 α-Tyr, 53.0 α-Arg, 52.3 α-Cys, 52.2 α-Cys, 51.9 α-Arg, 51.2 α-Leu, 42.0 β-Gly; 40.3 δ-Arg; 37.3 β-Phe, 37.0 β-Tyr, 36.5 β-Ile, 30.0 β-Cys, 29.9 β-Cys, 29.3 β-Arg, 29.0 β-Arg, 24.9 γ-Arg, 24.3 γ-Arg, 24.1 γ-Leu, 22.9 δ-Leu, 21.8 δ-Leu, 15.3 CH3-(β-Ile), 10.9 δ-Ile. MS: m/z [M + H]+ (calc: 1389.67); [M+2H]2+ calc. m/z 695.3392; exp. m/z 695.3413.
EB1a-K,Gly-Gln-Gln-Arg-Arg-Gly-His-Cys-Ser (GQQRRCLGHCS)
Yield: 92%; C47H81N21O15S2. tR (A) = 18.23 min.1H NMR (600 MHz, DMSO) δ 8.55 - 6.88 NH, 4.59 (dd, J = 13.2, 7.6 Hz, 1H) α-Arg, 4.44 (td, J = 8.4, 5.2 Hz, 1H), 4.36 (dt, J = 13.8, 6.9 Hz, 2H), 4.34 – 4.29 (m, 2H) α-Gln, 4.29 – 4.25 (m, 2H) α-His, 4.23 (dd, J = 14.0, 7.9 Hz, 1H) α-Gln, 3.75 – 3.69 (m, 4H) β-Ser, α-Gly, 3.66 – 3.62 (m, 2H) β-Ser, α-Gly 3.59 (d, J = 2.8 Hz, 2H) δ-Arg, 3.11 – 3.05 (m, 5H) δ-Arg, 3.04 – 2.99 (m, 2H) β-His, 2.92 (dd, J = 12.9, 5.1 Hz, 2H) β-His, 2.84 (dd, J = 12.6, 6.1 Hz, 1H) β-Cys, 2.69 (td, J = 13.3, 8.5 Hz, 2H), 2.19 – 2.05 (m, 4H) γ-Gln, 1.93 – 1.82 (m, 2H) β-Gln, 1.70 (d, J = 5.4 Hz, 5H) β-Gln, 1.63 – 1.56 (m, 2H) γ-Leu, β-Arg , 1.47 (m, 8H) β-Leu, β-Arg, γ-Arg, 0.94 (d, J = 18.4 Hz, 4H), 0.86 (d, J = 6.6 Hz, 3H) δ-Leu, 0.81 (d, J = 6.5 Hz, 3H) δ’-Leu. 13C NMR (151 MHz, DMSO) δ 174.0 - 165.8 NH, 156.8 ε-Arg, 134.6 ε-His, 132.3 γ-His, 116.1 δ-His, 61.2 β-Ser, 54.9 α-His, 53.0 α-Cys, 52.8 α-Ser, 52.3 α-Gln, 52.2 α-Arg, 52.0 α-Arg, 51.9 α-Arg, 51.2 α-Leu, 42.0 α-Gly, 41.9 α-Gly, 40.6 β-Leu, 40.4 δ-Arg, 40.1 δ-Arg, 40.0 - 39.0 DMSO, 31.4 γ-Gln, 31.3 γ-Gln, 30.6 t-Bu-OH, 29.9 β-Arg, 29.9 β-His, 29.4 β-Arg, 29.0 β-Gln, 28.3 β-Arg, 27.7 β-Cys, 24.9 γ-Arg, 24.8 γ-Arg, 24.0 γ-Leu, 23.0 δ-Leu, 21.4 δ’-Leu. MS: m/z [M + H]+ (calc: 1244.58) [M+2H]2+ calc. m/z 622.7909; exp. m/z 622.7914.
EB1-K,Gly-Gln-Cys-Gln-Arg-Arg-Gly-His-Cys-Ser (GQCQRRCLGHCS)
Yield: 46%; C50H86N22O16S3. tR (A) = 19.80 min. 1H NMR (600 MHz, DMSO) δ 8.58 - 6.83 NH, 4.59 - 4.55 (m) α-Arg, 4.45 - 4.41 (m) α-Arg, 4.40 - 4.31 (m) α-Gln, 4.29 - 4.24 (m) α-Leu, α-His, α-Ser, 3.74 - 3.73 (m) α-Gly, 3.72 - 3.69 (m) β-Ser, 3.65 - 3.63 (m) β-Ser, 3.60 δ-Arg, 3.09 - 3.07 (m) δ-Arg, 3.02 - 2.89 (m) β-His, 2.87 - 2.70 (m) δ-Arg, 2.68 - 2.61 (m) β-His, 2.52 - 2.38 DMSO, 2.14 - 2.08 (m) γ-Gln, 1.91 - 1.88 (m) β-Gln, 1.74 - 1.72 (m) β-Gln, 1.68 – 1.64 (m) β-Arg, 1.62 - 1.58 (m) γ-Leu, 1.50 - 1.47 (m) β-Leu, 1.36 - 1.12 t-Bu-OH, 0.86 (d, J = 6.6 Hz, 1H) δ-Leu, 0.81 (d, J = 6.5 Hz, 1H) δ’-Leu. 13C NMR (151 MHz, DMSO) δ 174.2 δ-Gln, 173.8 δ-Gln, 172.1 CO-Leu, 171.7 CO-Gln, 171.1 CO-Gln, 170.9 CO-Arg, 170.1 CO-Arg, 170.1 CO-His, 170.0 CO-Gly, 170.0 CO-Ser, 168.5 CO-Cys, 165.8 CO-Cys, 156.7 ε-Arg, 156.7 ε-Arg, 61.2 β-Ser, 54.9 α-His, 53.3 α-Cys, 53.0 α-Ser, 52.8 α-Arg, 52.2 α-Cys, 52.1, 52.04, 51.8 α-Arg, 51.2 α-Gln, 42.1 α-Gly, 41.9 α-Gly, 41.9, 41.85, 40.5 β-Leu, 40.4 δ-Arg, 40.1 δ-Arg, 40.0 - 39.0 DMSO, 31.4 γ-Gln, 31.2 γ-Gln, 30.6 β-His, 30.6 β-Arg, 29.9 β-Arg, 29.9 β-Cys, 29.7 β-Cys, 29.3 β-Cys, 28.5 β-Gln, 27.9 β-Gln, 24.9 γ-Arg, 24.8 γ-Arg, 24.0 γ-Leu, 23.0 δ-Leu, 21.4 δ’-Leu. MS: m/z [M + H]+ (calc: 1244.58); [M+2H]2+ calc. m/z 674.2955; exp. m/z 674.2955.
EB2-K,Arg-Arg-Cys-Pro-Arg-His-Pro-Gln-Cys-Arg-Arg (RRCPRHPQCRR)
