Submitted:
16 April 2025
Posted:
17 April 2025
You are already at the latest version
Abstract
Keywords:
1. Introduction
2. Discovery
3. Structural Domain and Functions
4. CYR61 Interactome
4.1. Integrin α6β1
4.2. Integrin αvβ3
4.3. Integrin αvβ5
4.3. Integrin αIIbβ3
5. CYR61 Roles in Cancer
| Ligand | Binding domain | Associated cancers |
| α6β1 | TSR, CT | Breast, ovarian, lung, lung metastasis, prostate |
| αvβ3 | vWC | Bone metastasis, breast, cervical, colon, melanoma, non-small cell lung, ovarian, glioblastoma, prostate, and pancreatic. |
| αvβ5 | vWC | Breast, colorectal, gastric, liver metastasis, ovarian, glioblastoma, pancreatic, and prostate. |
| αIIbβ3 | vWC | Breast, ovarian, and prostate. |
6. CYR61 in Liquid Biopsies
7. CYR61 as a Potential Target in Cancer
8. Challenges
9. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
Abbreviations
| CAR-T | Chimeric Antigen Receptor T cells |
| CCN | Cysteine-Rich Protein, Connective Tissue Growth Factor, Nephroblastoma |
| CT | C-Terminal |
| CTGF | Connective Tissue Growth Factor |
| CYR61 | Cysteine-Rich 61 |
| ECM | Extracellular Matrix |
| HRG | Heregulin |
| HSPG | Heparan Sulfate Proteoglycan |
| hUCMSC | Human Umbilical Mesenchymal Stromal Cells |
| IGFBP | Insulin-like Growth Factor Binding Protein |
| mDTC | mesenchymal Disseminated Tumor Cell |
| NOV | Nephroblastoma |
| RGD | Arginine, Glycine, Aspartic Acid |
| ROS | Reactive Oxygen Species |
| TSR | Thrombospondin Type 1 Repeat |
| VEGF | Vascular Endothelial Growth Factor |
| vWC | von Willebrand Factor Type C Domain |
References
- Kireeva ML, Mo FE, Yang GP, Lau LF: Cyr61, a product of a growth factor-inducible immediate-early gene, promotes cell proliferation, migration, and adhesion. Mol Cell Biol 1996, 16(4):1326-1334. [CrossRef]
- Bork P: The modular architecture of a new family of growth regulators related to connective tissue growth factor. FEBS Lett 1993, 327(2):125-130.
- O'Brien TP, Yang GP, Sanders L, Lau LF: Expression of cyr61, a growth factor-inducible immediate-early gene. Mol Cell Biol 1990, 10(7):3569-3577.
- Wong M, Kireeva ML, Kolesnikova TV, Lau LF: Cyr61, product of a growth factor-inducible immediate-early gene, regulates chondrogenesis in mouse limb bud mesenchymal cells. Dev Biol 1997, 192(2):492-508. [CrossRef]
- Grzeszkiewicz TM, Lindner V, Chen N, Lam SC, Lau LF: The angiogenic factor cysteine-rich 61 (CYR61, CCN1) supports vascular smooth muscle cell adhesion and stimulates chemotaxis through integrin alpha(6)beta(1) and cell surface heparan sulfate proteoglycans. Endocrinology 2002, 143(4):1441-1450.
- Yang GP, Lau LF: Cyr61, product of a growth factor-inducible immediate early gene, is associated with the extracellular matrix and the cell surface. Cell Growth Differ 1991, 2(7):351-357.
- Babic AM, Kireeva ML, Kolesnikova TV, Lau LF: CYR61, a product of a growth factor-inducible immediate early gene, promotes angiogenesis and tumor growth. Proc Natl Acad Sci U S A 1998, 95(11):6355-6360. [CrossRef]
- Tsai MS, Bogart DF, Castaneda JM, Li P, Lupu R: Cyr61 promotes breast tumorigenesis and cancer progression. Oncogene 2002, 21(53):8178-8185.
