Preprint
Article

This version is not peer-reviewed.

Designing Nerve Growth Factor Analogues to Suppress Pain Signal Transduction Mediated by the p75NTR-NGF-TrkA Complex: A Structural and Biophysical Perspective

Wei Li  *

Submitted:

28 March 2024

Posted:

28 March 2024

You are already at the latest version

Abstract
As a key mediator of chronic pain, neurotrophin nerve growth factor (NGF) binds to two neurotrophin receptors: p75 neurotrophin receptor (p75NTR) and tyrosine kinase receptor A (TrkA). The formation of the p75NTR-NGF-TrkA complex is implicated in the potentiation of chronic pain signals, making it an attractive target for therapeutic explorations. NGF analogues and monoclonal antibodies (mAbs) targeting NGF represent two distinct approaches in modulating the intricate signaling pathways involved in pain transduction mediated by the p75NTR-NGF-TrkA complex. While NGF analogues offer the advantage of tailored design to fine-tune neurotrophic responses, monoclonal antibodies provide a more systemic and comprehensive blockade of NGF, inhibiting its interactions with both p75NTR and TrkA receptors. However, the use of mAbs may pose challenges related to potential side effects and interference with the physiological functions of NGF. As a result, balancing the benefits and drawbacks of the two approaches is critical for advancing therapeutic strategies towards the alleviation of p75NTR-NGF-TrkA-mediated pain. In this study, therefore, a novel structural and biophysical approach was employed for the design of NGF analogues to suppress p75NTR-NGF-TrkA-related chronic pain signaling. Employing high-throughput structural modeling and biophysics-based intermolecular binding affinity calculations, this article for the first time puts forward a set of NGF analogues, including in particular NGF analogues with four site-specific mutations, for whose dimerizations the K d at 37 C were reduced by three orders of magnitude (from 10-9 M to 10-6 M) compared to the K d at 37 C for the dimerization of native NGFs. Overall, the integration of structural and biophysical perspectives enhances our understanding of the rational design of NGF analogues as promising candidates for the development of NGF-targeted analgesic therapies, which balances the benefits and drawbacks of anti-NGF antibodies and NGF analogues for advancing therapeutic strategies towards the alleviation of p75NTR-NGF-TrkA-mediated pain.
Keywords: 
;  ;  ;  ;  

1. Introduction

Chronic pain imposes a substantial burden on global healthcare systems, affecting millions of individuals and severely compromising their quality of life [1,2,3,4]. Unraveling the intricate mechanisms underlying pain signal transduction is essential for developing targeted and effective therapeutic interventions [5,6,7]. The p75 neurotrophin receptor (p75NTR)-nerve growth factor (NGF)-tyrosine kinase receptor A (TrkA) complex has emerged as a critical nexus in the modulation of nociceptive signaling, presenting a promising target for innovative analgesic strategies [8,9,10,11].
Historically, nerve growth factor (NGF) was first discovered approximately 60 years ago by Rita Levi-Montalcini as a protein that induces the growth of nerves [12,13,14,15]. It is now known that NGF is also associated with Alzheimer’s disease and intractable pain, and hence, it, along with its high-affinity receptor, tropomyosin receptor kinase (Trk) A, is considered to be 1 of the new targets for therapies being developed to treat these diseases [16,17,18,19,20,21,22]. Anti-NGF antibody and TrkA inhibitors are known drugs that suppress NGF/TrkA signaling, and many drugs of these classes have been developed thus far. Interestingly, local anesthetics also possess TrkA inhibitory effects. This manuscript describes the development of an analgesic that suppresses NGF/TrkA signaling, which is anticipated to be one of the new methods to treat intractable pain [23,24,25,26,27,28].
While the implication of NGF and its receptors, TrkA and p75NTR (referred to as the NGF system) in CNS autoimmune neuroinflammation is not fully elucidated, the necessity of designing nerve growth factor (NGF) analogues to suppress pain signal transduction mediated by the p75NTR-NGF-TrkA complex arises from the intricate and multifaceted nature of the neurotrophic signaling pathways involved in CNS autoimmune neuroinflammation [29,30,31,32,33,34]. Since native NGF plays a pivotal role in both promoting neuronal survival and contributing to pain sensitization through its interactions with the p75NTR and TrkA receptors, the delicate balance between these contrasting effects underscores the need for targeted interventions that selectively modulate the signaling cascade to alleviate pain without compromising essential neurotrophic functions [35,36,37,38]. Therefore, in this article, designing NGF analogues provides a strategic approach to fine-tune the molecular interactions within the p75NTR-NGF-TrkA complex, aiming to attenuate the nociceptive signals while preserving the beneficial aspects of NGF-mediated neurotrophic support [39,40,41,42,43,44,45,46].

2. Materials and Methods

According to a structure search of the Protein Data Bank (PDB) [47], as of March 28, 2024, there are a total of sixteen experimentally determined NGF-related structures deposited into the PDB, as listed in Table 1.
Among the sixteen, PDB ID 2IFG [48] is the only experimental structure of the extracellular segment of human TRKA in complex with nerve growth factor, as shown by Figure 1. Therefore, in this article, PDB ID 2IFG [48] is chosen here as a structural template for the design of NGF analogues to suppress pain signal transduction mediated by the p75NTR-NGF-TrkA complex.
Figure 1. A overview of the experimental structure of the extracellular segment of human TRKA in complex with nerve growth factor (PDB ID 2IFG [48]). This figure is prepared by PyMol [49].
Figure 1. A overview of the experimental structure of the extracellular segment of human TRKA in complex with nerve growth factor (PDB ID 2IFG [48]). This figure is prepared by PyMol [49].
Preprints 102483 g001
Specifically, of the structure of the extracellular segment of human TRKA in complex with nerve growth factor with PDB ID 2IFG [48], a set of relevant amino acid sequences are listed in italics in fasta format as below,
>TRKAchainA
CPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNP
>TRKAchainB
CPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNP
>NGFchainE
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
>NGFchainF
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
To further elucidate the mechanism of the design of NGF analogues to suppress pain signal transduction mediated by the p75NTR-NGF-TrkA complex here, Figure 2 shows a closer look of the homodimer of two native NGF molecules, as experimentally determined by X-ray diffraction in 2007 (PDB ID 2IFG [48]), as the core of the idea is that NGF analogues are to be still able to bind two neurotrophin receptors: p75 neurotrophin receptor (p75NTR) and tyrosine kinase receptor A (TrkA), yet, their ability to form a homodimer (Figure 2) is inhibited via disruptions of a set of key inter-residue interactions [50] at the binding interface of native NGF homodimers (Figure 1).