Yield: 77%; C57H101N29O13S2. tR (A) = 15.94 min. 1H NMR (600 MHz, DMSO) δ 8.72 - 7.12 NH, 4.70 (dd, J = 13.7, 6.6 Hz, 1H) α-Arg, 4.67 – 4.62 (m, 1H) α-Arg, 4.40 (dd, J = 11.7, 6.1 Hz, 2H) α-Pro, α-Cys, 4.37 – 4.32 (m, 2H) α-Pro, α-Cys, 4.31 – 4.20 (m, 3H) α-Arg, 3.83 (t, J = 6.3 Hz, 1H) α-Arg, 3.64 (m) δ-Pro, 3.68 -3.58 (m) δ-Pro, 3.37 – 3.31 (m) δ-Pro, 3.17 – 3.10 (m) δ-Arg, 3.08 -3.02 (m) β-Pro, 2.95 -2.89 (m) β-Pro, 2.77 – 2.71 (m) β-Pro, 2.20 (t, J = 7.6 Hz, 2H) γ-Gln, 2.12 -2.06 (m) β-Arg, 2.04 – 1.95 (m) β-Cys, 1.93 -1.89 (m) β-Arg, 1.88 – 1.82 (m) β-Cys, 1.80 – 1.75 (m) β-His, 1.76 -1.70 β-His, β-Arg, 1.67 – 1.61 (m) β-Arg, 1.59 – 1.48 (m) γ-Arg. 13C NMR (151 MHz, DMSO) δ 174.4 - 168.7 CO, 157.2 ε-Arg, 157.1 ε-Arg, 157.1 ε Arg, 116.3 δ-His, 60.1 α-Pro, 59.7 α-Pro α, 53.4 α-Arg, 52.7 α-His, 52.2 α-Cys, 52.0 α-Arg, 51.8 α-Arg, 51.7 α-Arg, 47.1 δ-Pro, 46.9 δ-Pro δ 40.6 δ-Arg, 40.5 δ-Arg, 40.5 δ-Arg, 40.3 δ-Arg, 40.2 δ-Arg, 40.0 - 39.4 DMSO, 31.5 γ-Gln 30.6 t-Bu-OH, 29.9 β-Pro, 29.4 β-Pro, 29.1 β-Arg, 28.9 β-Cys, 28.8 β-Arg, 28.5 β-Arg, 28.3 β-His, 27.4 β-Cys, 25.1 γ-Arg, 24.9 γ-Arg, 24.7 γ-Arg, 24.4 γ-Pro, 24.3 γ-Pro, 24.0 γ-Arg. MS: m/z [M + H]+ (calc: 1465.75); [M+2H]2+ calc. m/z 732.8866; exp. m/z 732.8958.
EB1-C, Gly-Gln-Arg-Gln-Arg-Lys-Arg-Leu-Gly-His-Arg-Ser (GQRQRKRLGHRS)
Yield: 60%; C59H107N29O16. tR (A) = 10.66 min. 1H NMR (600 MHz, DMSO) δ 8.58 - 6.85 NH, 4.59 – 4.55 (m, 1H) α-Arg, 4.35 (dd, J = 13.7, 7.9 Hz, 1H) α-Gln, 4.28 (dd, J = 14.1, 9.6 Hz, 2H) α-Arg, α- Gln, 4.24 (m, 5H) α-His, α-Gln, α-Leu, α-Ser, α-Lys, 3.80 – 3.71 (m, 2H) α-Gly, β-Ser, 3.70 – 3.62 (m, 2H) α-Gly, β-Ser, 3.62 – 3.56 (m) δ-Arg, 3.09 (m) δ-Arg, ε-Lys, 3.03 – 2.98 (m, 1H) β-His, 2.94 – 2.89 (M, 1H) β-His, 2.76 -2.73 (m) ε-Lys, 2.12 (m) γ-Gln, 1.92 -1.82 (m) β-Gln, 1.76 – 1.71 (m) β-Gln, 1.69 – 1.64 (m) β-Arg, 1.60 (m, 2H) γ-Leu, 1.48 (m, 69H) β-Leu, γ-Arg, β-Lys, 1.30 (m, 2H) γ-Lys, 0.86 (d, J = 6.6 Hz, 3H) δ-Leu, 0.82 (d, J = 6.5 Hz, 3H) δ’-Leu. 13C NMR (151 MHz, DMSO) δ 174.1 - 167.2 CO, 156.8 ε-Arg, 134.0 ε-His, 132.5 γ-His, 118.0 δ-His, 61.2 β-Ser, 54.7 α-His, 53.2 α-Lys, α-Arg, 52.2 α-Leu, 41.9 α-Gly, 41.0 β-Leu, 40.1 δ-Arg, 40.0 - 39.0 DMSO, 38.7 ε-Lys, 31.7 β-His, 31.3 γ-Gln, 27.6 β-Gln, β-Arg, 26.6 β-Lys, 24.8 γ-Arg, 24.1 γ-Leu, 23.0 δ-Leu, 22.1 γ-Lys, 21.4 δ’-Leu. MS: m/z [M + H]+ (calc: 1478.86); [M+2H]2+ calc. m/z 739.9304; exp. m/z 739.9287.
EB2-C,Lys-Lys-Arg-Pro-Lys-His-Pro-Gln-Arg-Arg-Lys (KKRPKHPQRRK)
Yield: 52%; C63H115N27O13. tR (A) = 9.53 min.1H NMR (600 MHz, DMSO) δ 8.42 - 7.14 NH, 4.75 (dd, J = 14.3, 7.5 Hz, 1H) α-Lys, 4.51 (dd, J = 12.6, 7.0 Hz, 1H) α-Arg, 4. 4.40 – 4.35 (m, 2H) α-Pro, 4.32 (dd, J = 13.4, 7.3 Hz, 3H) α-Lys, α-Gln, α-Arg, 4.27 (dd, J = 14.5, 9.0 Hz, 1H) α-Arg, 4.18 (td, J = 13.7, 8.3 Hz, 2H) α-Lys, α-His, 3.83 (t, J = 6.5 Hz, 1H) α-Lys, 3.69 – 3.64 (m, 1H) δ-Pro, 3.64 – 3.60 (m, 1H) δ-Pro, 3.60 – 3.53 (m, 1H) δ-Pro, 3.41 (m, 1H) δ-Pro, 3.13 (m) δ-Arg, 3.03 (m) ε-Lys, 2.92 (m) ε-Lys, 2.79 (m) ε-Lys, 2.19 (t, J = 7.6 Hz, 2H) γ-Gln, 2.12 – 2.02 (m, 2H) γ-Pro, 2.02 – 1.94 (m, 1H) γ-Pro, 1.91 (t, J = 6.9 Hz, 1H) β-Gln, 1.90 – 1.81 (m, 2H) β-Gln, γ-Pro, 1.76 -1.70 (m) δ-Lys, β-Arg, 1.66 – 1.48 (m) β-His, δ-Lys, β-Arg, γ-Arg, 1.37 (m) γ-Lys. 13C NMR (151 MHz, DMSO) δ 174.3 - 168.5 CO, 157.2 ε-Arg, 157.2 ε-Arg, 157.1 ε-Arg, 59.9 α-Pro, 59.3 α-Pro, 52.6 α-Arg, 