- Chen CC, Lau LF: Functions and mechanisms of action of CCN matricellular proteins. Int J Biochem Cell Biol 2009, 41(4):771-783.
- Huang YT, Lan Q, Lorusso G, Duffey N, Ruegg C: The matricellular protein CYR61 promotes breast cancer lung metastasis by facilitating tumor cell extravasation and suppressing anoikis. Oncotarget 2017, 8(6):9200-9215.
- Jandova J, Beyer TE, Meuillet EJ, Watts GS: The matrix protein CCN1/CYR61 is required for alpha(V)beta5-mediated cancer cell migration. Cell Biochem Funct 2012, 30(8):687-695.
- Terada N, Kulkarni P, Getzenberg RH: Cyr61 is a potential prognostic marker for prostate cancer. Asian J Androl 2012, 14(3):405-408.
- Desgrosellier JS, Barnes LA, Shields DJ, Huang M, Lau SK, Prevost N, Tarin D, Shattil SJ, Cheresh DA: An integrin alpha(v)beta(3)-c-Src oncogenic unit promotes anchorage-independence and tumor progression. Nat Med 2009, 15(10):1163-1169.
- Tong X, Xie D, O'Kelly J, Miller CW, Muller-Tidow C, Koeffler HP: Cyr61, a member of CCN family, is a tumor suppressor in non-small cell lung cancer. J Biol Chem 2001, 276(50):47709-47714.
- Gu Y, Dong B, He X, Qiu Z, Zhang J, Zhang M, Liu H, Pang X, Cui Y: The challenges and opportunities of alphavbeta3-based therapeutics in cancer: From bench to clinical trials. Pharmacol Res 2023, 189:106694.
- Jun JI, Lau LF: Taking aim at the extracellular matrix: CCN proteins as emerging therapeutic targets. Nat Rev Drug Discov 2011, 10(12):945-963.
- Rachfal AW, Brigstock DR: Structural and functional properties of CCN proteins. Vitam Horm 2005, 70:69-103.
- Kireeva ML, Latinkic BV, Kolesnikova TV, Chen CC, Yang GP, Abler AS, Lau LF: Cyr61 and Fisp12 are both ECM-associated signaling molecules: activities, metabolism, and localization during development. Exp Cell Res 1997, 233(1):63-77.
- Chen N, Chen CC, Lau LF: Adhesion of human skin fibroblasts to Cyr61 is mediated through integrin alpha 6beta 1 and cell surface heparan sulfate proteoglycans. J Biol Chem 2000, 275(32):24953-24961.
- O'Brien TP, Lau LF: Expression of the growth factor-inducible immediate early gene cyr61 correlates with chondrogenesis during mouse embryonic development. Cell Growth Differ 1992, 3(9):645-654.
- Brigstock DR: The connective tissue growth factor/cysteine-rich 61/nephroblastoma overexpressed (CCN) family. Endocr Rev 1999, 20(2):189-206.
- Perbal B: CCN proteins: multifunctional signalling regulators. Lancet 2004, 363(9402):62-64.
- Mo FE, Muntean AG, Chen CC, Stolz DB, Watkins SC, Lau LF: CYR61 (CCN1) is essential for placental development and vascular integrity. Mol Cell Biol 2002, 22(24):8709-8720.
- Emre Y, Imhof BA: Matricellular protein CCN1/CYR61: a new player in inflammation and leukocyte trafficking. Semin Immunopathol 2014, 36(2):253-259.
- Lau LF: CCN1/CYR61: the very model of a modern matricellular protein. Cell Mol Life Sci 2011, 68(19):3149-3163.