2.1. A Comprehensive Structural and Biophysical Analysis of the p75NTR-NGF-TrkA Complex

As described previously in [50,51,52], a comprehensive structural and biophysical analysis was conducted for the structure of the extracellular segment of human TRKA in complex with nerve growth factor with PDB ID 2IFG [48]. Specifically, the salt bridge analysis was conducted with an in-house python script only for titrateable residues (Asp, Glu, Lys, Arg and His), 4.0 Å was used as the cutoff distance for the two oppositely charged groups [50]. The hydrogen bond analysis was also conducted for only side chain nuclei with an in-house python script, and employed two geometric criteria: (a) a cutoff value of the angle formed by acceptor (A), donor (D) and hydrogen (H) ( A D H ) of 30°; (b) a cutoff value of donor-acceptor distance at 3.0 Å. That is, a hydrogen bond is only considered to be formed if A D H is no larger than 30° and the donor-acceptor distance is not larger than 3.0 Å [50].

2.2. The Design of NGF Analogues to Suppress Pain Signal Transduction Mediated by the p75NTR-NGF-TrkA Complex

In combination with the comprehensive structural and biophysical analysis [50] as described above, the key amino acid residues at the p75NTR-NGF-TrkA complex binding interface (PDB ID: 2IFG) were examined carefully [ ] in PyMol [49], and the inter-residue distances were calculated by PyMol [49] to identify potential neighbouring residue pair(s) to modulate the structural stability of the p75NTR-NGF-TrkA complex structure, leading to the design of a set of NGF analogues with reduced affinity such that ability of NGF monomers to form a homodimer (Figure 2) is inhibited via disruptions of a set of key inter-residue interactions [50] at the binding interface of native NGF homodimers (Figure 1). Specifically, after homology structural modeling with Modeller [53], the binding affinity between rt-PA analogue and PAI-1 was calculated using Prodigy [54,55].

3. Results

As described above, the core of the idea is that NGF analogues are to be still able to bind two neurotrophin receptors: p75 neurotrophin receptor (p75NTR) and tyrosine kinase receptor A (TrkA), yet, their ability to form a homodimer (Figure 2) is inhibited via disruptions of a set of key inter-residue interactions [50] at the binding interface of native NGF homodimers (Figure 1). Essentially, the design of NGF analogues here is the construction of an n-dimensional NGF dimer-based mini GIBAC [52] towards the suppression of chronic NGF-related pain signaling, where n represents the number of site-specific mutations introduced to the amino acid sequence of NGF, as listed below:
>NGFchainE
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
>NGFchainF
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Given that the length of monomeric NGF is 121, n is not to be beyond six to ensure that the NGF analogues is more than 95% homologous to its native counterpart, and the accuracy of the homology structural modeling using the experimental structure of the extracellular segment of human TRKA in complex with nerve growth factor (PDB ID 2IFG [48]).
Here, in this article, a total of three occasions were reported, i.e., n = 3 , specifically,
1.
n = 1 , i.e., a one-dimensional NGF dimer-based mini GIBAC [51,52] for the design of NGF analogues towards the suppression of NGF-related chronic pain signaling, as partly listed in Table 2.
2.
n = 2 , i.e., a two-dimensional NGF dimer-based mini GIBAC [51,52] for the design of NGF analogues towards the suppression of NGF-related chronic pain signaling, as partly listed in Table 3.
3.
n = 3 , i.e., a three-dimensional NGF dimer-based mini GIBAC [51,52] (Supplementary file trio.pdf) for the design of NGF analogues towards the suppression of NGF-related chronic pain signaling, as partly listed in Table 4.
Table 2. Single site-specific mutation-based analysis of the binding affinities between two nerve growth factor monomers. Prodigy [55] is used to calculate the binding energy and Kd between two nerve growth factor monomers. In this table, the row for Nddm (yellow background) represents the binding affinity between two native nerve growth factor monomers.
Table 2. Single site-specific mutation-based analysis of the binding affinities between two nerve growth factor monomers. Prodigy [55] is used to calculate the binding energy and Kd between two nerve growth factor monomers. In this table, the row for Nddm (yellow background) represents the binding affinity between two native nerve growth factor monomers.
Mutation Energy mean Energy std Kd mean Kd std
S4F -10.270 0.671 8.953000000000001e-08 6.715793400634061e-08
S4A -10.310 0.342 6.23e-08 3.199703111227665e-08
S4P -10.320 0.389 6.8e-08 6.065311203887233e-08
S4V -10.370 0.335 5.59e-08 2.6135990511170603e-08
S4I -10.370 0.377 6.05e-08 4.102499238269277e-08
S4M -10.450 0.478 5.9399999999999996e-08 4.9218289283558e-08
S4L -10.560 0.578 5.859e-08 7.30497973987608e-08
S4Y -10.650 0.301 3.52e-08 1.70926884953772e-08
S4G -10.660 0.258 3.24e-08 1.3162066707018317e-08
S4C -10.850 0.461 2.911e-08 1.89068479657504e-08
A98S -10.860 0.595 3.832e-08 5.483358095182185e-08
S4K -11.020 0.328 1.958e-08 1.4229111005259603e-08
A98Q -11.070 0.454 2.023e-08 1.62038297942184e-08
A98T -11.150 0.364 1.6529999999999996e-08 1.0195494102788742e-08
S4E -11.180 0.464 1.726e-08 1.4366293885341482e-08
S104I -11.180 0.447 1.645e-08 1.0609736094738644e-08
S4D -11.200 0.410 1.5650000000000004e-08 1.0420772524146184e-08
S104L -11.260 0.250 1.24e-08 3.7812696280482305e-09
N36A -11.260 0.242 1.24e-08 4.991192242340502e-09
S4W -11.280 0.440 1.394e-08 8.486247698482527e-09
N36P -11.310 0.262 1.1369999999999999e-08 4.242652472215937e-09
I35S -11.370 0.618 1.4880000000000002e-08 1.4351431984300383e-08
S104P -11.420 0.392 1.025e-08 5.6498230060772695e-09
S104F -11.420 0.421 1.1350000000000002e-08 8.690368231553827e-09
S104G -11.430 0.473 1.126e-08 7.755282070950095e-09
S4H -11.440 0.472 1.229e-08 1.466243158551814e-08
S104A -11.460 0.361 9.48e-09 4.582313826005372e-09
N36G -11.470 0.323 9.34e-09 5.523078851510269e-09
I35T -11.500 0.490 1.1449999999999998e-08 1.2621509418449125e-08
S104V -11.540 0.508 1.091e-08 1.3590912404985913e-08
Nddm -12.700 0.000 1.2e-09 0.0
Table 3. Double site-specific mutation-based analysis of the binding affinities between two nerve growth factor monomers. Prodigy [55] is used to calculate the binding energy and Kd between two nerve growth factor monomers. In this table, the row for Nddm (yellow background) represents the binding affinity between two native nerve growth factor monomers.
Table 3. Double site-specific mutation-based analysis of the binding affinities between two nerve growth factor monomers. Prodigy [55] is used to calculate the binding energy and Kd between two nerve growth factor monomers. In this table, the row for Nddm (yellow background) represents the binding affinity between two native nerve growth factor monomers.
Mutation Energy mean Energy std Kd mean Kd std
S4F_A98G -8.600 0.000 9.1e-07 0.0
S4A_L81D -8.600 0.000 8.3e-07 0.0
S4Y_L81A -8.700 0.000 7.8e-07 0.0
S4A_I22G -8.800 0.000 6.3e-07 0.0
S4A_D63G -8.800 0.000 6e-07 0.0
S4G_A98Q -8.900 0.000 5.5e-07 0.0
S4G_A88E -8.900 0.000 5.2e-07 0.0
S4A_V33A -8.900 0.000 5.1e-07 0.0
S4F_D63I -9.000 0.000 4.6e-07 0.0
S4A_A98Q -9.000 0.000 4.4e-07 0.0
S4Y_G1Q -9.100 0.000 3.8e-07 0.0
S4A_I22F -9.100 0.000 3.9e-07 0.0
S4G_E46D -9.100 0.000 4.1e-07 0.0
S4G_K79E -9.100 0.000 3.7e-07 0.0
S4G_H66A -9.100 0.000 3.9e-07 0.0
S4A_K106L -9.100 0.000 3.9e-07 0.0
S4Y_A89L -9.200 0.000 3.4e-07 0.0
S4G_W90P -9.200 0.000 3.4e-07 0.0
S4A_K65R -9.200 0.000 3.2e-07 0.0
S4G_L81E -9.300 0.000 2.6e-07 0.0
S4A_I95A -9.300 0.000 2.9e-07 0.0
S4G_L30M -9.300 0.000 2.9e-07 0.0
S4G_W90G -9.300 0.000 2.7e-07 0.0
S4L_H75I -9.300 0.000 3e-07 0.0
Nddm -12.700 0.000 1.2e-09 0.0
Table 4. Triple site-specific mutation-based analysis of the binding affinities between two nerve growth factor monomers. Prodigy [55] is used to calculate the binding energy and Kd between two nerve growth factor monomers. In this table, the row for Nddm (yellow background) represents the binding affinity between two native nerve growth factor monomers.
Table 4. Triple site-specific mutation-based analysis of the binding affinities between two nerve growth factor monomers. Prodigy [55] is used to calculate the binding energy and Kd between two nerve growth factor monomers. In this table, the row for Nddm (yellow background) represents the binding affinity between two native nerve growth factor monomers.
Mutation Energy mean Energy std Kd mean Kd std
S4A_A98Q_V33A -7.400 0.000 5.8e-06 0.0
S4A_A98Q_V33G -7.400 0.000 6.1e-06 0.0
S4G_A98Q_K79P -7.500 0.000 4.7e-06 0.0
S4G_A98Q_W90A -7.500 0.000 4.8e-06 0.0
S4Y_A98Q_R105I -7.500 0.000 5.5e-06 0.0
S4Y_A98Q_K41P -7.600 0.000 4.2e-06 0.0
S4F_A98Q_Y70L -7.700 0.000 3.5e-06 0.0
S4G_A98Q_W90V -7.700 0.000 4e-06 0.0
S4F_A98Q_K41V -7.700 0.000 3.5e-06 0.0
S4G_A98Q_K79M -7.700 0.000 3.5e-06 0.0
S4A_A98Q_L81A -7.700 0.000 3.5e-06 0.0
S4Y_A98Q_K41V -7.800 0.000 3.2e-06 0.0
S4A_A98Q_W12G -7.800 0.000 3.1e-06 0.0
S4F_A98Q_L81K -7.800 0.000 3e-06 0.0
S4G_A98Q_Q42G -7.800 0.000 2.9e-06 0.0
S4L_L81G_I35Q -7.800 0.000 3e-06 0.0
S4G_A98Q_K41P -7.800 0.000 3.4e-06 0.0
S4G_A98Q_D63G -7.900 0.000 2.9e-06 0.0
S4F_A98Q_K79G -7.900 0.000 2.5e-06 0.0
S4G_A98Q_R105G -7.900 0.000 2.5e-06 0.0
Nddm -12.700 0.000 1.2e-09 0.0
As quantitatively described in Table 2, Table 3 and Table 4, the binding affinity (Kd) between two native nerve growth factor monomers at 37 °C is 1.2 × 10-9 M, while the binding affinity (Kd) between two nerve growth factor analogue monomers at 37 °C is reduced to as low as 5.8 × 10-6 M (i.e., the S 4 A _ A 98 Q _ V 33 A site-specific mutations for native NGF monomers) with a set of triple site-specific mutations introduced into the amino acid sequence of native NGF sequence, towards the disruption of the homodimer of NGF and the suppression of NGF-related chronic pain signaling mediated by the p75NTR-NGF-TrkA complex (PDB ID 2IFG [48]).