52.5 α-Arg, 52.3 α-Lys, 52.2 α-Gln, 52.1 α-Lys, 51.9 α-Lys, 50.2 α-Lys, 47.0 δ-Pro, 46.9 δ-Pro, 40.7 δ-Arg, 40.6 δ-Arg, 40.5 δ-Arg, 40.2 - 39.4 DMSO, 38.8 ε-Lys, 38.7 ε-Lys, 38.6 ε-Lys, 31.5 γ-Gln, 31.3 γ-Gln, 31.1 β-His 30.6 δ-Lys, 30.4 δ-Lys, 29.2 β-Arg, 29.1 β-β-Arg, 29.0 β-Gln, 28.9 β-Gln, 28.2 β-Pro, 27.5 β-Pro, 26.6 β-Lys, 26.5 β-Lys, 26.3 β-Lys, 24.8 γ-Arg, 24.8 γ-Arg, 24.5 γ-Pro, 24.4 γ-Pro, 22.3 γ-Lys, 22.2 γ-Lys, 22.1 γ-Lys, 21.0 γ-Lys. MS: m/z [M + H]+ (calc: 1458.93); [M+2H]2+ calc. m/z 729.9662; exp. m/z 729.9648.
EB3-C,Arg-Arg-Ile-Arg-Arg-Arg-Phe-Gly-Tyr-Arg-Leu (RRIRRRFGYRL)
Yield: 74%; C68H117N29O13. tR (A) = 17.24 min. 1H NMR (600 MHz, DMSO) δ 8.97 - 7.57 NH, 7.24 - 7.20 (m) δ-Phe, ε-Phe, ζ-Phe, 7.18 - 7.02 NH, 7.01 - 7.00 (d, J = 8.6 Hz) δ-Tyr, 6.65 - 6.64 (d, J = 8.4 Hz) ε-Tyr, 4.57 - 4.53 (m) α-Arg, 4.51 - 4.48 (m) α-Arg, 4.40 - 4.38 (m) α-Arg, 4.32 - 4.26 (m) α-Tyr, 4.25 - 4.20 (m) α-Leu, α-ILe, 3.75 - 3.63 (m) α-Gly, 3.14 - 3.02 (m) δ-Arg, β-Phe, 2.97 - 2.94 (m) β-Phe, 2.87 - 2.83 (m) β-Tyr, 2.74 - 2.70 (m) β-Tyr, 2.51 - 2.49 DMSO, 1.79 - 1.43 (m) β-Ile, β-Leu, γ-Ile, γ-Leu, γ-Arg, 0.92 - 0.81 (m) δ-Leu, δ-Ile, CH3-(β-Ile). 13C NMR (151 MHz, DMSO) δ 174.1 - 168.4 CO, 159.0 ε-Arg, 158.8 ε-Arg, 157.2 ε-Arg, 157.1 ε-Arg, 155.9 ξ-Tyr, 137.4 γ-Phe, 129.9 δ-Tyr, 129.1 ε-Phe, 127.9 δ-Tyr, 127.6 γ-Tyr, 126.2 ζ-Phe, 115.0 ε-Tyr, 57.0 α-Ile, 54.4 α-Phe, 54.0 α-Tyr, 52.7 α-Arg, 52.4 α-Arg, 51.0 α-Arg, 42.1 α-Gly, 40.7 δ-Arg, 40.6 δ-Arg, 40.5 δ-Arg, 40.5 δ-Arg, 40.2 - 39.4 DMSO, 37.7 β-Phe, 36.9 β-Tyr β, 36.7 β-Ile, 29.2 β-Arg, 29.1 β-Arg , 29.0 β-Arg , 28.9 β-Arg, 25.0 γ-Arg, 24.9 γ-Arg, 24.8 γ-Arg , 24.4 γ-Arg , 24.3 γ-Arg , 24.3 γ-Leu, 22.7 δ-Leu, 21.7 δ-Leu, 15.2 β-Ile, 10.8 δ-Ile. HRMS: m/z [M + H]+ (calc: 1548.95); [M+2H]2+ calc. m/z 774.9771; exp. m/z 774.9764.
EB3a-C,Arg-Arg-Ile-Arg-Arg-Arg-Gly-Tyr-Arg-Leu (RRIRRRGYRL)
Yield: 24%; C59H108N28O12. tR (A) = 15.70 min. 1H NMR (600 MHz, DMSO) δ 8.02 – 7.58 NH, 7.32 – 7.04 (m) NH, 6.99 (d, J = 8.5 Hz, 2H) δ-Tyr, 6.68 – 6.62 (d, J = 8.5 Hz, 2H) ε-Tyr, 4.49 (dd, J = 13.2, 8.3 Hz, 1H) α-Tyr, 4.43 – 4.38 (m, 1H) α-Leu, 4.32 (dd, J = 13.8, 8.0 Hz, 2H) α-Arg, 4.30 – 4.25 (m, 3H) α-Arg, 4.22 (dd, J = 15.3, 7.6 Hz, 1H) α-Ile, 3.83 (t, J = 6.4 Hz, 1H) α-Arg, 3.72 (d, J = 6.8 Hz, 2H) α-Gly, 2.94 (dd, J = 14.1, 4.7 Hz, 2H) β-Tyr, 2.71 (dd, J = 14.1, 8.7 Hz, 1H) β-Tyr, 1.72 (ddd, J = 19.9, 14.6, 6.5 Hz, 9H) β-Ile, β-Arg 1.67 – 1.48 (m) β-Arg, γ-Leu 1.45 (ddd, J = 13.4, 7.5, 3.5 Hz, 2H) β-Leu, 1.16 – 1.08 (m, 1H) γ-Ile , 0.91 (d, J = 6.6 Hz, 3H) δ-Leu, 0.87 (d, J = 6.5 Hz, 3H) δ’-Leu, 0.85 (d, J = 6.8 Hz, 3H) CH3-(β-Ile), 0.82 (t, J = 7.4 Hz, 3H) ε-Ile. 13C NMR (151 MHz, DMSO) δ 173.6 - 168.4 CO, 157.2 ε-Arg, 157.1 β-Arg, 155.8 ζ-Tyr, 120,0 δ-Tyr, 127.6 γ-Tyr, 115.0 ε-Tyr, 57.1 α-Ile, 54.3 α-Tyr, 52.6 α-Arg, 52.3 α-Arg, 52.2 α-Arg, 52.1 α-Arg, 50.6 α-Leu, 41.9 α-Gly, 40.6 δ-Arg, 40.5 β-Leu, 40.5 δ-Arg, 40.3 δ-Arg, 40.3 δ-Arg, 40.2 δ-Arg, 40.0 - 39.4 DMSO, 36.9 β-Tyr, 36.6 β-Ile, 29.2 β-Arg, 28.9 β-Arg, 28.8 β-Arg, 28.6 β-Arg, 24.9 γ-Arg, 24.8 γ-Arg, 24.7 γ-Arg, 24.3 γ-Ile, 24.3 γ-Arg, 24.0 γ-Ile, 22.7 δ-Leu, 21.5 δ’-Leu, 15.3 CH3-(β-Ile) , 10.8 ε-Ile. MS: m/z [M+H]+ (calc: 1401.88); [M+2H]2+ calc. m/z 701.4429; exp. m/z 701.4415.