- Martinerie C, Viegas-Pequignot E, Nguyen VC, Perbal B: Chromosomal mapping and expression of the human cyr61 gene in tumour cells from the nervous system. Mol Pathol 1997, 50(6):310-316. [CrossRef]
- Jay P, Berge-Lefranc JL, Marsollier C, Mejean C, Taviaux S, Berta P: The human growth factor-inducible immediate early gene, CYR61, maps to chromosome 1p. Oncogene 1997, 14(14):1753-1757.
- Yang R, Chen Y, Chen D: Biological functions and role of CCN1/Cyr61 in embryogenesis and tumorigenesis in the female reproductive system (Review). Mol Med Rep 2018, 17(1):3-10.
- Planque N, Perbal B: A structural approach to the role of CCN (CYR61/CTGF/NOV) proteins in tumourigenesis. Cancer Cell Int 2003, 3(1):15. [CrossRef]
- Holbourn KP, Acharya KR, Perbal B: The CCN family of proteins: structure-function relationships. Trends Biochem Sci 2008, 33(10):461-473.
- Grzeszkiewicz TM, Kirschling DJ, Chen N, Lau LF: CYR61 stimulates human skin fibroblast migration through Integrin alpha vbeta 5 and enhances mitogenesis through integrin alpha vbeta 3, independent of its carboxyl-terminal domain. J Biol Chem 2001, 276(24):21943-21950.
- Heng EC, Huang Y, Black SA, Jr., Trackman PC: CCN2, connective tissue growth factor, stimulates collagen deposition by gingival fibroblasts via module 3 and alpha6- and beta1 integrins. J Cell Biochem 2006, 98(2):409-420.
- Kireeva ML, Lam SC, Lau LF: Adhesion of human umbilical vein endothelial cells to the immediate-early gene product Cyr61 is mediated through integrin alphavbeta3. J Biol Chem 1998, 273(5):3090-3096.
- Schober JM, Chen N, Grzeszkiewicz TM, Jovanovic I, Emeson EE, Ugarova TP, Ye RD, Lau LF, Lam SC: Identification of integrin alpha(M)beta(2) as an adhesion receptor on peripheral blood monocytes for Cyr61 (CCN1) and connective tissue growth factor (CCN2): immediate-early gene products expressed in atherosclerotic lesions. Blood 2002, 99(12):4457-4465.
- Jedsadayanmata A, Chen CC, Kireeva ML, Lau LF, Lam SC: Activation-dependent adhesion of human platelets to Cyr61 and Fisp12/mouse connective tissue growth factor is mediated through integrin alpha(IIb)beta(3). J Biol Chem 1999, 274(34):24321-24327.
- Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, Miller W, Lipman DJ: Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res 1997, 25(17):3389-3402.
- Kalus W, Zweckstetter M, Renner C, Sanchez Y, Georgescu J, Grol M, Demuth D, Schumacher R, Dony C, Lang K et al: Structure of the IGF-binding domain of the insulin-like growth factor-binding protein-5 (IGFBP-5): implications for IGF and IGF-I receptor interactions. EMBO J 1998, 17(22):6558-6572.
- Xu ER, Blythe EE, Fischer G, Hyvonen M: Structural analyses of von Willebrand factor C domains of collagen 2A and CCN3 reveal an alternative mode of binding to bone morphogenetic protein-2. J Biol Chem 2017, 292(30):12516-12527.
- Tan K, Duquette M, Liu JH, Dong Y, Zhang R, Joachimiak A, Lawler J, Wang JH: Crystal structure of the TSP-1 type 1 repeats: a novel layered fold and its biological implication. J Cell Biol 2002, 159(2):373-382.
- Leu SJ, Chen N, Chen CC, Todorovic V, Bai T, Juric V, Liu Y, Yan G, Lam SC, Lau LF: Targeted mutagenesis of the angiogenic protein CCN1 (CYR61). Selective inactivation of integrin alpha6beta1-heparan sulfate proteoglycan coreceptor-mediated cellular functions. J Biol Chem 2004, 279(42):44177-44187.