4. Conclusions and Discussion

Overall, this article for the first time puts forward a set of NGF analogues, including in particular NGF analogues with four site-specific mutations, for whose dimerizations the Kd at 37 °C were reduced by three orders of magnitude (from 10-9 M to 10-6 M) compared to the Kd at 37 °C for the dimerization of native NGFs. As discussed above, a structural and biophysical perspective (Figure 3) is crucial in guiding the rational design of these analogues, ensuring a nuanced understanding of the intricate molecular mechanisms involved in pain transduction and enabling the development of therapeutics with enhanced specificity and efficacy [56,57,58,59,60]. Hence, the investigation here of the design of NGF analogues, targeted at suppressing pain signal transduction mediated by the p75 neurotrophin receptor (p75NTR)-NGF-tyrosine kinase receptor A (TrkA) complex, has yielded valuable insights into the potential for developing innovative analgesic interventions [61,62,63,64,65].
Of further pharmaceutical interest is the integration of experimental biophysical techniques complemented our computational predictions, offering a dynamic perspective on the interactions between the designed analogues and the complex [66,67,68,69]. In the realm of drug discovery and design, the quest for innovative therapeutic interventions to alleviate chronic pain has become a pivotal focus. Chronic pain, a pervasive and debilitating condition, poses a significant clinical challenge, necessitating the exploration of novel targets and strategies. Among the various molecular players implicated in pain signal transduction, the p75 neurotrophin receptor (p75NTR)-nerve growth factor (NGF)-tyrosine kinase receptor A (TrkA) complex has emerged as a promising nexus for intervention [70,71,72,73,74].
In short, the use of NGF analogues in drug discovery heralds a paradigm shift in the approach to pain modulation. By harnessing insights from structural and biophysical perspectives, researchers can tailor NGF analogues to disrupt specific interactions within the p75NTR-NGF-TrkA complex. This precision allows for the design of therapeutics with the potential to selectively dampen pain signaling pathways while minimizing off-target effects [75,76,77,78,79,80,81,82].
In conclusion, the structural and biophysical perspective on designing NGF analogues to suppress pain signal transduction provides a robust foundation for the development of targeted analgesic therapies. By elucidating the structural biophysics underlying the p75NTR-NGF-TrkA complex, this article contributes valuable knowledge to the field, paving the way for the next generation of therapeutic strategies aimed at alleviating chronic pain [83,84,85,86,87,88,89,90,91].

5. Ethical Statement

No ethical approval is required.

