Preprint
Review

This version is not peer-reviewed.

Targeting Plasmodium Population Bottlenecks with Parasite Ligands as Vaccine Antigens

A peer-reviewed version of this preprint was published in:
Vaccines 2024, 12(5), 484. https://doi.org/10.3390/vaccines12050484

Submitted:

11 April 2024

Posted:

11 April 2024

You are already at the latest version

Abstract
WHO reported an estimated 249 million malaria cases and 608,000 malaria deaths in 85 countries in 2022. A total of 94% of malaria deaths occurred in Africa, 80 % of which were children under 5. In other words, one child dies every minute from malaria. The RTS,S/AS01 malaria vaccine, that uses the Plasmodium falciparum circumsporozoite protein (CSP) to target sporozoite infection of the liver, achieved modest efficacy. The Malaria Vaccine Implementation Program (MVIP), coordinated by the WHO and completed at the end of 2023, found that immunization reduced mortality by only 13%. To further reduce malaria death, development of a more effective malaria vaccine is a high priority. Three major malaria vaccine targets being considered are the level of sporozoite liver infection, merozoite red blood cell (RBC) infection, and mosquito midgut infection. These targets involve specific ligand-receptor interactions. However, current malaria vaccine candidates that target two major parasite population bottlenecks, liver infection and mosquito midgut infection, do not focus on such parasite ligands. Here we evaluate the potential of newly identified parasite ligands as novel malaria vaccine antigens.
Keywords: 
;  ;  ;  

1. Introduction

Malaria is the deadliest known vector born infectious disease. Malaria can be controlled by killing of mosquitoes with insecticides, drug treatment of patients, and vaccination of humans. Although insecticides and drugs have reduced malaria death, this approach is facing difficulties due to selection of resistant mosquitoes and parasites. Moreover, an effective malaria vaccine is yet to be implemented. The malaria parasite has a complex life cycle with multiple stages in the mosquito and in humans, each step involving specific host cell recognition. Therefore, targeting the [parasite ligand-host cell receptor] pair is a prime goal of malaria vaccine development.
Human infection starts with the release of ~50 sporozoites into the human skin by the bite of an infected Anopheles mosquito [1,2]. Sporozoites enter the blood circulation and move to the first target organ, the liver. Circulating sporozoites are retained by the liver via electrostatic interaction between the positively charged CSP protein that covers the sporozoite surface and the negatively charged glycosaminoglycans (GAGs) produced by Stellate cells in the liver parenchyma and protruded through the fenestrations of the liver sinusoidal (blood vessel) lining [3]. Next, sporozoites traverse the liver sinusoidal lining by invading macrophage-like Kupffer cells or endothelial cells [4,5], followed by an invasion of a hepatocyte to establish a productive infection. Although only a few sporozoites reach their destination, each infected liver cell generates around 30,000 hepatic merozoites that are released into the blood circulation, where they proliferate and cause pathogenesis [2,6]. Sporozoite liver infection constitutes the most dramatic malaria parasite population bottleneck and has been a focus of malaria vaccine development. The most advanced malaria vaccine RTS,S/AS01 targets the sporozoite CSP to interfere with liver infection [7,8]. Malaria vaccines that target liver infection (before RBC infection) are called pre-erythrocytic vaccines (PEV), and vaccines that target asexual blood-stage parasite antigens, mainly on the merozoites surface, are called blood-stage vaccines (BSV). Since the blood stage starts with the release of large number of hepatic merozoites, followed by quick (30~70 seconds) invasion of RBCs utilizing redundant ligand-receptor pairs [9], development of blood-stage vaccines is more challenging. Indeed, no sterile protection has been reported from human BSV trials [7]. In addition to liver infection, another parasite population bottleneck occurs at the initial stages of mosquito infection [10,11]. In an infected human, less than 5 % of Plasmodium blood-stage parasites are committed to develop into sexual stage gametocytes [12], the only form that can survive in the mosquito. In the blood bolus, male and female gametocytes are rapidly activated into gametes. One male gametocyte generates eight microgametes after three rounds of DNA replication. Microgametes actively move in search of activated female macrogametes for fertilization and formation of zygotes. Zygotes differentiate into motile ookinetes that move in the blood bolus and invade the mosquito midgut to form oocysts lodged between the midgut epithelium and the basal lamina. Each oocyst generates thousands of sporozoites that when released, invade the mosquito salivary glands from where they are transmitted to a new human host. Out of thousands of ingested gametocytes, only few oocysts form [11], defining a strong bottleneck.
Transition through bottlenecks involves specific cell-cell recognition steps. For liver infection, sporozoites specifically interact with the phagocytic Kupffer cells that line the sinusoids to exit the circulation and then specifically infect hepatocytes, and no other cell type. In the mosquito, fertilization requires specific recognition between male and female gametes and ookinete traversal involves its recognition of mosquito midgut epithelium receptors. Using a phage-peptide display approach, [parasite ligand-host cell receptor] pairs involved in these parasite bottlenecks have been identified [13,14,15,16]. Interestingly, many of the parasite surface ligands are conserved moonlighting proteins that have acquired separate ligand functions. This review provides an overview of these parasite ligands and evaluates their potential for development of novel malaria vaccine antigens.

2. Pre-Erythrocytic Plasmodium Ligands

Plasmodium sporozoites interact with Kupffer cells to leave the circulation and enter the liver parenchyma [4]. Sporozoite surface glyceraldehyde 3-phosphate dehydrogenase (GAPDH) was identified as a ligand for Kupffer cell traversal [15]. In the liver parenchyma, sporozoites specifically infect hepatocytes using the phospholipid scramblase (PLSCR) protein as a ligand [14].