- Lv H, Fan E, Sun S, Ma X, Zhang X, Han DM, Cong YS: Cyr61 is up-regulated in prostate cancer and associated with the p53 gene status. J Cell Biochem 2009, 106(4):738-744.
- Mammadova-Bach E, Zigrino P, Brucker C, Bourdon C, Freund M, De Arcangelis A, Abrams SI, Orend G, Gachet C, Mangin PH: Platelet integrin alpha6beta1 controls lung metastasis through direct binding to cancer cell-derived ADAM9. JCI Insight 2016, 1(14):e88245.
- Leu SJ, Lam SC, Lau LF: Pro-angiogenic activities of CYR61 (CCN1) mediated through integrins alphavbeta3 and alpha6beta1 in human umbilical vein endothelial cells. J Biol Chem 2002, 277(48):46248-46255.
- Chen N, Leu SJ, Todorovic V, Lam SC, Lau LF: Identification of a novel integrin alphavbeta3 binding site in CCN1 (CYR61) critical for pro-angiogenic activities in vascular endothelial cells. J Biol Chem 2004, 279(42):44166-44176.
- Gu Y, Du Y, Jiang L, Tang X, Li A, Zhao Y, Lang Y, Liu X, Liu J: alphavbeta3 integrin-specific exosomes engineered with cyclopeptide for targeted delivery of triptolide against malignant melanoma. J Nanobiotechnology 2022, 20(1):384.
- Chen CC, Young JL, Monzon RI, Chen N, Todorovic V, Lau LF: Cytotoxicity of TNFalpha is regulated by integrin-mediated matrix signaling. EMBO J 2007, 26(5):1257-1267.
- Bougie DW, Rasmussen M, Zhu J, Aster RH: Antibodies causing thrombocytopenia in patients treated with RGD-mimetic platelet inhibitors recognize ligand-specific conformers of alphaIIb/beta3 integrin. Blood 2012, 119(26):6317-6325.
- Adair BD, Alonso JL, van Agthoven J, Hayes V, Ahn HS, Yu IS, Lin SW, Xiong JP, Poncz M, Arnaout MA: Structure-guided design of pure orthosteric inhibitors of alphaIIbbeta3 that prevent thrombosis but preserve hemostasis. Nat Commun 2020, 11(1):398.
- Kardeh S, Ashkani-Esfahani S, Alizadeh AM: Paradoxical action of reactive oxygen species in creation and therapy of cancer. Eur J Pharmacol 2014, 735:150-168.
- Chen CC, Kim KH, Lau LF: The matricellular protein CCN1 suppresses hepatocarcinogenesis by inhibiting compensatory proliferation. Oncogene 2016, 35(10):1314-1323.
- Zhang H, Li W, Huang P, Lin L, Ye H, Lin D, Koeffler HP, Wang J, Yin D: Expression of CCN family members correlates with the clinical features of hepatocellular carcinoma. Oncol Rep 2015, 33(3):1481-1492. [CrossRef]
- Kim KH, Chen CC, Monzon RI, Lau LF: Matricellular protein CCN1 promotes regression of liver fibrosis through induction of cellular senescence in hepatic myofibroblasts. Mol Cell Biol 2013, 33(10):2078-2090. [CrossRef]
- Chien W, Kumagai T, Miller CW, Desmond JC, Frank JM, Said JW, Koeffler HP: Cyr61 suppresses growth of human endometrial cancer cells. J Biol Chem 2004, 279(51):53087-53096.
- Lorusso G, Ruegg C: The tumor microenvironment and its contribution to tumor evolution toward metastasis. Histochem Cell Biol 2008, 130(6):1091-1103.
- Juric V, Chen CC, Lau LF: Fas-mediated apoptosis is regulated by the extracellular matrix protein CCN1 (CYR61) in vitro and in vivo. Mol Cell Biol 2009, 29(12):3266-3279.