6. Declaration of Generative AI and AI-Assisted Technologies in the Writing Process

During the preparation of this work, the author used OpenAI’s ChatGPT in order to improve the readability of the manuscript, and to make it as concise and short as possible. After using this tool, the author reviewed and edited the content as needed and takes full responsibility for the content of the publication.

Author Contributions

Conceptualization, W.L.; methodology, W.L.; software, W.L.; validation, W.L.; formal analysis, W.L.; investigation, W.L.; resources, W.L.; data duration, W.L.; writing–original draft preparation, W.L.; writing–review and editing, W.L.; visualization, W.L.; supervision, W.L.; project administration, W.L.; funding acquisition, not applicable.

Funding

This research received no external funding.

Conflicts of Interest

The author declares no conflict of interest.

References

  1. Rankin, S.L.; Guy, C.S.; Mearow, K.M. TrkA NGF receptor plays a role in the modulation of p75NTR expression. Neuroscience Letters 2005, 383, 305–310. [Google Scholar] [CrossRef]
  2. White, D.M.; Mansfield, K.; Kelleher, K. Increased neurite outgrowth of cultured rat dorsal root ganglion cells following transection or inhibition of axonal transport of the sciatic nerve. Neuroscience Letters 1996, 208, 93–96. [Google Scholar] [CrossRef]
  3. Xu, Z.L.; Chen, G.; Liu, X.; Xie, D.; Zhang, J.; Ying, Y. Effects of ginsenosides on memory impairment in propofol-anesthetized rats. Bioengineered 2021, 13, 617–623. [Google Scholar] [CrossRef]
  4. Genty, J.; Tetsi Nomigni, M.; Anton, F.; Hanesch, U. The combination of postnatal maternal separation and social stress in young adulthood does not lead to enhanced inflammatory pain sensitivity and depression-related behavior in rats. PLOS ONE 2018, 13, e0202599. [Google Scholar] [CrossRef]
  5. Koo, H.M.; Yong, M.S.; Na, S.S. The effect of low-intensity laser therapy (LILT) on cutaneous wound healing and pain relief in rats. Journal of Physical Therapy Science 2015, 27, 3421–3423. [Google Scholar] [CrossRef]
  6. Bishop, T.; Hewson, D.W.; Yip, P.K.; Fahey, M.S.; Dawbarn, D.; Young, A.R.; McMahon, S.B. Characterisation of ultraviolet-B-induced inflammation as a model of hyperalgesia in the rat. Pain 2007, 131, 70–82. [Google Scholar] [CrossRef]
  7. Kashyap, M.P.; Roberts, C.; Waseem, M.; Tyagi, P. Drug Targets in Neurotrophin Signaling in the Central and Peripheral Nervous System. Molecular Neurobiology 2018, 55, 6939–6955. [Google Scholar] [CrossRef]
  8. Das, V.; Kc, R.; Li, X.; O-Sullivan, I.; van Wijnen, A.J.; Kroin, J.S.; Pytowski, B.; Applegate, D.T.; Votta-Velis, G.; Ripper, R.L.; et al. Blockade of vascular endothelial growth factor receptor-1 (Flt-1), reveals a novel analgesic for osteoarthritis-induced joint pain. Gene Reports 2018, 11, 94–100. [Google Scholar] [CrossRef]
  9. Gugliandolo, E.; Peritore, A.f.; Impellizzeri, D.; Cordaro, M.; Siracusa, R.; Fusco, R.; D’Amico, R.; Di Paola, R.; Schievano, C.; Cuzzocrea, S.; et al. Dietary Supplementation with Palmitoyl-Glucosamine Co-Micronized with Curcumin Relieves Osteoarthritis Pain and Benefits Joint Mobility. Animals 2020, 10, 1827. [Google Scholar] [CrossRef]
  10. Vellani, V.; Kinsey, A.M.; Prandini, M.; Hechtfischer, S.C.; Reeh, P.; Magherini, P.C.; Giacomoni, C.; McNaughton, P.A. Protease Activated Receptors 1 and 4 Sensitize TRPV1 in Nociceptive Neurones. Molecular Pain 2010, 6, 1744-8069-6-61. [Google Scholar] [CrossRef]
  11. Kingery, W.S. Role of Neuropeptide, Cytokine, and Growth Factor Signaling in Complex Regional Pain Syndrome. Pain Medicine 2010, 11, 1239–1250. [Google Scholar] [CrossRef] [PubMed]
  12. Ma, Z.; Huang, Z.; Zhang, L.; Li, X.; Xu, B.; Xiao, Y.; Shi, X.; Zhang, H.; Liao, T.; Wang, P. Vanillic Acid Reduces Pain-Related Behavior in Knee Osteoarthritis Rats Through the Inhibition of NLRP3 Inflammasome-Related Synovitis. Frontiers in Pharmacology 2021, 11. [Google Scholar] [CrossRef] [PubMed]
  13. Day-Williams, A.; Southam, L.; Panoutsopoulou, K.; Rayner, N.; Esko, T.; Estrada, K.; Helgadottir, H.; Hofman, A.; Ingvarsson, T.; Jonsson, H.; et al. A Variant in MCF2L Is Associated with Osteoarthritis. The American Journal of Human Genetics 2011, 89, 446–450. [Google Scholar] [CrossRef] [PubMed]
  14. Isa, I.L.M.; Srivastava, A.; Tiernan, D.; Owens, P.; Rooney, P.; Dockery, P.; Pandit, A. Hyaluronic Acid Based Hydrogels Attenuate Inflammatory Receptors and Neurotrophins in Interleukin-1β Induced Inflammation Model of Nucleus Pulposus Cells. Biomacromolecules 2015, 16, 1714–1725. [Google Scholar] [CrossRef]
  15. Facer, P.; Casula, M.A.; Smith, G.D.; Benham, C.D.; Chessell, I.P.; Bountra, C.; Sinisi, M.; Birch, R.; Anand, P. Differential expression of the capsaicin receptor TRPV1 and related novel receptors TRPV3, TRPV4 and TRPM8 in normal human tissues and changes in traumatic and diabetic neuropathy. BMC Neurology 2007, 7. [Google Scholar] [CrossRef] [PubMed]
  16. Liang, R.; Ustinova, E.E.; Patnam, R.; Fraser, M.O.; Gutkin, D.W.; Pezzone, M.A. Enhanced expression of mast cell growth factor and mast cell activation in the bladder following the resolution of trinitrobenzenesulfonic acid (TNBS) colitis in female rats. Neurourology and Urodynamics 2007, 26, 887–893. [Google Scholar] [CrossRef] [PubMed]
  17. Klein, J.P.; Tendi, E.A.; Dib-Hajj, S.D.; Fields, R.D.; Waxman, S.G. Patterned electrical activity modulates sodium channel expression in sensory neurons. Journal of Neuroscience Research 2003, 74, 192–198. [Google Scholar] [CrossRef] [PubMed]