3.2. Biological Activity

3.3.1. Minimum Inhibitory Concentration (MIC) Assay

For these studies we used reference strains Escherichia coli ATCC25922, Bacillus subtilis 168c, Staphylococcus epidermidis DSM 20044 (DSMZ Gmbh, Germany) and Enterococcus hirae DSM 3320 (DSMZ Gmbh, Germany). Bacterial cells were inoculated into Mueller-Hinton Broth II (MHB II; Sigma, Austria) and grown to the mid-logarithmic phase, washed in sodium buffered saline (PBS, 137 mM NaCl, 2.7 mM KCl, 10 mM Na₂HPO₄, and 2 mM KH₂PO₄, pH 7.4). The culture was adjusted to ~1 × 10⁶ CFU/mL and dispensed into 96-well microtiter plates. Peptides were tested in two-fold serial dilutions across a concentration range of 0.4–100 µM, each concentration assayed in duplicate. Growth control wells (bacteria + medium, no peptide) and sterility control wells (medium only) were included. In parallel, the inoculum density and purity were verified by plating serial dilutions of the bacterial culture on MHB agar. After incubation at 37 °C for 20 h under static conditions, bacterial growth was quantified by measuring optical density at 620 nm (OD 620). The MIC was defined as the lowest peptide concentration at which OD 620 showed no increase compared to the growth-control baseline. The experiment was repeated in three independent biological replicates.

3.3.2. Hemolysis Assay

The hemolysis assay was performed using pooled human blood of at least 10 healthy volunteers obtained from healthy donors at the Medical University of Graz (ethical approval: 1142/2025). Erythrocytes were isolated by centrifuging the blood for 10 min at 2100 rpm and subsequently washed several times with PBS. A 2.5% erythrocyte solution in PBS was exposed 10 EB peptides (Figure 2.) (final concentrations: 6.25–400 μM). After 1 h at 37 °C under static conditions, the erythrocyte suspensions were centrifuged for 10 min at 4000 rpm and the absorbance of the supernatants was determined at 405 nm. The percentage of hemolysis was calculated relative to the positive control (1% Triton X-100), according to the following equation
Hemolysis (%) = (Absorbance at peptide x concentration/Absorbance at Triton) × 100

3.3.3. In Silico Analysis of Peptides Structural Properties

Peptide structures were predicted using AlphaFold3 (Beta Server, standard settings, 11 Nov 2024) [22]. Molecular graphics and analyses were performed with UCSF ChimeraX [24]. In addition, peptide sequences were submitted to the PEP-FOLD server (https://bioserv.rpbs.univ-paris-diderot.fr/services/PEP-FOLD/) to generate 3D models using a coarse-grained force field, which were then clustered with Apollo for secondary structure prediction [15,25,26].The basic structural parameters of the peptides, including hydrophobicity, acidity, and charge, were calculated using the Peptide 2.0 hydrophobicity/hydrophilicity analysis tool [https://www.peptide2.com/N_peptide_hydrophobicity_hydrophilicity.php] (https://www.peptide2.com/N_peptide_hydrophobicity_hydrophilicity.php)). Hydrophobic moment (µ), and bilayer partitioning free energy (ΔG) were obtained using Totalizer, a tool within Membrane Protein Explorer (mPEX) [27], [https://blanco.biomol.uci.edu/mpex/](https://blanco.biomol.uci.edu/mpex/)). Totalizer computes peptide hydropathy plots based on whole-residue hydrophobicity according to the Wimley–White scales [28], allowing evaluation of the energetic cost of inserting H-bonded peptide bonds of α-helices into membranes. Bilayer partitioning free energy was assessed using the octanol scale, representing the free energy change for transferring residues from water to the hydrophobic core of the bilayer.

3.3.4. Membrane Permeability Assay

Bacterial membrane permeabilization was evaluated using propidium iodide (PI) uptake. PI is a membrane-impermeable dye: it cannot cross intact bacterial cytoplasmic membranes, but when the membrane integrity is compromised (for example via peptide-mediated permeabilization), PI enters the cell, intercalates into nucleic acids (DNA and RNA) and fluorescence increases markedly. B. subtilis, E. hirae and S. epidermidis cells were grown to mid-logarithmic phase, harvested by centrifugation, washed once with PBS and diluted to a concentration of 1 × 107 cells/mL using PBS instead of growth medium. The cell suspension was incubated with peptides (Table 1) at various concentrations in the presence of PI (final concentration 2.5 µg/mL). Fluorescence (excitation 535 nm, emission 617 nm) was monitored every 2 min for 120 min at 37 °C using a microplate reader (GloMax®, Promega). The time-course fluorescence curves were recorded for each peptide concentration (in duplicate for each time point, and the entire experiment was repeated three independent times). From each time-course fluorescence curve (for a given peptide concentration), a constant time-window (for example minutes 10 to 20) was selected where the fluorescence signal was stable or in the linear uptake phase. The fluorescence values within that window were averaged to provide a representative fluorescence uptake value for that peptide concentration. These averaged fluorescence values (mean of duplicates) were then plotted as a function of peptide concentration (for each independent experiment) to generate a dose-response curve (fluorescence uptake vs peptide concentration). The three independent biological replicates were averaged and standard deviations (or standard errors) calculated and plotted.