- Huang YT, Lan Q, Ponsonnet L, Blanquet M, Christofori G, Zaric J, Ruegg C: The matricellular protein CYR61 interferes with normal pancreatic islets architecture and promotes pancreatic neuroendocrine tumor progression. Oncotarget 2016, 7(2):1663-1674.
- Espinoza I, Kurapaty C, Park CH, Vander Steen T, Kleer CG, Wiley E, Rademaker A, Cuyas E, Verdura S, Buxo M et al: Depletion of CCN1/CYR61 reduces triple-negative/basal-like breast cancer aggressiveness. Am J Cancer Res 2022, 12(2):839-851.
- Todorovic V, Chen CC, Hay N, Lau LF: The matrix protein CCN1 (CYR61) induces apoptosis in fibroblasts. J Cell Biol 2005, 171(3):559-568.
- Lee KB, Byun HJ, Park SH, Park CY, Lee SH, Rho SB: CYR61 controls p53 and NF-kappaB expression through PI3K/Akt/mTOR pathways in carboplatin-induced ovarian cancer cells. Cancer Lett 2012, 315(1):86-95.
- Gasparini G, Brooks PC, Biganzoli E, Vermeulen PB, Bonoldi E, Dirix LY, Ranieri G, Miceli R, Cheresh DA: Vascular integrin alpha(v)beta3: a new prognostic indicator in breast cancer. Clin Cancer Res 1998, 4(11):2625-2634.
- Sampath D, Winneker RC, Zhang Z: The angiogenic factor Cyr61 is induced by the progestin R5020 and is necessary for mammary adenocarcinoma cell growth. Endocrine 2002, 18(2):147-159.
- D'Antonio KB, Schultz L, Albadine R, Mondul AM, Platz EA, Netto GJ, Getzenberg RH: Decreased expression of Cyr61 is associated with prostate cancer recurrence after surgical treatment. Clin Cancer Res 2010, 16(23):5908-5913.
- Marra M, Santini D, Meo G, Vincenzi B, Zappavigna S, Baldi A, Rosolowski M, Tonini G, Loeffler M, Lupu R et al: Cyr61 downmodulation potentiates the anticancer effects of zoledronic acid in androgen-independent prostate cancer cells. Int J Cancer 2009, 125(9):2004-2013.
- Franzen CA, Chen CC, Todorovic V, Juric V, Monzon RI, Lau LF: Matrix protein CCN1 is critical for prostate carcinoma cell proliferation and TRAIL-induced apoptosis. Mol Cancer Res 2009, 7(7):1045-1055.
- Lin CM, Liang CZ: Cyr61: a potential therapeutic target for prostate cancer. Asian J Androl 2014, 16(5):788-789.
- Pilarsky CP, Schmidt U, Eissrich C, Stade J, Froschermaier SE, Haase M, Faller G, Kirchner TW, Wirth MP: Expression of the extracellular matrix signaling molecule Cyr61 is downregulated in prostate cancer. Prostate 1998, 36(2):85-91.
- Lin Y, Xu T, Tian G, Cui M: Cysteine-rich, angiogenic inducer, 61 expression in patients with ovarian epithelial carcinoma. J Int Med Res 2014, 42(2):300-306.
- Han S, Bui NT, Ho MT, Kim YM, Cho M, Shin DB: Dexamethasone Inhibits TGF-beta1-Induced Cell Migration by Regulating the ERK and AKT Pathways in Human Colon Cancer Cells Via CYR61. Cancer Res Treat 2016, 48(3):1141-1153.
- Jeong D, Heo S, Sung Ahn T, Lee S, Park S, Kim H, Park D, Byung Bae S, Lee SS, Soo Lee M et al: Cyr61 expression is associated with prognosis in patients with colorectal cancer. BMC Cancer 2014, 14:164.