  18. Wijaya, L.K.; Stumbles, P.A.; Drummond, P.D. Tumor necrosis factor α induces α1B-adrenergic receptor expression in keratinocytes. Cytokine 2020, 125, 154851. [Google Scholar] [CrossRef] [PubMed]
  19. Magalhaes, T.F.; Baracat, E.C.; Doumouchtsis, S.K.; Haddad, J.M. Biomarkers in the diagnosis and symptom assessment of patients with bladder pain syndrome: A systematic review. International Urogynecology Journal 2019, 30, 1785–1794. [Google Scholar] [CrossRef]
  20. Li, B.; Jing, L.; Jia, L.; Qian, T.; Jianyi, C.; Zhongsheng, H.; Xiaohong, Z.; Guowei, C. Acupuncture reduces pain in rats with osteoarthritis by inhibiting MCP2CCR2 signaling pathway. Experimental Biology and Medicine 2020, 245, 1722–1731. [Google Scholar] [CrossRef]
  21. D’Arcy, Y.; Mantyh, P.; Yaksh, T.; Donevan, S.; Hall, J.; Sadrarhami, M.; Viktrup, L. Treating osteoarthritis pain: Mechanisms of action of acetaminophen, nonsteroidal anti-inflammatory drugs, opioids, and nerve growth factor antibodies. Postgraduate Medicine 2021, 133, 879–894. [Google Scholar] [CrossRef] [PubMed]
  22. Borgonio Cuadra, V.M.; González-Huerta, N.C.; Romero-Córdoba, S.; Hidalgo-Miranda, A.; Miranda-Duarte, A. Altered Expression of Circulating MicroRNA in Plasma of Patients with Primary Osteoarthritis and In Silico Analysis of Their Pathways. PLoS ONE 2014, 9, e97690. [Google Scholar] [CrossRef] [PubMed]
  23. Schrenker, S.; Gao, L.; Cucchiarini, M.; Madry, H. Future Aspects of Clinical Osteoarthritis Therapies in the Continuum of Translational Research. Zeitschrift für Orthopädie und Unfallchirurgie 2019, 157, 629–643. [Google Scholar] [CrossRef] [PubMed]
  24. Shen, Q.; Zhang, M.; Jin, Y.; Di, X.; Liu, R.; Wang, Z. Safety, Tolerability, Pharmacokinetics, and Immunogenicity of a Novel Recombination Human Nerve Growth Factor in Healthy Chinese Subjects. CNS Drugs 2023, 37, 231–242. [Google Scholar] [CrossRef] [PubMed]
  25. Kissel, C.; Kovács, K.; Larson, A. Evidence for the modulation of nociception in mice by central mast cells. European Journal of Pain 2017, 21, 1743–1755. [Google Scholar] [CrossRef] [PubMed]
  26. LA Binch, A.; Cole, A.A.; Breakwell, L.M.; Michael, A.L.; Chiverton, N.; Cross, A.K.; Le Maitre, C.L. Expression and regulation of neurotrophic and angiogenic factors during human intervertebral disc degeneration. Arthritis Research: Therapy 2014, 16. [Google Scholar] [CrossRef] [PubMed]
  27. Joseph, E.; Levine, J. Mu and delta opioid receptors on nociceptors attenuate mechanical hyperalgesia in rat. Neuroscience 2010, 171, 344–350. [Google Scholar] [CrossRef] [PubMed]
  28. FATANI, A.J.; AL-REJAIE, S.S.; ABUOHASHISH, H.M.; AL-ASSAF, A.; PARMAR, M.Y.; OLA, M.S.; AHMED, M.M. Neuroprotective effects of Gymnema sylvestre on streptozotocin-induced diabetic neuropathy in rats. Experimental and Therapeutic Medicine 2015, 9, 1670–1678. [Google Scholar] [CrossRef] [PubMed]
  29. Cruise, B.A.; Xu, P.; Hall, A.K. Wounds increase activin in skin and a vasoactive neuropeptide in sensory ganglia. Developmental Biology 2004, 271, 1–10. [Google Scholar] [CrossRef]
  30. Shaqura, M.; Khalefa, B.I.; Shakibaei, M.; Winkler, J.; Al-Khrasani, M.; Fürst, S.; Mousa, S.A.; Schäfer, M. Reduced Number, G Protein Coupling, and Antinociceptive Efficacy of Spinal Mu-Opioid Receptors in Diabetic Rats Are Reversed by Nerve Growth Factor. The Journal of Pain 2013, 14, 720–730. [Google Scholar] [CrossRef]
  31. Sharma, H.S.; F. Ali, S.; Patnaik, R.; Zimmermann-Meinzingen, S.; Sharma, A.; F. Muresanu, D. Cerebrolysin Attenuates Heat Shock Protein (HSP 72 KD) Expression in the Rat Spinal Cord Following Morphine Dependence and Withdrawal: Possible New Therapy for Pain Management. Current Neuropharmacology 2011, 9, 223–235. [Google Scholar] [CrossRef] [PubMed]
  32. Tomalty, D.; Giovannetti, O.; Magliocchetti, S.; Williams, A.; Hannan, J.; Komisaruk, B.; Goldstein, S.; Goldstein, I.; Adams, M.A. Characterizing the innervation of the vulvar vestibule and the immunohistochemical features of neuroproliferative vestibulodynia. The Journal of Sexual Medicine 2023, 20, 716–731. [Google Scholar] [CrossRef] [PubMed]
  33. Khan, N.; Muralidharan, A.; Smith, M.T. Attenuation of the Infiltration of Angiotensin II Expressing CD3+ T-Cells and the Modulation of Nerve Growth Factor in Lumbar Dorsal Root Ganglia - A Possible Mechanism Underpinning Analgesia Produced by EMA300, An Angiotensin II Type 2 (AT2) Receptor Antagonist. Frontiers in Molecular Neuroscience 2017, 10. [Google Scholar]
  34. Palma, J.A.; Yadav, R.; Gao, D.; Norcliffe-Kaufmann, L.; Slaugenhaupt, S.; Kaufmann, H. Expanding the Genotypic Spectrum of Congenital Sensory and Autonomic Neuropathies Using Whole-Exome Sequencing. Neurology Genetics 2021, 7, e568. [Google Scholar] [CrossRef] [PubMed]
  35. Chien, C.C.; Fu, W.M.; Huang, H.I.; Lai, Y.H.; Tsai, Y.F.; Guo, S.L.; Wu, T.J.; Ling, Q.D. Expression of Neurotrophic Factors in Neonatal Rats After Peripheral Inflammation. The Journal of Pain 2007, 8, 161–167. [Google Scholar] [CrossRef] [PubMed]
  36. Sonkodi, B. Delayed Onset Muscle Soreness (DOMS): The Repeated Bout Effect and Chemotherapy-Induced Axonopathy May Help Explain the Dying-Back Mechanism in Amyotrophic Lateral Sclerosis and Other Neurodegenerative Diseases. Brain Sciences 2021, 11, 108. [Google Scholar] [CrossRef] [PubMed]