2.1. Sporozoite Exit from the Circulation

A phage peptide-display library that displays 12 amino acid random peptides fused to the coat protein pVIII of the M13 filamentous phage was screened against a primary rat Kupffer cell culture [17]. The selected Kupffer cell-binding P39 peptide (DCAIVYAYDPCL) competitively inhibited sporozoite-Kupffer cell interaction. This suggested that the P39 peptide binds to a Kupffer cell receptor for sporozoite interaction. Far-Western blotting using the P39 peptide as a probe and mass spectrometry assays identified the Kupffer cell CD68 protein as the P39 peptide binding target. Confirming this finding, sporozoite liver infection is significantly reduced in CD68KO mice [18]. These findings suggested that P39 is a structural mimic of a sporozoite ligand for CD68 interaction. To test this hypothesis, antibodies against the P39 peptide were generated. These antibodies bound to a ~ 40 kDa sporozoite surface molecule [15]. Immunoprecipitation and mass spectrometry assays identified the ~40 kDa sporozoite surface protein Plasmodium GAPDH as a ligand for CD68 interaction. Follow up studies found that anti-P39 antibodies bind to two epitopes in the GAPDH C-terminal end and antibodies against these epitopes inhibited sporozoite liver infection [19].
The canonical role of GAPDH is to facilitate the conversion of glyceraldehyde-3-phosphate into 1-3 di-phosphoglycerate during glycolysis [20]. Although GAPDH acts as a quintessential housekeeping protein for cell energy production across many species, research identified GAPDH as a moonlighting protein whose function extends well beyond its traditional role in glycolysis. GAPDH is involved in DNA repair, gene expression control, cell signaling, and interaction with other molecules such as RNA and protein. Furthermore, diverse infectious microbes expose GAPDH onto their surface and utilize it for attachment to host cell protein, extracellular matrix degradation, modification of cell signaling, immune evasion, and virulence factor [20,21,22]. These properties have spotlighted GAPDH as a vaccine target for bacterial and parasitic diseases. For instance, immunization with recombinant GAPDH of Erysipelothrix rhusiopathiae, the causative agent of animal erysipelas and human erysipeloid, elicited sterile protection in a mouse model [23]. Immunization with recombinant GAPDH of Streptococcus dysgalactiae, a bacterial pathogen causing intramammary infections in dairy bovines, improved the survival rates and decreased the bacterial burdens in the mammary glands in immunized mice [24]. Conserved GAPDH peptides among multiple pathogens have been explored for a universal vaccine antigen that target Listeria monocytogenes, Mycobacterium marinum and Streptococcus pneumoniae [25,26]. On the other hand, predicted GAPDH B-cell epitopes and pyruvate dehydrogenase E1 subunit alpha in Streptococcus iniae, a bacterial flounder pathogen, were fused for a multiple epitope vaccine antigen, which increased survival rate in immunized animals compared to single antigen immunized animals [27]. Multiple epitope vaccine using Schistosoma mansoni GAPDH and Sm10-DLC (a 10-kDa dynein light chain protein) peptides showed protection in a mouse model [27]. The challenge however, lies in distinguishing between the host and pathogen GAPDH proteins to avoid potential autoimmune reactions, necessitating the identification of protective epitopes unique to the pathogen protein.
Two major requirements of potential vaccine antigens are 1) to contain the sequence located within the ligand region that interacts with the target receptor and 2) to have low genetic polymorphism. GAPDH genes among human-infecting Plasmodium species are well conserved at the level of 87% identity [15]. However, Plasmodium GAPDH identity with its human counterpart is lower, at the level of 64 % identity (Table 1). Genetic polymorphism is low, only one non-synonymous single nucleotide polymorphism (NS-SNP) having been identified out of 275 P. falciparum strains (Table 1). There are nine parasite-specific GAPDH peptides that are well conserved among Plasmodium species and divergent from mammalian orthologues [15]. Interestingly, two Plasmodium-specific GAPDH peptides were identified as epitopes for Kupffer cell interaction [19]. Antibodies against these epitope peptides do not cross-react with the mammalian GAPDH. Indeed, these antibodies significantly inhibited sporozoite liver infection in mice. One of these peptides, G6-1-20, overlaps with a parasite specific B-cell epitope (GAPDH 283-292, see Table 2). Therefore, parasite specific GAPDH epitope peptides are candidates for novel malaria vaccine antigens. Since these epitopes are small (20 amino acids), they could be fused to existing malaria vaccine antigens for additive or synergistic protective efficacy [28].

2.2. Hepatocyte Infection

The same phage-peptide display library was used to screen for peptides that bind to freshly isolated mouse hepatocytes [14]. Out of five candidates, the HP1 peptide (NCTSNDIWESCT) was the strongest hepatocyte-binding peptide and this peptide competitively inhibited sporozoite-hepatocyte interaction [14]. The basic hypothesis was that HP1 is a structural mimic of a sporozoite ligand for hepatocyte interaction and competes with the sporozoite for binding to the hepatocyte receptor. Supporting this hypothesis, anti-HP1 antibodies recognized molecules on the surface of unpermeabilized P. berghei and P. falciparum sporozoites. On Western blots, anti-HP1 antibodies bound to a ~50 kDa sporozoite protein and mass spectrometry identified 6 candidate sporozoite proteins of this size range. All 6 candidates were expressed as recombinant proteins, of which anti-HP1 antibodies recognized only PbPLSCR. In parallel, a hepatocyte membrane protein for HP1 peptide binding was identified as Carbamoyl-phosphate synthase 1 (Cps1). Interaction of PbPLSCR with Cps1 was confirmed with pull-down and ELISA assays leading to the identification of Plasmodium PLSCR and hepatocyte Cps1 as sporozoite ligand and hepatocyte receptor proteins, respectively.
PLSCR is a type II membrane protein, whose N’-terminal region is predicted to face the cytosolic space, and the C-terminal end to be embedded in the membrane. PLSCR catalyzes the scrambling of asymmetrically polarized plasma membrane phospholipid components in a Ca2+-dependent and ATP-independent manner [29,30]. Mammalian cell membranes are enriched for sphingomyelin and phosphatidylcholine in the outer leaflet and enriched for phosphatidylserine (PS), phosphatidylethanolamine, and phosphatidylinositol in the inner leaflet. PLSCRs activate externalization of PS, which activates blood coagulation and apoptosis. There are three phospholipid scrambling enzyme families: the PLSCR family, the TMEM16 family, and the XKR family [29]. Only the PLSCR family has structural similarity with Tubby-like proteins that possess a 12-stranded beta barrel surrounding a central alpha helix. Plasmodium PLSCR has the conserved structure of the PLSCR family [31] and its scramblase activity was confirmed, however PfPLSCR is dispensable for blood stage growth [32]. Apart from these canonical activities, PLSCR has additional functions as a moonlighting protein [33]. PLSCR can be secreted into the extracellular matrix (ECM) or enter the nucleus. In the cytosolic space PLSCRs interact with other proteins involved in cell death, autophagy, inflammation, molecular trafficking, and gene regulation. In the extracellular space or endosomal compartment, PLSCRs interact with viruses or other cellular receptor molecules for internalization. Some enveloped viruses utilize canonical scramblase function to induce PS exposure on the host cell membrane which serves as the viral envelope that induces apoptotic mimicry that facilitates viral entry through host cell phagocytosis. On the other hand, human PLSCR1 targets SARS-CoV-2-containing vesicles and inhibits virus entry and membrane fusion by the spike protein through its ectodomain (β-barrels and C-terminal helix) which has no direct correlation with scramblase activity [34].
PfPLSCR has potential for a PEV antigen since it is highly expressed on the sporozoite surface [14,28,32,35,36]. As humanPLSCR1 ectodomain interacts with SARS-CoV-2 particles, it is expected that the PfPLSCR ectodomain will act as a ligand for hepatocyte interaction [14,32]. Therefore, none of the three predicted Plasmodium-specific B-cell epitopes in the N-terminal region (Table 2) is expected to generate protective antibodies. It is expected that the ligand epitope in the ectodomain may contribute for protective immunity when immunized. Except for Plasmodium sporozoite, PLS has never been investigated as a ligand of infectious microbes or a vaccine candidate. Plasmodium has one PLSCR gene and PLSCR genes among Plasmodium species are well conserved (~ 75 % identity) [14] , however the human genome has 5 genes and 10 isoforms (uniprot.org) of which maximum identity reaches 21 % (HsPLSCR3). Moreover, only two non-synonymous PfPLSCR SNPs have been reported out of 301 sequenced strains (Table 1). Divergent sequence identity from mammalian host proteins and low polymorphism in the field favors the potential use of PfPLSCR as an additional malaria vaccine antigen. Indeed, antibodies against PbPLSCR inhibited both P. berghei and P. falciparum sporozoite-hepatocyte interaction [14]. Genetic polymorphism of a vaccine antigen can dampen enthusiasm of its general application. PfCSP, the most prominent malaria vaccine antigen, has 48 NS-SNPs out of 310 sequenced strains and 14 % of mutant alleles have frequencies over 30%. On the other hand, two SNPs in PfPLSCR were identified in the cytosolic N’-terminal region with 1% frequency (plasmodb.org).