- Song YF, Xu ZB, Zhu XJ, Tao X, Liu JL, Gao FL, Wu CL, Song B, Lin Q: Serum Cyr61 as a potential biomarker for diagnosis of colorectal cancer. Clin Transl Oncol 2017, 19(4):519-524.
- Chen PC, Cheng HC, Yang SF, Lin CW, Tang CH: The CCN family proteins: modulators of bone development and novel targets in bone-associated tumors. Biomed Res Int 2014, 2014:437096.
- Lin Z, Song Y, Qiu Y, Shi P, Zeng M, Cao Y, Zhu X: Serum CYR61 as a potential biomarker to improve breast cancer diagnostics. Biomark Med 2022, 16(15):1121-1128.
- Bartkowiak K, Heidrich I, Kwiatkowski M, Gorges TM, Andreas A, Geffken M, Verpoort K, Muller V, Schluter H, Pantel K: Cysteine-Rich Angiogenic Inducer 61: Pro-Survival Function and Role as a Biomarker for Disseminating Breast Cancer Cells. Cancers (Basel) 2021, 13(3).
- Schmitz P, Gerber U, Jungel E, Schutze N, Blaheta R, Bendas G: Cyr61/CCN1 affects the integrin-mediated migration of prostate cancer cells (PC-3) in vitro. Int J Clin Pharmacol Ther 2013, 51(1):47-50.
- Van Agthoven JF, Xiong JP, Alonso JL, Rui X, Adair BD, Goodman SL, Arnaout MA: Structural basis for pure antagonism of integrin alphaVbeta3 by a high-affinity form of fibronectin. Nat Struct Mol Biol 2014, 21(4):383-388.
- Menendez JA, Mehmi I, Griggs DW, Lupu R: The angiogenic factor CYR61 in breast cancer: molecular pathology and therapeutic perspectives. Endocr Relat Cancer 2003, 10(2):141-152.
- Pang X, He X, Qiu Z, Zhang H, Xie R, Liu Z, Gu Y, Zhao N, Xiang Q, Cui Y: Targeting integrin pathways: mechanisms and advances in therapy. Signal Transduct Target Ther 2023, 8(1):1.
- Sheldrake HM, Patterson LH: Strategies to inhibit tumor associated integrin receptors: rationale for dual and multi-antagonists. J Med Chem 2014, 57(15):6301-6315.
- Wallstabe L, Mades A, Frenz S, Einsele H, Rader C, Hudecek M: CAR T cells targeting alpha(v)beta(3) integrin are effective against advanced cancer in preclinical models. Adv Cell Gene Ther 2018, 1(2).
- Harris LG, Pannell LK, Singh S, Samant RS, Shevde LA: Increased vascularity and spontaneous metastasis of breast cancer by hedgehog signaling mediated upregulation of cyr61. Oncogene 2012, 31(28):3370-3380. [CrossRef]

| Domain | Conserved Sequence | Binding Sites | Ribbon Diagram |
|---|---|---|---|
| Insulin-like Growth Factor Binding Protein (IGFBP) | CPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQLNEDCSKTQPCDHTKGLEC | Insulin-like growth factor binding proteins | ![]() |
| von Willebrand Factor type-C repeat (vWC) | CEYNSRIYQNGESFQPNCKHQCTCIDGAVGCIPLCPQESLPNLGCPNPRLVKVTGQCCE | αvβ3 αvβ5 αIIbβ3 |
|
| Thrombospondin type-1 repeat (TSR) | CIVQTTSWSQCSKTCGTGISTRVTNDNPECRLVKETRICEVRPC | α6β1 | ![]() |
| C-terminal (CT) | PEPVRFTYAGCLSVKKYRPKYCGSCVDGRCCTPQLTRTVKMRFRCEDGETFSKNVMMIQSCKCNYNCPHANEAAFPFYRLFND | αvβ3, α6β1-HSPG: H1, α6β1-HSPG:H2 | ![]() |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2025 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).