  37. Cherief, M.; Negri, S.; Qin, Q.; Pagani, C.A.; Lee, S.; Yang, Y.P.; Clemens, T.L.; Levi, B.; James, A.W. TrkA+ Neurons Induce Pathologic Regeneration After Soft Tissue Trauma. Stem Cells Translational Medicine 2022, 11, 1165–1176. [Google Scholar] [CrossRef] [PubMed]
  38. Yigitturk, G.; Erbas, O.; Karabay Yavasoglu, N.U.; Acikgoz, E.; Buhur, A.; Gokhan, A.; Gurel, C.; Gunduz, C.; Yavasoglu, A. The neuro-restorative effect of adipose-derived mesenchymal stem cell transplantation on a mouse model of diabetic neuropathy. Neurological Research 2021, 44, 156–164. [Google Scholar] [CrossRef] [PubMed]
  39. Allas, L.; Brochard, S.; Rochoux, Q.; Ribet, J.; Dujarrier, C.; Veyssiere, A.; Aury-Landas, J.; Grard, O.; Leclercq, S.; Vivien, D.; et al. EZH2 inhibition reduces cartilage loss and functional impairment related to osteoarthritis. Scientific Reports 2020, 10. [Google Scholar] [CrossRef]
  40. Scandolera, A.; Hubert, J.; Humeau, A.; Lambert, C.; De Bizemont, A.; Winkel, C.; Kaouas, A.; Renault, J.H.; Nuzillard, J.M.; Reynaud, R. GABA and GABA-Alanine from the Red Microalgae Rhodosorus marinus Exhibit a Significant Neuro-Soothing Activity through Inhibition of Neuro-Inflammation Mediators and Positive Regulation of TRPV1-Related Skin Sensitization. Marine Drugs 2018, 16, 96. [Google Scholar] [CrossRef]
  41. Romero, M.I.; Rangappa, N.; Li, L.; Lightfoot, E.; Garry, M.G.; Smith, G.M. Extensive Sprouting of Sensory Afferents and Hyperalgesia Induced by Conditional Expression of Nerve Growth Factor in the Adult Spinal Cord. The Journal of Neuroscience 2000, 20, 4435–4445. [Google Scholar] [CrossRef]
  42. Shaikh, S.S.; Chen, Y.; Halsall, S.; Nahorski, M.S.; Omoto, K.; Young, G.T.; Phelan, A.; Woods, C.G. A Comprehensive Functional Analysis ofNTRK1Missense Mutations Causing Hereditary Sensory and Autonomic Neuropathy Type IV (HSAN IV). Human Mutation 2016, 38, 55–63. [Google Scholar] [CrossRef] [PubMed]
  43. Kazemi, A.; Rahmati, M.; Eslami, R.; Sheibani, V. Activation of neurotrophins in lumbar dorsal root probably contributes to neuropathic pain after spinal nerve ligation. Iranian Journal of Basic Medical Sciences 2017, 20. [Google Scholar]
  44. Javed, S.; Petropoulos, I.N.; Alam, U.; Malik, R.A. Treatment of painful diabetic neuropathy. Therapeutic Advances in Chronic Disease 2014, 6, 15–28. [Google Scholar] [CrossRef]
  45. Jiang, Y.H.; Jhang, J.F.; Kuo, H.C. Urinary Oxidative Stress Biomarker Levels Might Be Useful in Identifying Functional Bladder Disorders in Women with Frequency and Urgency Syndrome. Journal of Clinical Medicine 2023, 12, 2336. [Google Scholar] [CrossRef] [PubMed]
  46. Xie, W.; Xie, W.; Kang, Z.; Jiang, C.; Liu, N. Administration of Curcumin Alleviates Neuropathic Pain in a Rat Model of Brachial Plexus Avulsion. Pharmacology 2019, 103, 324–332. [Google Scholar] [CrossRef]
  47. Berman, H.; Henrick, K.; Nakamura, H. Announcing the worldwide Protein Data Bank. Nature Structural & Molecular Biology 2003, 10, 980. [Google Scholar]
  48. Wehrman, T.; He, X.; Raab, B.; Dukipatti, A.; Blau, H.; Garcia, K.C. Structural and Mechanistic Insights into Nerve Growth Factor Interactions with the TrkA and p75 Receptors. Neuron 2007, 53, 25–38. [Google Scholar] [CrossRef] [PubMed]
  49. DeLano, W.L. Pymol: An open-source molecular graphics tool. CCP4 Newsletter On Protein Crystallography 2002, 40, 82–92. [Google Scholar]
  50. Li, W. How do SMA-linked mutations of SMN1 lead to structural/functional deficiency of the SMA protein? PLOS ONE 2017, 12, e0178519. [Google Scholar] [CrossRef]
  51. Li, W. Towards a General Intermolecular Binding Affinity Calculator 2022. [CrossRef]
  52. Li, W.; Vottevor, G. Towards a Truly General Intermolecular Binding Affinity Calculator for Drug Discovery and Design 2023. [CrossRef]
  53. Webb, B.; Sali, A. Protein Structure Modeling with MODELLER. In Methods in Molecular Biology; Springer US, 2020; pp. 239–255.
  54. Vangone, A.; Bonvin, A.M. Contacts-based prediction of binding affinity in protein-protein complexes. eLife 2015, 4. [Google Scholar] [CrossRef] [PubMed]
  55. Xue, L.C.; Rodrigues, J.P.; Kastritis, P.L.; Bonvin, A.M.; Vangone, A. PRODIGY: A web server for predicting the binding affinity of protein-protein complexes. Bioinformatics 2016, btw514. [Google Scholar]
  56. Fuji, H.; Qi, F.; Qu, L.; Takaesu, Y.; Hoshino, T. Prediction of Ligand Binding Affinity to Target Proteins by Molecular Mechanics Theoretical Calculation. Chemical and Pharmaceutical Bulletin 2017, 65, 461–468. [Google Scholar] [CrossRef]
  57. Sikandar, S.; Aasvang, E.K.; Dickenson, A.H. Scratching the surface: The processing of pain from deep tissues. Pain Management 2016, 6, 95–102. [Google Scholar] [CrossRef] [PubMed]
  58. Ashraf, S.; Bouhana, K.S.; Pheneger, J.; Andrews, S.W.; Walsh, D.A. Selective inhibition of tropomyosin-receptor-kinase A (TrkA) reduces pain and joint damage in two rat models of inflammatory arthritis. Arthritis Research: Therapy 2016, 18. [Google Scholar] [CrossRef] [PubMed]
  59. Cheng, C.F.; Cheng, J.K.; Chen, C.Y.; Lien, C.C.; Chu, D.; Wang, S.Y.; Tsaur, M.L. Mirror-image pain is mediated by nerve growth factor produced from tumor necrosis factor alpha-activated satellite glia after peripheral nerve injury. Pain 2014, 155, 906–920. [Google Scholar] [CrossRef] [PubMed]
  60. Schnakenberg, M.; Thomas, C.; Schmelz, M.; Rukwied, R. Nerve growth factor sensitizes nociceptors to C-fibre selective supra-threshold electrical stimuli in human skin. European Journal of Pain 2020, 25, 385–397. [Google Scholar] [CrossRef]