3. Plasmodium Ligands in the Mosquito

The first specific parasite interaction in the mosquito midgut occurs between male and female gametes at fertilization. Female gamete heat-shock protein 90 (HSP90) was identified as a ligand for fertilization [16]. The zygote then develops into an ookinete that moves to the mosquito midgut epithelium. Ookinetes traverse the mosquito midgut using surface enolase as a ligand [13], and then diferentiate into oocysts that produce thousands of sporozoites.

3.1. Fertilization

Purified male P. berghei gametocytes were incubated with a phage-peptide display library for selecting male gamete-binding peptides. The MG1 peptide (SFRSRLQPYSCA) was selected, and it competitively inhibited P. berghei and P. falciparum fertilization, both in vitro and in the mosquito midgut [16]. The hypothesis that MG1 peptide is a structural mimic of a female gamete protein for fertilization was confirmed with assays using anti-MG1 antibodies. Anti-MG1 antibodies bound to the female gamete surface and recognized a ~110 kDa female gamete membrane protein. Mass spectrometry assay identified three candidate proteins in this size range that were expressed as recombinant proteins. Anti-MG1 antibodies recognized Plasmodium heat-shock protein 90 (HSP90) only. Immuno-fluorescence assays confirmed surface exposure of HSP90 on P. berghei and P. falciparum female gametes. Moreover, anti-HSP90 antibodies inhibited gamete fertilization in the mosquito midgut confirming that Plasmodium female gamete HSP90 as a fertilization ligand.
HSP90 is a well-known molecular chaperone that plays crucial roles in various cellular processes, including signal transduction, protein folding, and response to stress conditions. Canonical roles of HSP90 include facilitating protein folding, stabilization and activation of a wide range of client proteins [37]. HSP90 operates as a homodimer whose conformation is regulated by ATP binding to its N’-terminal ATPase domain. Binding of various co-chaperones can modulate its activity. HSP90 function is not limited to the intracellular environment; extracellular HSP90 also plays a role in immune responses by interacting with surface receptors on immune cells, thereby modulating cellular functions such as cytokine secretion, cell maturation, and antigen presentation. HSP90 has been explored as an adjuvant since it activates and modulates professional antigen-presenting cells to induce robust immune responses [38]. As is the case for Plasmodium, mammalian oocyte surface HSP90s are important for fertilization as well [39,40]. Surface HSP90 exposure on diverse infectious microorganisms have been reported, which suggest HSP90 may be a vaccine candidate. Immunoblotting assays using convalescent sera from Streptococcus oralis-infected patients detected two immunodominant antigens. An 85 kDa protein was identified as HSP90 and antibodies against HSP90 protected immunized animals [41]. HSP90 of the oriental liver fluke, Clonorchis sinensis, was assessed for T-cell activation and antibody production [42]. Antisera against human fungal disease Aspergillus fumigatus identified enolase and HSP90 as vaccine candidates [43]. Proteome analysis using antisera against Borrelia burgdorferi, a causative agent of Lyme disease, identified HSP90 as an immunodominant antigen [44]. Two HSP90 epitopes of Candida albicans, an opportunistic pathogenic yeast, have been identified and applied as vaccine antigens for protective immunity [45,46]
P. falciparum has one HSP90 gene and humans have two genes and three isoforms of which maximum Plasmodium-human identity is 75% (HsHSP90B, Table 1). Seven non-synonymous SNPs were identified out of 301 sequenced P. falciparum strains of which 6 NS-SNPs were found in the predicted B-cell epitope PfHSP90_211-340 (Table 2). Plasmodium HSP90 is recognized as a potential vaccine candidate since it is exposed on the parasite surface during diverse stages even on the infected RBC surface, important for fertilization, and essential for blood-stage parasite growth [39,40,47,48,49,50,51]. Antibodies against P. berghei HSP90 inhibited parasite fertilization, which shows the potential of Plasmodium HSP90 as a TBV antigen [16]. Anti-sporozoite and anti-asexual blood stage parasite activity of these antibodies is yet to be assessed. Since HSP90 acts as a chaperon molecule in diverse pathways, and surface exposure of HSP90 was confirmed at multiple parasite stages [47,48,49], the utility of anti-HSP90 antibodies may extend beyond the TBV. Despite PfHSP90’s high sequence identity with human orthologues, there are over 20 divergent peptides with identity lower than 50%, and four of them are predicted to be B-cell epitopes (Table 2).