3.3.5. Membrane Depolarization Assay

The assay was performed as previously described [23] and in analogy to PI assay described above. Briefly, the mid-log phase cells (1 × 10⁷ CFU/mL) were stained with 1 µM DiSC₃(5) in PBS containing 100 mM KCl for 30 min to allow dye self-assembly and K⁺ equilibration. Peptides of different concentration were added, and fluorescence was recorded at 622/685 nm using was monitored every 2 min for 120 min at 37 °C using a microplate reader (GloMax®, Promega). Further analysis was performed analogously to the PI uptake assay described in Section 3.3.4.

3.3.6. In Silico Peptide-Membrane Interactions

Structure of the peptides were predicted by AlphaFold and Pepfold programs [22]. Bacterial membrane models were composed as follow: for B. subtilis, 35% 1,2-distearoyl-sn-glycero-3-phosphoglycerol (DSPG), 35% 1,2-dipalmitoyl-sn-glycero-3-phosphoglycerol (DPPG), 12% phosphatidylethanolamine (PE), 3% cardiolipin (CL), 5% phosphatidylglycerol (PGH), 2% lysyl-mono-galactosyldiacylglycerol (LMG), 4% digalactosyldiacylglycerol (DGD), and 2% bis(monoacylglycero)phosphate (B5S); for E. hirae, 30% DSPG, 30% DPPG, and 20% CL; and for S. epidermidis, 8% PE, 26% DPPG, 26% DSPG, and 20% CL. These models closely reflect membrane compositions reported in earlier studies [29]. The prediction analysis yielded a ranking score of 0.84, ipTM and pTM scores of 0.34 and 0.35, respectively, and an ipTM+pTM value of about 0.34, and these results were consistent across all models.

3.4. Nano-Ultra-Performance Liquid Chromatography-Electrospray Ionization-Quadrupole Mass Spectrometry Analysis

Peptides were desalted on the AssayMAP Bravo Platform (Agilent Technologies, Waldbronn, Germany) using in-house packed mixed-cation exchange (MCX) cartridges. Cartridges were conditioned with methanol (100 μL), equilibrated with ultrapure water (100 μL), and loaded with 100 μL of 0.1 mg/mL peptide solution. Peptides were eluted with 25 μL of 10% ACN in 1% ammonium hydroxide, vacuum-dried, and reconstituted in 0.1% formic acid to a final concentration of 0.1 mg/mL. They were separated on a nanoAcquity UPLC system equipped with a nanoAcquity UPLC 2G-V/M symmetry C18 trap column (100 Å, 5 μm, 180 μm × 20 mm) and a nanoAcquity UPLC BEH C18 analytical column (130 Å, 1.7 μm, 100 μm × 100 mm) (Waters, Milford, MA, USA). The column temperature was set to 40 °C and injection volume was 1 μL. Mobile phase A consisted of aqueous 0.1% formic acid, and mobile phase B consisted of 0.1% formic acid in 95% ACN. Isocratic delivery of solvent A into the trap column was performed at a flow rate of 15 μL/min for 2 min. The samples were eluted under gradient elution conditions at a flow rate of 1 μL/min and a run time of 32 min. The following elution gradient was used: 0–3 min, 80% solvent A; 3–24 min, 45% solvent A; 24–27 min, 1% solvent A; 27–29 min, 80% solvent A; and 29–32 min, 80% solvent A. The modifier solution of 1 mM ethyl methanoate in isopropanol was introduced from a Synapt A channel by a “T” connector at a flow rate of 0.4 μL/min.
A nanoUPLC system was coupled to a nanoESI-QTOF Synapt G2-Si mass spectrometer (Waters, Milford, MA, USA), and instrument parameters were set using MassLynx software (v4.1, Waters, Milford, MA, USA). Acquisition mode for both MS and MS/MS was set to positive polarity and resolution analyzer mode with the following parameters: nitrogen flow was 1.1 bar with a source temperature of 80 °C, capillary voltage was set to 4.2 kV, cone voltage was set to 40 kV and spectral acquisition time was 1 s. Collision energy during MS/MS was set to 40 V for all peptides. The mass accuracy of the raw data was achieved by infusing 1 ng/μL of leucine enkephalin in isopropanol and 0.1% formic acid. Table A1. contains the list of selected precursor ions.
Data analysis The obtained MS/MS spectra were deconvoluted using ExDViewer software (v4.6.31, Agilent Technologies). The assignment of y- and b-ion series, as well as sequence coverage calculation, was performed within the same software. MS analysis results are shown in SM: Figure S2.1. – S2.30. and Table S2.1. – S2.10:

4. Conclusions

To identify biologically active regions in the Equinin B (EB) sequence, we generated a set of peptides and applied structure–function-driven modifications to enhance their antimicrobial activity. The sequence was cleaved twice: after 12 (Ser) and after 23 (Lys), resulting in three peptides EB-1, EB-2 and EB-3. In the first derivatization all Lys residues in EB-1 and EB-2 were replaced with Arg to increase hydrogen bonding (EB1-K, EB2-K). In the second derivatization all Cys residues were replaced with Arg (EB1-C, EB2-C, EB3-C). All compounds were tested for antimicrobial activity against E. coli and S. epidermidis. Only peptides from the third part of Equinin B, EB-3 (MIC 25 µM), and EB3-C (MIC 25-50 µM) showed antimicrobial activity only against the Gram-positive S. epidermidis. When Phe was removed from EB3-C, the antimicrobial activity was lost in the peptide EB3a-C. This removal reduced hydrophobicity from 27% to 20%, suggesting that ~20% represents the minimal threshold for antimicrobial activity, consistent with the inactivity of all peptides below this level. Since EB-3 shows high hemolytic activity, EB3-C is the leading peptide for potential drug design. In silico structure analysis predicts a better helical structure for EB-3, while EB3-C shows a less folded structure. To verify that the peptides’ effects were not artifacts and not limited to S. epidermidis, they were also tested against two additional Gram-positive species - both showing similar potency against B. subtilis (MIC ~25–50 µM) and somewhat lower activity against E. hirae (MIC ~50–100 µM), suggesting a more general target. In silico analysis of their physicochemical properties indicated that EB-3 had the lowest bilayer partitioning free energy (ΔG) and higher amphipathicity, suggesting a greater potential for membrane interaction. EB3-C exhibited a slightly higher ΔG and lower amphipathicity, consistent with its predicted reduced membrane affinity, highlighting how these properties may contribute to differences in antimicrobial potency. Evaluation of membrane effects using PI and DiSC₃(5) assays revealed that EB-3 significantly depolarized the membranes of all tested Gram-positive bacteria, but only markedly increased permeability in B. subtilis. In contrast, EB3-C induced minimal depolarization and negligible permeabilization, supporting a non-lytic mechanism or one that does not involve lethal disruption of the membrane. Structure–function modeling indicates that EB-3 most likely lacks membrane selectivity due to its ability to adopt multiple non-specific conformations across Gram-positive membranes, including shallow insertion in B. subtilis, surface binding in E. hirae, and a carpet-like mechanism in S. epidermidis. EB3-C exhibits consistent, selective interactions via a short amphipathic helix and conserved R4/R6–phosphate contacts, with hydrophobic residues fine-tuning membrane anchoring, which explains its non-hemolytic, targeted antimicrobial activity. In contrast, removal of the phenylalanine residue in EB3a-C disrupts proper membrane engagement, leading to primarily surface-bound interactions and loss of antimicrobial function. These findings demonstrate that EB-3 is the core antimicrobial region of equinin B against Gram-positive bacteria, that substituting C with R preserves antimicrobial activity while reducing hemolysis, and that subtle structural changes can dramatically alter peptide–membrane interactions and biological activity.

Supplementary Materials

The following supporting information can be downloaded at the website of this paper posted on Preprints.org, Figure S1.1.-S1.20.: NMR spectra of prepared peptides EB derivatives; Figure S2.1. – S2.30. and Table S2.1. – S2.10: MS analysis of peptides EB derivatives.

Author Contributions

Conceptualization, A.J. and N.M.; methodology, A.J., N.M. M.S., T.S., J.T., L.P.and R.B. ; validation, R.B; formal analysis, R.B., M.S., T.S., J.T., L.P. and J.F.; investigation, M.S., T.S., J.T., M.R. and M.C.; resources, A.J.; data curation, A.J. and N.M..; writing—original draft preparation, A.J. and N.M.; writing—review and editing, A.J. and N.M.; visualization, M.S., T.S. and J.T.; supervision, A.J. and N.M.; project administration, A.J.; funding acquisition, A.J. All authors have read and agreed to the published version of the manuscript.

Funding

This paper was supported by Croatian Science Foundation, Project No. IP-2024-05-1216. The paper was supported in part by FWF grant, Grant-DOI 10.55776/P36985. This paper was supported in part by European Union NextGenerationEU, National Recovery and Resilience Plan’s project MetaPatvor (Grant number NPOO.C3.2.R3-I1.04.0122).

Institutional Review Board Statement

Not applicable.

Acknowledgments

We thank Henrik Strahl (University of Newcastle, UK) and Beate Leeb-Zatorska (Department of Infection Control and Hospital Epidemiology, Medical University of Vienna for kindly providing the bacterial strains used in this studies). We thank Dr. Mario Cindrić and Dr. Amela Hozić (Laboratory for Bioanalytics, Division of Molecular Medicine, RBI) for MS analysis. We also thank Dr. Ana Čikoš, Dr. Sunčica Roca and Mrs. Nikolina Višić (NMR Centre, IRB) for recording spectra and helping in NMR analysis.

Conflicts of Interest

The authors declare no conflicts of interest. The funders had no role in the design of the study; in the collection, analyses, or interpretation of data; in the writing of the manuscript; or in the decision to publish the results.

Abbreviations

The following abbreviations are used in this manuscript:
AR Antibiotic resistance
AMPs Antimicrobial peptides
HBTU N,N,N′,N′-Tetramethyl-O-(1H-benzotriazol-1-yl)uronium hexafluorophosphate
NMM N-methylmorpholine
TFA Trifluoroacetic acid
TIS Triisopropylsylane
SPE Solid Phase Extraction
SPPS Solid Phase Peptide Synthesis
MIC Minimum Inhibitory Concentration
PI Propidium iodide
MHB Mueller-Hinton Broth
DMSO Dimethyl sulfoxide
DMF Dimethylformamide

Appendix A

Table A1. List of selected precursor ions and their respective retention times (Rt) used in MS/MS analysis.
Table A1. List of selected precursor ions and their respective retention times (Rt) used in MS/MS analysis.
Peptide ID Peptide sequence Precursor m/z Rt/min
1 EB-1 GQCQRKCLGHCS [660.2925+2H]2+ 11.53
2 EB-2 KKCPKHPQCRK [676.8743+2H]2+ 09.17
3 EB-3 RCIRRCFGYCL [695.3392+2H]2+ 18.06
4 EB1a-K GQQRRCLGHCS [622.7909+2H]2+ 10.17
5 EB1-K GQCQRRCLGHCS [674.2955+2H]2+ 10.77
6 EB2-K RRCPRHPQCRR [732.8866+2H]2+ 09.17
7 EB1-C GQRQRKRLGHRS [739.9304+2H]2+ 09.76
8 EB2-K KKRPKHPQRRK [729.9662+2H]2+ 08.76
9 EB3-C RRIRRRFGYRL [774.9771+2H]2+ 09.07
10 EB3a-C RRIRRRGYRL [701.4429+2H]2+ 09.23