  61. Nees, T.A.; Rosshirt, N.; Zhang, J.A.; Reiner, T.; Sorbi, R.; Tripel, E.; Walker, T.; Schiltenwolf, M.; Hagmann, S.; Moradi, B. Synovial Cytokines Significantly Correlate with Osteoarthritis-Related Knee Pain and Disability: Inflammatory Mediators of Potential Clinical Relevance. Journal of Clinical Medicine 2019, 8, 1343. [Google Scholar] [CrossRef] [PubMed]
  62. Xu, Y.; Baylink, D.J.; Chen, C.S.; Reeves, M.E.; Xiao, J.; Lacy, C.; Lau, E.; Cao, H. The importance of vitamin d metabolism as a potential prophylactic, immunoregulatory and neuroprotective treatment for COVID-19. Journal of Translational Medicine 2020, 18. [Google Scholar] [CrossRef]
  63. Sharma, P.; Rani, N.; Gangwar, A.; Singh, R.; Kaur, R.; Upadhyaya, K. Diabetic Neuropathy: A Repercussion of Vitamin D Deficiency. Current Diabetes Reviews 2023, 19. [Google Scholar] [CrossRef]
  64. Tanaka, Y.; Niwa, S.; Dong, M.; Farkhondeh, A.; Wang, L.; Zhou, R.; Hirokawa, N. The Molecular Motor KIF1A Transports the TrkA Neurotrophin Receptor and Is Essential for Sensory Neuron Survival and Function. Neuron 2016, 90, 1215–1229. [Google Scholar] [CrossRef]
  65. Subedi, L.; Gaire, B.P.; Do, M.H.; Lee, T.H.; Kim, S.Y. Anti-neuroinflammatory and neuroprotective effects of the Lindera neesiana fruit in vitro. Phytomedicine 2016, 23, 872–881. [Google Scholar] [CrossRef] [PubMed]
  66. Anand, U.; Otto, W.; Facer, P.; Zebda, N.; Selmer, I.; Gunthorpe, M.; Chessell, I.; Sinisi, M.; Birch, R.; Anand, P. TRPA1 receptor localisation in the human peripheral nervous system and functional studies in cultured human and rat sensory neurons. Neuroscience Letters 2008, 438, 221–227. [Google Scholar] [CrossRef] [PubMed]
  67. Araújo-filho, H.G.; Pereira, E.W.; Heimfarth, L.; Souza Monteiro, B.; Santos Passos, F.R.; Siqueira-Lima, P.; Gandhi, S.R.; Viana dos Santos, M.R.; Guedes da Silva Almeida, J.R.; Picot, L.; et al. Limonene, a food additive, and its active metabolite perillyl alcohol improve regeneration and attenuate neuropathic pain after peripheral nerve injury: Evidence for IL-1β, TNF-α, GAP, NGF and ERK involvement. International Immunopharmacology 2020, 86, 106766. [Google Scholar] [CrossRef] [PubMed]
  68. Evans, L.J.; Loescher, A.R.; Boissonade, f.M.; Whawell, S.A.; Robinson, P.P.; Andrew, D. Temporal mismatch between pain behaviour, skin Nerve Growth Factor and intra-epidermal nerve fibre density in trigeminal neuropathic pain. BMC Neuroscience 2014, 15. [Google Scholar] [CrossRef]
  69. Nauta, H.J.W.; Wehman, J.C.; Koliatsos, V.E.; Terrell, M.A.; Chung, K. Intraventricular infusion of nerve growth factor as the cause of sympathetic fiber sprouting in sensory ganglia. Journal of Neurosurgery 1999, 91, 447–453. [Google Scholar] [CrossRef] [PubMed]
  70. Spezia Adachi, L.N.; Vercelino, R.; de Oliveira, C.; Scarabelot, V.L.; de Souza, A.; Medeiros, L.F.; Cioato, S.G.; Caumo, W.; Torres, I.L. Isoflurane and the Analgesic Effect of Acupuncture and Electroacupuncture in an Animal Model of Neuropathic Pain. Journal of Acupuncture and Meridian Studies 2018, 11, 97–106. [Google Scholar] [CrossRef]
  71. Obata, K.; Yamanaka, H.; Dai, Y.; Mizushima, T.; Fukuoka, T.; Tokunaga, A.; Noguchi, K. Activation of extracellular signal-regulated protein kinase in the dorsal root ganglion following inflammation near the nerve cell body. Neuroscience 2004, 126, 1011–1021. [Google Scholar] [CrossRef] [PubMed]
  72. Malerba, F.; Paoletti, F.; Bruni Ercole, B.; Materazzi, S.; Nassini, R.; Coppi, E.; Patacchini, R.; Capsoni, S.; Lamba, D.; Cattaneo, A. Functional Characterization of Human ProNGF and NGF Mutants: Identification of NGF P61SR100E as a ’Painless’ Lead Investigational Candidate for Therapeutic Applications. PLOS ONE 2015, 10, e0136425. [Google Scholar] [CrossRef]
  73. Jönhagen, M.E. Nerve Growth Factor Treatment in Dementia. Alzheimer Disease and Associated Disorders 2000, 14, S31–S38. [Google Scholar] [CrossRef] [PubMed]
  74. Yasui, M.; Shiraishi, Y.; Ozaki, N.; Hayashi, K.; Hori, K.; Ichiyanagi, M.; Sugiura, Y. Nerve growth factor and associated nerve sprouting contribute to local mechanical hyperalgesia in a rat model of bone injury. European Journal of Pain 2011, 16, 953–965. [Google Scholar] [CrossRef]
  75. Andres, C.; Meyer, S.; Dina, O.A.; Levine, J.D.; Hucho, T. Quantitative Automated Microscopy (QuAM) Elucidates Growth Factor Specific Signalling in Pain Sensitization. Molecular Pain 2010, 6, 1744–8069–6–98. [Google Scholar] [CrossRef] [PubMed]
  76. Ramer, M.S.; Thompson, S.W.; McMahon, S.B. Causes and consequences of sympathetic basket formation in dorsal root ganglia. Pain 1999, 82, S111–S120. [Google Scholar] [CrossRef] [PubMed]
  77. Yu, H.M.; Wang, Q.; Sun, W.B. Silencing of FKBP51 alleviates the mechanical pain threshold, inhibits DRG inflammatory factors and pain mediators through the NF-kappaB signaling pathway. Gene 2017, 627, 169–175. [Google Scholar] [CrossRef] [PubMed]
  78. Severini, C.; Petrocchi Passeri, P.; Ciotti, M.; Florenzano, F.; Petrella, C.; Malerba, F.; Bruni, B.; D’Onofrio, M.; Arisi, I.; Brandi, R.; et al. Nerve growth factor derivative NGF61100 promotes outgrowth of primary sensory neurons with reduced signs of nociceptive sensitization. Neuropharmacology 2017, 117, 134–148. [Google Scholar] [CrossRef] [PubMed]
  79. Alhilou, A.M.; Shimada, A.; Svensson, C.I.; Svensson, P.; Ernberg, M.; Cairns, B.E.; Christidis, N. Sex-related differences in response to masseteric injections of glutamate and nerve growth factor in healthy human participants. Scientific Reports 2021, 11. [Google Scholar] [CrossRef] [PubMed]