3.2. Traversal of the Midgut Epithelium

Screening for mosquito midgut-binding peptides using a phage-peptide display library led to the identification of the Plasmodium ookinete surface enolase as a ligand for mosquito midgut invasion [52]. The selected SM1 peptide (PCQRAIFQSICN) bound to the luminal side of mosquito midgut and prevented interaction with ookinetes. This suggested that the SM1 peptide binds to a receptor on the mosquito midgut for ookinete invasion and that the SM1 peptide mimics the conformation of an ookinete ligand for midgut interaction. This hypothesis was confirmed with a series of assays using anti-SM1 antibodies. Immunofluorescence assays showed that anti-SM1 antibodies bind to both P. berghei and P. falciparum ookinete surface. A Western blotting assay found that the anti-SM1 antibodies bound to two, ~65 kDa and ~48 kDa, major protein bands. Mass spectrometry assay identified the 65 kDa protein as RNA helicase which is a cytoplasmic protein and the 48 kDa protein as enolase. Recombinant P. falciparum enolase was generated for production of antibodies in rabbits. Immuno-electron microscopy confirmed the surface localization of P. berghei ookinete enolase. Importantly, anti-enolase antibodies inhibited P. berghei and P. falciparum ookinete midgut invasion [13].
The main function of enolase is catalysis of 2-phosphoglycerate to phosphoenolpyruvate, reordering the single bond between carbon atoms to form a higher energy double bond in glycolysis [53]. However, as a moonlighting protein, enolase plays an important role in diverse pathogenic microorganisms for adhering to the ECM of various organisms [53,54]. As an adherence factor, enolase interacts with host ECM and recruiting mammalian plasminogen, which in turn plays a key role in the fibrinolytic system maintaining homeostasis via creation and dissolution of fibrin clots. Plasminogen should be activated into plasmin for fibrinolysis and plasminogen binding to enolase promotes this activation, thus allowing pathogens to traverse the host ECM [55]. Plasminogen-enolase interaction plays an important role in the Plasmodium ookinete mosquito midgut invasion. In addition to serve as a mosquito midgut ligand, ookinete surface enolase mediates the binding of blood plasminogen via a C-terminal 6-amino acid motif (DKSLVK) that is recognized by a lysine-binding Kringle domains of the plasminogen. Confirming this role, feeding an infectious blood meal with excess soluble 6-aa peptide competitively inhibited ookinete mosquito midgut invasion by preventing plasminogen binding to ookinete surface enolase [13].
Enolase has been investigated for a vaccine candidate to protect from diverse infectious microbes. The avian bacterial pathogen, Mycoplasma synoviae, uses enolase as an adherence factor and immunization and challenge assays using six major immunogenic antigens identified that enolase elicited the best protective efficacy in challenged chickens [56]. This trend was also seen in ticks where it was shown that anti-enolase antibodies reduced tick attachment [57]. The bovine disease-causing bacterium, Anaplasmasa marginale, uses enolase for attachment to the host erythrocyte surface. A. marginale AmEno01 protein was identified as a vaccine candidate, as it exists across all groups of A. marginale strains with well-conserved 3D-structures [58]. Bioinformatics studies of enolase in Trypanosoma cruzi, a causative agent of American trypanosomiasis, identified a consensus sequence of the enolase protein from 15 T. cruzi strains as a vaccine candidate [59].
Plasmodium enolase is a promising TBV antigen candidate since it is exposed on the ookinete surface for interaction with a mosquito midgut receptor and is important for the movement of ookinete in the blood bolus using the fibrinolysis pathway. Indeed, anti-enolase antibodies inhibited ookinete mosquito invasion. Interestingly, treatment of 6-aa peptide for a lysine-binding Kringle domain competitively inhibited parasite mosquito midgut invasion with similar efficacy as antibody treatment, which suggests that antibody against the 6-aa peptide can inhibit ookinete midgut invasion [13]. Due to its small size, the 6-aa peptide can be fused with an existing antigen for immunization.

4. Conclusions and Perspectives

All merozoite ligands for RBC infection identified so far are parasite specific proteins [9]. In contrast, all parasite ligands at two major population bottlenecks are moonlighting proteins acting uncoupled from their canonical roles. In terms of vaccine development, concerns are not related to their multifunctional properties, but to their conserved protein structures and sequences with host protein orthologues. One hypothesis for why infectious microorganisms use conserved moonlighting proteins as ligands is that the host will not elicit antibodies against these conserved proteins. Indeed, most of predicted linear B-cell epitopes in the microbes and human protein orthologues overlap [60]. However, the parasite ligand epitope peptides for host cell recognition may not be located only in highly conserved regions. Two Plasmodium sporozoite GAPDH epitopes, G6-1-20, and G6-41-60 peptides, for CD68 interaction have 70 % and 65 % identities with host protein and antibodies against these epitope peptides do not cross react with the host protein [19]. Although these epitope peptides do not locate in the immunodominant regions, immunization of each epitope peptide elicited enough antibodies for protective immunity. Therefore, epitope-based vaccination strategies will resolve conserved antigen issues and will enable easy fusion of multiple epitope antigens for increased protective efficacy.
A major weakness of TBVs is that transmission-blocking antibodies do not protect the immunized hosts. Thus, addition to the TBV of an antigen that confers protective immunity to the vaccinated person is highly desirable. Optimizing an immunization regimen for two different vaccine antigens has many hurdles. The molecular size of the most advanced PEV (RTS,S/AS01E) or the most advanced TBV (P230) is large enough to generate broad-range polyclonal antibodies that can ‘dilute’ protection efficiency by generating antibodies unrelated to protection [7,61]. Immunization with two large antigens may elicit competition and immunodominance of antibodies irrelevant to protection. Development of fusion vaccine antigens containing multiple epitopes targeting both liver infection and mosquito transmission will improve malaria vaccine strategies to prevent both infection of humans and transmission to mosquitoes. Of note, parasite ligands in the two major population bottlenecks were identified through host cell binding peptide selection. All the selected peptides were identified as structural mimics of parasite ligands. Immunization with these peptides elicited protective antibodies, which strongly implies feasibility of using these peptides, instead of parasite host antigens, as vaccine antigens.