References

  1. Boman, H.G. Antibacterial Peptides: Basic Facts and Emerging Concepts. Journal of Internal Medicine 2003, 254, 197–215. [Google Scholar] [CrossRef]
  2. Huan, Y.; Kong, Q.; Mou, H.; Yi, H. Antimicrobial Peptides: Classification, Design, Application and Research Progress in Multiple Fields. Front. Microbiol. 2020, 11, 582779. [Google Scholar] [CrossRef]
  3. Steiner, H.; Hultmark, D.; Engström, Å.; Bennich, H.; Boman, H.G. Sequence and Specificity of Two Antibacterial Proteins Involved in Insect Immunity. Nature 1981, 292, 246–248. [Google Scholar] [CrossRef] [PubMed]
  4. Haug, B.; Strom, M.; M. Svendsen, J. The Medicinal Chemistry of Short Lactoferricin-Based Antibacterial Peptides. CMC 2007, 14, 1–18. [Google Scholar] [CrossRef] [PubMed]
  5. Gaspar, D.; Veiga, A.S.; Castanho, M.A.R.B. From Antimicrobial to Anticancer Peptides. A Review. Front. Microbiol. 2013, 4. [Google Scholar] [CrossRef] [PubMed]
  6. Brogden, N.K.; Brogden, K.A. Will New Generations of Modified Antimicrobial Peptides Improve Their Potential as Pharmaceuticals? International Journal of Antimicrobial Agents 2011, S0924857911002342. [Google Scholar] [CrossRef]
  7. Bocchinfuso, G.; Palleschi, A.; Orioni, B.; Grande, G.; Formaggio, F.; Toniolo, C.; Park, Y.; Hahm, K.; Stella, L. Different Mechanisms of Action of Antimicrobial Peptides: Insights from Fluorescence Spectroscopy Experiments and Molecular Dynamics Simulations. Journal of Peptide Science 2009, 15, 550–558. [Google Scholar] [CrossRef]
  8. Gerwick, W.H.; Moore, B.S. Lessons from the Past and Charting the Future of Marine Natural Products Drug Discovery and Chemical Biology. Chemistry & Biology 2012, 19, 85–98. [Google Scholar] [CrossRef]
  9. Wang, Y.-N.; Meng, L.-H.; Wang, B.-G. Progress in Research on Bioactive Secondary Metabolites from Deep-Sea Derived Microorganisms. Marine Drugs 2020, 18, 614. [Google Scholar] [CrossRef]
  10. Satpute, S.K.; Banat, I.M.; Dhakephalkar, P.K.; Banpurkar, A.G.; Chopade, B.A. Biosurfactants, Bioemulsifiers and Exopolysaccharides from Marine Microorganisms. Biotechnology Advances 2010, 28, 436–450. [Google Scholar] [CrossRef]
  11. Laport, M.; Santos, O.; Muricy, G. Marine Sponges: Potential Sources of New Antimicrobial Drugs. CPB 2009, 10, 86–105. [Google Scholar] [CrossRef]
  12. Macedo, M.W.F.S.; Cunha, N.B.D.; Carneiro, J.A.; Costa, R.A.D.; Alencar, S.A.D.; Cardoso, M.H.; Franco, O.L.; Dias, S.C. Marine Organisms as a Rich Source of Biologically Active Peptides. Front. Mar. Sci. 2021, 8, 667764. [Google Scholar] [CrossRef]
  13. La Corte, C.; Catania, V.; Dara, M.; Parrinello, D.; Staropoli, M.; Trapani, M.R.; Cammarata, M.; Parisi, M.G. Equinins as Novel Broad-Spectrum Antimicrobial Peptides Isolated from the Cnidarian Actinia Equina (Linnaeus, 1758). Marine Drugs 2024, 22, 172. [Google Scholar] [CrossRef] [PubMed]
  14. Ovchinnikova, T.V.; Balandin, S.V.; Aleshina, G.M.; Tagaev, A.A.; Leonova, Y.F.; Krasnodembsky, E.D.; Men’shenin, A.V.; Kokryakov, V.N. Aurelin, a Novel Antimicrobial Peptide from Jellyfish Aurelia Aurita with Structural Features of Defensins and Channel-Blocking Toxins. Biochemical and Biophysical Research Communications 2006, 348, 514–523. [Google Scholar] [CrossRef] [PubMed]
  15. Shenkarev, Z.O.; Panteleev, P.V.; Balandin, S.V.; Gizatullina, A.K.; Altukhov, D.A.; Finkina, E.I.; Kokryakov, V.N.; Arseniev, A.S.; Ovchinnikova, T.V. Recombinant Expression and Solution Structure of Antimicrobial Peptide Aurelin from Jellyfish Aurelia Aurita. Biochemical and Biophysical Research Communications 2012, 429, 63–69. [Google Scholar] [CrossRef]
  16. Huertas, N.; Monroy, Z.; Medina, R.; Castañeda, J. Antimicrobial Activity of Truncated and Polyvalent Peptides Derived from the FKCRRQWQWRMKKGLA Sequence against Escherichia Coli ATCC 25922 and Staphylococcus Aureus ATCC 25923. Molecules 2017, 22, 987. [Google Scholar] [CrossRef]
  17. Wang, G. The Antimicrobial Peptide Database Is 20 Years Old: Recent Developments and Future Directions. Protein Science 2023, 32, e4778. [Google Scholar] [CrossRef]
  18. Merrifield, R.B. Solid Phase Peptide Synthesis. I. The Synthesis of a Tetrapeptide. J. Am. Chem. Soc. 1963, 85, 2149–2154. [Google Scholar] [CrossRef]
  19. Guzmán, F.; Aróstica, M.; Román, T.; Beltrán, D.; Gauna, A.; Albericio, F.; Cárdenas, C. Peptides, Solid-Phase Synthesis and Characterization: Tailor-Made Methodologies. Electronic Journal of Biotechnology 2023, 64, 27–33. [Google Scholar] [CrossRef]
  20. Malanovic, N.; Lohner, K. Antimicrobial Peptides Targeting Gram-Positive Bacteria. Pharmaceuticals 2016, 9, 59. [Google Scholar] [CrossRef]
  21. Malanovic, N.; Lohner, K. Gram-Positive Bacterial Cell Envelopes: The Impact on the Activity of Antimicrobial Peptides. Biochimica et Biophysica Acta (BBA) - Biomembranes 2016, 1858, 936–946. [Google Scholar] [CrossRef]
  22. Abramson, J.; Adler, J.; Dunger, J.; Evans, R.; Green, T.; Pritzel, A.; Ronneberger, O.; Willmore, L.; Ballard, A.J.; Bambrick, J.; et al. Accurate Structure Prediction of Biomolecular Interactions with AlphaFold 3. Nature 2024, 630, 493–500. [Google Scholar] [CrossRef]
  23. Piller, P.; Wolinski, H.; Cordfunke, R.A.; Drijfhout, J.W.; Keller, S.; Lohner, K.; Malanovic, N. Membrane Activity of LL-37 Derived Antimicrobial Peptides against Enterococcus Hirae: Superiority of SAAP-148 over OP-145. Biomolecules 2022, 12, 523. [Google Scholar] [CrossRef]
  24. Meng, E.C.; Goddard, T.D.; Pettersen, E.F.; Couch, G.S.; Pearson, Z.J.; Morris, J.H.; Ferrin, T.E. UCSF ChimeraX : Tools for Structure Building and Analysis. Protein Science 2023, 32, e4792. [Google Scholar] [CrossRef]
  25. Thevenet, P.; Shen, Y.; Maupetit, J.; Guyon, F.; Derreumaux, P.; Tuffery, P. PEP-FOLD: An Updated de Novo Structure Prediction Server for Both Linear and Disulfide Bonded Cyclic Peptides. Nucleic Acids Research 2012, 40, W288–W293. [Google Scholar] [CrossRef]
  26. Beaufays, J.; Lins, L.; Thomas, A.; Brasseur, R. In Silico Predictions of 3D Structures of Linear and Cyclic Peptides with Natural and Non-proteinogenic Residues. Journal of Peptide Science 2012, 18, 17–24. [Google Scholar] [CrossRef] [PubMed]
  27. Snider, C.; Jayasinghe, S.; Hristova, K.; White, S.H. MPEx: A Tool for Exploring Membrane Proteins. Protein Science 2009, 18, 2624–2628. [Google Scholar] [CrossRef] [PubMed]
  28. White, S.H.; Wimley, W.C. MEMBRANE PROTEIN FOLDING AND STABILITY: Physical Principles. Annu. Rev. Biophys. Biomol. Struct. 1999, 28, 319–365. [Google Scholar] [CrossRef] [PubMed]
  29. Malanovic, N.; Marx, L.; Blondelle, S.E.; Pabst, G.; Semeraro, E.F. Experimental Concepts for Linking the Biological Activities of Antimicrobial Peptides to Their Molecular Modes of Action. Biochimica et Biophysica Acta (BBA) - Biomembranes 2020, 1862, 183275. [Google Scholar] [CrossRef]
Figure 1. Schematic representation of the design strategy.
Figure 1. Schematic representation of the design strategy.
Preprints 187232 g001
Figure 2. Hemolysis of peptides. Hemolytic activity of peptides was estimated in 2.5 % human erytrocytes derived from pooled whole human blood of at least 10 donors.
Figure 2. Hemolysis of peptides. Hemolytic activity of peptides was estimated in 2.5 % human erytrocytes derived from pooled whole human blood of at least 10 donors.
Preprints 187232 g002
Figure 3. Structural surface characteristics of the conformational assemblies of peptides A) AlphaFold pedictions of secondary structure exposing charged (blue) and hydrophobic regions (beige). B) AlphaFold predictions illustrating the folding topology. C) PepFold predictions illustrating the folding topology.
Figure 3. Structural surface characteristics of the conformational assemblies of peptides A) AlphaFold pedictions of secondary structure exposing charged (blue) and hydrophobic regions (beige). B) AlphaFold predictions illustrating the folding topology. C) PepFold predictions illustrating the folding topology.
Preprints 187232 g003
Figure 4. Impact on the Membrane Integrity by EB peptides. A) Bacterial growth, B) membrane permeability and C) Membrane depolarization of B. subtilis, E. hirae and S. epidermidis exposed to EB-3 and EB3-C. Data of A) and B) are mean results of three independent experiments performed in duplicates. Data of C) are mean results of two independent experiments performed in duplicates.
Figure 4. Impact on the Membrane Integrity by EB peptides. A) Bacterial growth, B) membrane permeability and C) Membrane depolarization of B. subtilis, E. hirae and S. epidermidis exposed to EB-3 and EB3-C. Data of A) and B) are mean results of three independent experiments performed in duplicates. Data of C) are mean results of two independent experiments performed in duplicates.
Preprints 187232 g004
Figure 5. Prediction models of EB-3, EB3-C and EB3a-C interacting with membranes mimicking B. subtilis, E. hirae and S. epidermidis cytoplasmic membranes.
Figure 5. Prediction models of EB-3, EB3-C and EB3a-C interacting with membranes mimicking B. subtilis, E. hirae and S. epidermidis cytoplasmic membranes.
Preprints 187232 g005
Table 1. Antimicrobial activity of compounds against E.coli and S.epidermidis.
Table 1. Antimicrobial activity of compounds against E.coli and S.epidermidis.
Compound Sequence Escherichia coli Staphylococcus epidermidis
MIC90/µgmL-1 MIC90/µgmL-1
EB-1 GQCQRKCLGHCS >100 >100
EB-2 KKCPKHPQCRK >100 >100
EB-3 RCIRRCFGYCL 100 25
EB1a-K GQQRRCLGHCS >100 >100
EB-1K GQCQRRCLGHCS >100 >100
EB-2K RRCPRHPQCRR >100 >100
EB1-C GQRQRKRLGHRS >100 >100
EB2-C KKRPKHPQRRK >100 >100
EB3a1-C RRIRRRFGYRL >100 >100
EB3-C RRIRRRFGYRL >100 25-50
EB3a-C RRIRRRGYRL >100 >100
Table 2. Starting resins with first anchored amino acids and final peptides obtained with SPPS.
Table 2. Starting resins with first anchored amino acids and final peptides obtained with SPPS.
Starting resin for SPPS Final peptide*
Preprints 187232 i011 Preprints 187232 i001
Preprints 187232 i002
Preprints 187232 i003
Preprints 187232 i004
Preprints 187232 i012 Preprints 187232 i005
Preprints 187232 i006
Preprints 187232 i013 Preprints 187232 i007
Preprints 187232 i014 Preprints 187232 i008
Preprints 187232 i009
Preprints 187232 i010
*The amino acids in the truncated peptides where changes were made to the original equinin B sequence are colored differently from the other amino acids. In the derivatives, the new amino acids (Arg) are shown in black. The changes are made to Lys (red) and Cys (green), which are substituted with Arg, or some amino acids are simply removed (Cys in EB1a-K, Phe (blue) in EB3a-C).
Table 3. Presentation of the difference in Gibbs energies and the moment of hydration for the prepared peptides, Wimley–White partitioning parameters (amphipathicity = hydrophobic moment, µ; ∆GW-OCT, free energy transfer from water to bilayer).
Table 3. Presentation of the difference in Gibbs energies and the moment of hydration for the prepared peptides, Wimley–White partitioning parameters (amphipathicity = hydrophobic moment, µ; ∆GW-OCT, free energy transfer from water to bilayer).
Compound ΔG Total Hydr. Moment
EB-1 9.93 5.3
EB-2 16.35 4.48
EB-3 1.73 6.97
EB1a-K 16.86 5.47
EB1-K 16.84 4.42
EB2-K 20.29 2.17
EB1-C 15.42 4.59
EB2-C 20.01 4.01
EB3-C 7.22 5.58
EB3a-C 8.93 5.47
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
Copyright: This open access article is published under a Creative Commons CC BY 4.0 license, which permit the free download, distribution, and reuse, provided that the author and preprint are cited in any reuse.