Author Contributions

Conceptualization, writing-original draft preparation, and review and editing: K.S., P.M., P.D.A. and C.S. All authors have read and agreed to the published version of the manuscript.

Funding

This research received no external funding.

Institutional Review Board Statement

Not applicable.

Data Availability Statement

Not applicable.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Kebaier, C., T. Voza, and J. Vanderberg. "Kinetics of Mosquito-Injected Plasmodium Sporozoites in Mice: Fewer Sporozoites Are Injected into Sporozoite-Immunized Mice." PLoS Pathog 5, no. 4 (2009): e1000399.
  2. White, N. J., S. Pukrittayakamee, T. T. Hien, M. A. Faiz, O. A. Mokuolu, and A. M. Dondorp. "Malaria." Lancet 383, no. 9918 (2014): 723-35.
  3. Pradel, G., S. Garapaty, and U. Frevert. "Kupffer and Stellate Cell Proteoglycans Mediate Malaria Sporozoite Targeting to the Liver." Comp Hepatol 3 Suppl 1, no. Suppl 1 (2004): S47.
  4. Frevert, U., S. Engelmann, S. Zougbede, J. Stange, B. Ng, K. Matuschewski, L. Liebes, and H. Yee. "Intravital Observation of Plasmodium Berghei Sporozoite Infection of the Liver." PLoS Biol 3, no. 6 (2005): e192.
  5. Tavares, J., P. Formaglio, S. Thiberge, E. Mordelet, N. Van Rooijen, A. Medvinsky, R. Menard, and R. Amino. "Role of Host Cell Traversal by the Malaria Sporozoite During Liver Infection." J Exp Med 210, no. 5 (2013): 905-15.
  6. Sturm, A., R. Amino, C. van de Sand, T. Regen, S. Retzlaff, A. Rennenberg, A. Krueger, J. M. Pollok, R. Menard, and V. T. Heussler. "Manipulation of Host Hepatocytes by the Malaria Parasite for Delivery into Liver Sinusoids." Science 313, no. 5791 (2006): 1287-90.
  7. Duffy, P. E. , and J. Patrick Gorres. "Malaria Vaccines since 2000: Progress, Priorities, Products." NPJ Vaccines 5, no. 1 (2020): 48.
  8. Tsoumani, M. E., C. Voyiatzaki, and A. Efstathiou. "Malaria Vaccines: From the Past Towards the Mrna Vaccine Era." Vaccines (Basel) 11, no. 9 (2023).
  9. Weiss, G. E., P. R. Gilson, T. Taechalertpaisarn, W. H. Tham, N. W. de Jong, K. L. Harvey, F. J. Fowkes, P. N. Barlow, J. C. Rayner, G. J. Wright, A. F. Cowman, and B. S. Crabb. "Revealing the Sequence and Resulting Cellular Morphology of Receptor-Ligand Interactions During Plasmodium Falciparum Invasion of Erythrocytes." PLoS Pathog 11, no. 2 (2015): e1004670.
  10. Duffy, P. E. "Transmission-Blocking Vaccines: Harnessing Herd Immunity for Malaria Elimination." Expert Rev Vaccines 20, no. 2 (2021): 185-98.
  11. Smith, R. C., J. Vega-Rodríguez, and M. Jacobs-Lorena. "The Plasmodium Bottleneck: Malaria Parasite Losses in the Mosquito Vector." Mem Inst Oswaldo Cruz 109, no. 5 (2014): 644-61.
  12. Tadesse, F. G., L. Meerstein-Kessel, B. P. Goncalves, C. Drakeley, L. Ranford-Cartwright, and T. Bousema. "Gametocyte Sex Ratio: The Key to Understanding Plasmodium Falciparum Transmission?" Trends Parasitol 35, no. 3 (2019): 226-38.
  13. Ghosh, A. K., I. Coppens, H. Gardsvoll, M. Ploug, and M. Jacobs-Lorena. "Plasmodium Ookinetes Coopt Mammalian Plasminogen to Invade the Mosquito Midgut." Proc Natl Acad Sci U S A 108, no. 41 (2011): 17153-8.
  14. Cha, S. J., M. S. Kim, C. H. Na, and M. Jacobs-Lorena. "Plasmodium Sporozoite Phospholipid Scramblase Interacts with Mammalian Carbamoyl-Phosphate Synthetase 1 to Infect Hepatocytes." Nat Commun 12, no. 1 (2021): 6773.
  15. Cha, S. J., M. S. Kim, A. Pandey, and M. Jacobs-Lorena. "Identification of Gapdh on the Surface of Plasmodium Sporozoites as a New Candidate for Targeting Malaria Liver Invasion." J Exp Med 213, no. 10 (2016): 2099-112.
  16. Cha, S. J., J. Vega-Rodriguez, D. Tao, H. M. Kudyba, K. Hanner, and M. Jacobs-Lorena. "Plasmodium Female Gamete Surface Hsp90 Is a Key Determinant for Fertilization." mBio (2023): e0314223.
  17. Bonnycastle, L. L., J. S. Mehroke, M. Rashed, X. Gong, and J. K. Scott. "Probing the Basis of Antibody Reactivity with a Panel of Constrained Peptide Libraries Displayed by Filamentous Phage." J Mol Biol 258, no. 5 (1996): 747-62.
  18. Cha, S. J., K. Park, P. Srinivasan, C. W. Schindler, N. van Rooijen, M. Stins, and M. Jacobs-Lorena. Cd68 Acts as a Major Gateway for Malaria Sporozoite Liver Infection. J Exp Med 2015, 212, 1391–403. [Google Scholar] [CrossRef] [PubMed]
  19. Cha, S. J., K. J. McLean, and M. Jacobs-Lorena. Identification of Plasmodium Gapdh Epitopes for Generation of Antibodies That Inhibit Malaria Infection. Life Sci Alliance 2018, 1, e201800111. [Google Scholar] [CrossRef] [PubMed]
  20. Perez-Casal, J., and A. A. Potter. Glyceradehyde-3-Phosphate Dehydrogenase as a Suitable Vaccine Candidate for Protection against Bacterial and Parasitic Diseases. Vaccine 2016, 34, 1012–7. [Google Scholar] [CrossRef] [PubMed]
  21. Kopeckova, M., I. Pavkova, and J. Stulik. Diverse Localization and Protein Binding Abilities of Glyceraldehyde-3-Phosphate Dehydrogenase in Pathogenic Bacteria: The Key to Its Multifunctionality?". Front Cell Infect Microbiol 2020, 10, 89. [Google Scholar] [CrossRef] [PubMed]
  22. Wang, J., S. Li, J. Chen, L. Gan, J. Wang, Q. Xiong, Z. Feng, Q. Li, Z. Deng, X. Yuan, and Y. Yu. Hijacking of Host Plasminogen by Mesomycoplasma (Mycoplasma) Hyopneumoniae Via Gapdh: An Important Virulence Mechanism to Promote Adhesion and Extracellular Matrix Degradation. Microbiol Spectr 023, 11, e0021823. [Google Scholar]
  23. Zhu, W., C. Wu, C. Kang, C. Cai, Y. Wang, J. Li, Q. Zhang, X. Sun, and M. Jin. Evaluation of the Protective Efficacy of Four Newly Identified Surface Proteins of Erysipelothrix Rhusiopathiae. Vaccine 2018, 36, 8079–83. [Google Scholar] [CrossRef] [PubMed]
  24. An, R., Y. Guo, M. Gao, and J. Wang. Subcutaneous Streptococcus Dysgalactiae Gapdh Vaccine in Mice Induces a Proficient Innate Immune Response. J Vet Sci 2023, 24, e72. [Google Scholar] [CrossRef]
  25. Alvarez-Dominguez, C., D. Salcines-Cuevas, H. Teran-Navarro, R. Calderon-Gonzalez, R. Tobes, I. Garcia, S. Grijalvo, A. Paradela, A. Seoane, F. J. Sangari, M. Fresno, J. Calvo-Montes, I. C. Perez Del Molino Bernal, and S. Yanez-Diaz. "Epitopes for Multivalent Vaccines against Listeria, Mycobacterium and Streptococcus Spp: A Novel Role for Glyceraldehyde-3-Phosphate Dehydrogenase. Front Cell Infect Microbiol 2020, 10, 573348. [Google Scholar] [CrossRef] [PubMed]
  26. Salcines-Cuevas, D., H. Teran-Navarro, R. Calderon-Gonzalez, P. Torres-Rodriguez, R. Tobes, M. Fresno, J. Calvo-Montes, Icpd Molino-Bernal, S. Yanez-Diaz, and C. Alvarez-Dominguez. Glyceraldehyde-3-Phosphate Dehydrogenase Common Peptides of Listeria Monocytogenes, Mycobacterium Marinum and Streptococcus Pneumoniae as Universal Vaccines. Vaccines 2021, 9. [Google Scholar] [CrossRef]
  27. Sheng, X., H. Zhang, M. Liu, X. Tang, J. Xing, H. Chi, and W. Zhan. Development and Evaluation of Recombinant B-Cell Multi-Epitopes of Pdha1 and Gapdh as Subunit Vaccines against Streptococcus Iniae Infection in Flounder (Paralichthys Olivaceus). Vaccines 2023, 11. [Google Scholar] [CrossRef]
  28. Gomez-Diaz, E., R. S. Yerbanga, T. Lefevre, A. Cohuet, M. J. Rowley, J. B. Ouedraogo, and V. G. Corces. Epigenetic Regulation of Plasmodium Falciparum Clonally Variant Gene Expression During Development in Anopheles Gambiae. Sci Rep 2017, 7, 40655. [Google Scholar] [CrossRef] [PubMed]
  29. Kodigepalli, K. M., K. Bowers, A. Sharp, and M. Nanjundan. Roles and Regulation of Phospholipid Scramblases. FEBS Lett 2015, 589. [Google Scholar]
  30. Rayala, S., V. G. Francis, U. Sivagnanam, and S. N. Gummadi. N-Terminal Proline-Rich Domain Is Required for Scrambling Activity of Human Phospholipid Scramblases. J Biol Chem, 2014; 289, 13206–18. [Google Scholar]
  31. Bateman, A., R. D. Finn, P. J. Sims, T. Wiedmer, A. Biegert, and J. Soding. Phospholipid Scramblases and Tubby-Like Proteins Belong to a New Superfamily of Membrane Tethered Transcription Factors. Bioinformatics 2009, 2009, 159–62. [Google Scholar]
  32. Haase, S., M. Condron, D. Miller, D. Cherkaoui, S. Jordan, J. M. Gulbis, and J. Baum. Identification and Characterisation of a Phospholipid Scramblase in the Malaria Parasite Plasmodium Falciparum. Mol Biochem Parasitol 2021, 243, 111374. [Google Scholar] [CrossRef] [PubMed]
  33. Dal Col, J., M. J. Lamberti, A. Nigro, V. Casolaro, E. Fratta, A. Steffan, and B. Montico. Phospholipid Scramblase 1: A Protein with Multiple Functions Via Multiple Molecular Interactors. Cell Commun Signal 2022, 20, 78. [Google Scholar] [CrossRef] [PubMed]
  34. Xu, D., W. Jiang, L. Wu, R. G. Gaudet, E. S. Park, M. Su, S. K. Cheppali, N. R. Cheemarla, P. Kumar, P. D. Uchil, J. R. Grover, E. F. Foxman, C. M. Brown, P. J. Stansfeld, J. Bewersdorf, W. Mothes, E. Karatekin, C. B. Wilen, and J. D. MacMicking. Plscr1 Is a Cell-Autonomous Defence Factor against Sars-Cov-2 Infection. Nature 2023, 619, 819–27. [Google Scholar] [CrossRef]
  35. Zanghi, G., S. S. Vembar, S. Baumgarten, S. Ding, J. Guizetti, J. M. Bryant, D. Mattei, A. T. R. Jensen, L. Renia, Y. S. Goh, R. Sauerwein, C. C. Hermsen, J. F. Franetich, M. Bordessoulles, O. Silvie, V. Soulard, O. Scatton, P. Chen, S. Mecheri, D. Mazier, and A. Scherf. A Specific Pfemp1 Is Expressed in P. Falciparum Sporozoites and Plays a Role in Hepatocyte Infection. Cell Rep 2018, 22, 2951–63. [Google Scholar] [CrossRef]
  36. Lindner, S. E., K. E. Swearingen, A. Harupa, A. M. Vaughan, P. Sinnis, R. L. Moritz, and S. H. Kappe. Total and Putative Surface Proteomics of Malaria Parasite Salivary Gland Sporozoites. Mol Cell Proteomics 2013, 12, 1127–43. [Google Scholar] [CrossRef] [PubMed]
  37. Schopf, F. H., M. M. Biebl, and J. Buchner. The Hsp90 Chaperone Machinery. Nat Rev Mol Cell Biol 2017, 18, 345–60. [Google Scholar] [CrossRef]
  38. Corigliano, M. G., V. A. Sander, E. F. Sanchez Lopez, V. A. Ramos Duarte, L. F. Mendoza Morales, S. O. Angel, and M. Clemente. Heat Shock Proteins 90 Kda: Immunomodulators and Adjuvants in Vaccine Design against Infectious Diseases. Front Bioeng Biotechnol 2020, 8, 622186. [Google Scholar]
  39. Calvert, M. E., L. C. Digilio, J. C. Herr, and S. A. Coonrod. Oolemmal Proteomics--Identification of Highly Abundant Heat Shock Proteins and Molecular Chaperones in the Mature Mouse Egg and Their Localization on the Plasma Membrane. Reprod Biol Endocrinol 2003, 1, 27. [Google Scholar] [CrossRef] [PubMed]
  40. Pires, E. S., and V. V. Khole. A Block in the Road to Fertility: Autoantibodies to Heat-Shock Protein 90-Beta in Human Ovarian Autoimmunity. Fertil Steril 2009, 92, 1395–409. [Google Scholar] [CrossRef]
  41. Burnie, J. P., W. Brooks, M. Donohoe, S. Hodgetts, A. al-Ghamdi, and R. C. Matthews. Defining Antibody Targets in Streptococcus Oralis Infection. Infect Immun 1996, 64, 1600–8. [Google Scholar] [CrossRef] [PubMed]
  42. Chung, E. J., Y. I. Jeong, M. R. Lee, Y. J. Kim, S. E. Lee, S. H. Cho, W. J. Lee, M. Y. Park, and J. W. Ju. Heat Shock Proteins 70 and 90 from Clonorchis Sinensis Induce Th1 Response and Stimulate Antibody Production. Parasit Vectors 2017, 10, 118. [Google Scholar] [CrossRef] [PubMed]
  43. Denikus, N., F. Orfaniotou, G. Wulf, P. F. Lehmann, M. Monod, and U. Reichard. Fungal Antigens Expressed During Invasive Aspergillosis. Infect Immun 2005, 73, 4704–13. [Google Scholar] [CrossRef]
  44. Nowalk, A. J., R. D. Gilmore, Jr., and J. A. Carroll. Serologic Proteome Analysis of Borrelia Burgdorferi Membrane-Associated Proteins. Infect Immun 2006, 74, 3864–73. [Google Scholar] [CrossRef]
  45. Wang, G., M. Sun, J. Fang, Q. Yang, H. Tong, and L. Wang. Protective Immune Responses against Systemic Candidiasis Mediated by Phage-Displayed Specific Epitope of Candida Albicans Heat Shock Protein 90 in C57bl/6j Mice. Vaccine 2006, 24, 6065–73. [Google Scholar] [CrossRef]
  46. Li, X., Y. Yang, F. Yang, F. Wang, H. Li, H. Tian, and G. Wang. Chitosan Hydrogel Loaded with Recombinant Protein Containing Epitope C from Hsp90 of Candida Albicans Induces Protective Immune Responses against Systemic Candidiasis. Int J Biol Macromol 2021, 173, 327–40. [Google Scholar] [CrossRef]
  47. Florens, L., X. Liu, Y. Wang, S. Yang, O. Schwartz, M. Peglar, D. J. Carucci, J. R. Yates, 3rd, and Y. Wu. Proteomics Approach Reveals Novel Proteins on the Surface of Malaria-Infected Erythrocytes. Mol Biochem Parasitol 2004, 135, 1–11. [Google Scholar] [CrossRef]
  48. Florens, L., M. P. Washburn, J. D. Raine, R. M. Anthony, M. Grainger, J. D. Haynes, J. K. Moch, N. Muster, J. B. Sacci, D. L. Tabb, A. A. Witney, D. Wolters, Y. Wu, M. J. Gardner, A. A. Holder, R. E. Sinden, J. R. Yates, and D. J. Carucci. A Proteomic View of the Plasmodium Falciparum Life Cycle. Nature 2002, 419, 520–6. [Google Scholar] [CrossRef]
  49. Swearingen, K. E., S. E. Lindner, L. Shi, M. J. Shears, A. Harupa, C. S. Hopp, A. M. Vaughan, T. A. Springer, R. L. Moritz, S. H. Kappe, and P. Sinnis. "Interrogating the Plasmodium Sporozoite Surface: Identification of Surface-Exposed Proteins and Demonstration of Glycosylation on Csp and Trap by Mass Spectrometry-Based Proteomics. PLoS Pathog 2016, 12, e1005606.
  50. Bayih, A. G., A. Folefoc, A. N. Mohon, S. Eagon, M. Anderson, and D. R. Pillai. In Vitro and in Vivo Anti-Malarial Activity of Novel Harmine-Analog Heat Shock Protein 90 Inhibitors: A Possible Partner for Artemisinin. Malar J 2016, 15, 579. [Google Scholar] [CrossRef] [PubMed]
  51. Shahinas, D., G. Macmullin, C. Benedict, I. Crandall, and D. R. Pillai. Harmine Is a Potent Antimalarial Targeting Hsp90 and Synergizes with Chloroquine and Artemisinin. Antimicrob Agents Chemother 2012, 56, 4207–13. [Google Scholar] [CrossRef]
  52. Ghosh, A. K., P. E. Ribolla, and M. Jacobs-Lorena. Targeting Plasmodium Ligands on Mosquito Salivary Glands and Midgut with a Phage Display Peptide Library. Proc Natl Acad Sci U S A 2001, 98, 13278–81. [Google Scholar] [CrossRef] [PubMed]
  53. Pancholi, V. Multifunctional Alpha-Enolase: Its Role in Diseases. Cell Mol Life Sci 2001, 58, 902–20. [Google Scholar] [CrossRef] [PubMed]
  54. Chen, S. M., Z. Zou, S. Y. Guo, W. T. Hou, X. R. Qiu, Y. Zhang, L. J. Song, X. Y. Hu, Y. Y. Jiang, H. Shen, and M. M. An. Preventing Candida Albicans from Subverting Host Plasminogen for Invasive Infection Treatment. Emerg Microbes Infect 2020, 9, 2417–32. [Google Scholar] [CrossRef] [PubMed]
  55. Hussain, M., C. Kohler, and K. Becker. Enolase of Staphylococcus Lugdunensis Is a Surface-Exposed Moonlighting Protein That Binds to Extracellular Matrix and the Plasminogen/Plasmin System. Front Microbiol 2022, 13, 837297. [Google Scholar] [CrossRef]
  56. Han, S., Y. Wang, W. Chang, L. Wang, J. Fang, J. Han, X. Hou, X. Qi, and J. Wang. Evaluation of the Protective Efficacy of Six Major Immunogenic Proteins of Mycoplasma Synoviae. Front Vet Sci 2023, 10, 1334638. [Google Scholar]
  57. Haque, M. S., M. S. Islam, and M. J. You. Efficacy of Recombinant Enolase as a Candidate Vaccine against Haemaphysalis Longicornis Tick Infestation in Mice. Parasites Hosts Dis 2023, 61, 439–48. [Google Scholar] [CrossRef]
  58. Quiroz-Castaneda, R. E., H. Aguilar-Diaz, and I. Amaro-Estrada. An Alternative Vaccine Target for Bovine Anaplasmosis Based on Enolase, a Moonlighting Protein. Front Vet Sci 2023, 10, 1225873. [Google Scholar] [CrossRef]
  59. Diaz-Hernandez, A., M. C. Gonzalez-Vazquez, M. Arce-Fonseca, O. Rodriguez-Morales, M. L. Cedillo-Ramirez, and A. Carabarin-Lima. Consensus Enolase of Trypanosoma Cruzi: Evaluation of Their Immunogenic Properties Using a Bioinformatics Approach. Life, 2022; 12. [Google Scholar]
  60. Franco-Serrano, L., J. Cedano, J. A. Perez-Pons, A. Mozo-Villarias, J. Piñol, I. Amela, and E. Querol. A Hypothesis Explaining Why So Many Pathogen Virulence Proteins Are Moonlighting Proteins. Pathog Dis 2018, 76. [Google Scholar]
  61. Langowski, M. D., F. A. Khan, A. A. Bitzer, C. J. Genito, A. J. Schrader, M. L. Martin, K. Soto, X. Zou, S. Hadiwidjojo, Z. Beck, G. R. Matyas, M. C. Livingstone, A. H. Batchelor, and S. Dutta. Optimization of a Plasmodium Falciparum Circumsporozoite Protein Repeat Vaccine Using the Tobacco Mosaic Virus Platform. Proc Natl Acad Sci U S A 2020, 117, 3114–22. [Google Scholar] [CrossRef] [PubMed]
Table 1. Major genetic characteristics of P. falciparum ligand genes as malaria vaccine antigens. Genetic variation of parasite proteins were identified with NS-SNPs. Each NS-SNP is denoted for location, amino acid change, and percent of the minor allele among all sequenced strains (plasmodb.org). The maximum % identity between parasite and all human isoforms was determined.
Table 1. Major genetic characteristics of P. falciparum ligand genes as malaria vaccine antigens. Genetic variation of parasite proteins were identified with NS-SNPs. Each NS-SNP is denoted for location, amino acid change, and percent of the minor allele among all sequenced strains (plasmodb.org). The maximum % identity between parasite and all human isoforms was determined.
Ligand P. falciparum gene Human gene
# gene, isoforms Amino acids Genetic variation # gene, isoforms Maximum identity (%)
NS-SNPs (%) strains
GAPDH 1, 1 337 140Q-K (33) 275 1, 2 64
PLSCR 1, 1 275 50S-N (1>), 52M-I (1) 301 5, 10 21
HSP90 1, 1 745 58A-S (2), 229G-R (4), 231R-E (3), 233G-E (1), 235E-G (6), 239K-E (25), 256N-K (1) 301 2, 3 75
Enolase 1, 1 446 301V-I (1) 300 4, 10 69
Table 2. In silico prediction of linear B-cell epitope peptides for searching parasite specific peptides in each P. falciparum ligand protein. Percent identity denotes the maximum identity between parasite and human protein orthologues. Parasite epitope peptides no shorter than eight amino acids and on no higher identity than 60% are listed. B-cell epitopes were predicted using http://tools.iedb.org/bcell/.
Table 2. In silico prediction of linear B-cell epitope peptides for searching parasite specific peptides in each P. falciparum ligand protein. Percent identity denotes the maximum identity between parasite and human protein orthologues. Parasite epitope peptides no shorter than eight amino acids and on no higher identity than 60% are listed. B-cell epitopes were predicted using http://tools.iedb.org/bcell/.
Ligand Position Peptide sequence % identity
GAPDH 102-111 FLTKELASSH 0
189-199 VDGPSKGGKDW 0
283-292 EVVSQDFVHD 60
PLSCR 5-26 NIHMQPNINYSYRNPNMYNMNY 0
35-43 QQQMQLFVN 0
72-79 MGFKLDFN 0
HSP90 156-169 FTVTKDETNEKLGR 0
211-340 RQNEKEITASEEEEGEGEGEREGEEEEEKKKKTGEDKNADESKEENEDEEKKEDNEEDDNKTDHPKVEDVTEELENAEKKKKEKRKKKIHTVEHEWEELNKQKPLWMRKPEEVTNEEYASFYKSLTNDWE 28
562-590 CCTKEGLDIDDSEEAKKDFETLKAEYEGL 48
716-742 SIDEEENNDIDLPPLEETVDATDSKME 33
Enolase 83-90 NCTEQKKI 0
99-112 DGSKNEWGWSKSKL 0
142-150 QLAGKKSDQ 0
260-290 YNSENKTYDLDFKTPNNDKSLVKTGAQLVDL 42
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
Copyright: This open access article is published under a Creative Commons CC BY 4.0 license, which permit the free download, distribution, and reuse, provided that the author and preprint are cited in any reuse.