  80. Krock, E.; Rosenzweig, D.H.; Chabot-Doré, A.; Jarzem, P.; Weber, M.H.; Ouellet, J.A.; Stone, L.S.; Haglund, L. Painful, degenerating intervertebral discs up-regulate neurite sprouting and CGRP- through nociceptive factors. Journal of Cellular and Molecular Medicine 2014, 18, 1213–1225. [Google Scholar] [CrossRef] [PubMed]
  81. Handa, J.; Sekiguchi, M.; Krupkova, O.; Konno, S.i. The effect of serotonin-noradrenaline reuptake inhibitor duloxetine on the intervertebral disk-related radiculopathy in rats. European Spine Journal 2015, 25, 877–887. [Google Scholar] [CrossRef] [PubMed]
  82. Park, E.; Moon, S.; Suh, H.; Hochman, S.; Lee, M.G.; Kim, Y.; Jang, I.; Han, H. Disc degeneration induces a mechano-sensitization of disc afferent nerve fibers that associates with low back pain. Osteoarthritis and Cartilage 2019, 27, 1608–1617. [Google Scholar] [CrossRef] [PubMed]
  83. Hepner, D.L.; Arriaga, A.F.; Cooper, J.B.; Goldhaber-fiebert, S.N.; Gaba, D.M.; Berry, W.R.; Boorman, D.J.; Bader, A.M. Operating Room Crisis Checklists and Emergency Manuals. Anesthesiology 2017, 127, 384–392. [Google Scholar] [CrossRef]
  84. Jiang, Y.H.; Jhang, J.F.; Hsu, Y.H.; Ho, H.C.; Wu, Y.H.; Kuo, H.C. Urine biomarkers in ESSIC type 2 interstitial cystitisbladder pain syndrome and overactive bladder with developing a novel diagnostic algorithm. Scientific Reports 2021, 11. [Google Scholar]
  85. Hasenauer, J.; Hasenauer, C.; Hucho, T.; Theis, F.J. ODE Constrained Mixture Modelling: A Method for Unraveling Subpopulation Structures and Dynamics. PLoS Computational Biology 2014, 10, e1003686. [Google Scholar] [CrossRef] [PubMed]
  86. Wu, B.; Guo, X.; Yan, X.; Tian, Z.; Jiang, W.; He, X. TSG-6 inhibits IL-1β-induced inflammatory responses and extracellular matrix degradation in nucleus pulposus cells by activating the PI3KAkt signaling pathway. Journal of Orthopaedic Surgery and Research 2022, 17. [Google Scholar] [CrossRef]
  87. Kashima, S.; Roberto, P.G.; Soares, A.M.; Astolfi-filho, S.; Pereira, J.O.; Giuliati, S.; Faria, M.F., Jr.; Xavier, M.A.; Fontes, M.R.; Giglio, J.R.; et al. Analysis of Bothrops jararacussu venomous gland transcriptome focusing on structural and functional aspects11All sequence data reported in this paper will appear in the GenBank database under the following accession numbers: BOJU-I (AY 185200), BOJU-II (AY 185206), BOJU-III (AY 145836), BOJUMET-I (AY 55005), BOJUMET-II (AY 25584), BOJUMET-III (AY 258153), C-type lectin (AY 251283), serine-proteases (AY 251282).: I-gene expression profile of highly expressed phospholipases A2. Biochimie 2004, 86, 211–219. [Google Scholar] [PubMed]
  88. Xu, P.; Van Slambrouck, C.; Berti-Mattera, L.; Hall, A.K. Activin Induces Tactile Allodynia and Increases Calcitonin Gene-Related Peptide after Peripheral Inflammation. The Journal of Neuroscience 2005, 25, 9227–9235. [Google Scholar] [CrossRef] [PubMed]
  89. Kovačič, U.; Tesovnik, B.; Molnar, N.; Cör, A.; Skalerič, U.; Gašperšič, R. Dental pulp and gingivomucosa in rats are innervated by two morphologically and neurochemically different populations of nociceptors. Archives of Oral Biology 2013, 58, 788–795. [Google Scholar] [CrossRef]
  90. De Oliveira, C.C.; Gouveia, F.V.; de Castro, M.C.; Kuroki, M.A.; dos Santos, L.C.T.; Fonoff, E.T.; Teixeira, M.J.; Otoch, J.P.; Martinez, R.C.R. A Window on the Study of Aversive Instrumental Learning: Strains, Performance, Neuroendocrine, and Immunologic Systems. Frontiers in Behavioral Neuroscience 2016, 10. [Google Scholar] [CrossRef]
  91. Anand, U.; Oldfield, C.; Pacchetti, B.; Anand, P.; Sodergren, M.H. Dose-Related Inhibition of Capsaicin Responses by Cannabinoids CBG, CBD, THC and their Combination in Cultured Sensory Neurons. Journal of Pain Research 2021, Volume 14, 3603–3614. [Google Scholar] [CrossRef]
Figure 2. A closer look of the homodimer of two native NGF molecules as determined by X-ray diffraction (PDB ID 2IFG [48]). This figure is prepared by PyMol [49].
Figure 2. A closer look of the homodimer of two native NGF molecules as determined by X-ray diffraction (PDB ID 2IFG [48]). This figure is prepared by PyMol [49].
Preprints 102483 g002
Figure 3. Flowchart of the design of NGF analogues to disrupt the NGF homodimer and suppress pain signal transduction mediated by the p75NTR-NGF-TrkA complex.
Figure 3. Flowchart of the design of NGF analogues to disrupt the NGF homodimer and suppress pain signal transduction mediated by the p75NTR-NGF-TrkA complex.
Preprints 102483 g003
Table 1. Experimentally determined NGF-related structures (released newest from oldest) in the Protein Data Bank (PDB [47]) as of March 28, 2024, QUERY code: Additional Structure Keywords HAS EXACT PHRASE “NERVE, GROWTH FACTOR”.
Table 1. Experimentally determined NGF-related structures (released newest from oldest) in the Protein Data Bank (PDB [47]) as of March 28, 2024, QUERY code: Additional Structure Keywords HAS EXACT PHRASE “NERVE, GROWTH FACTOR”.
PDB ID Structure Title (release date from newest to oldest)
8DWN Crystal structure of bis-phosphorylated insulin receptor kinase domain
6PL1 TRK-A IN COMPLEX WITH LIGAND 1B
6NPT TRK-A IN COMPLEX WITH LIGAND 1
6NSP TRK-A IN COMPLEX WITH LIGAND 9
6NSS TRK-A IN COMPLEX WITH LIGAND 6
5WR7 Crystal structure of Trk-A complexed with a selective inhibitor CH7057288
4XPJ Crystal structure of Nerve growth factor in complex with lysophosphatidylinositol
4NWT Crystal structure of the anti-human NGF Fab APE1531
4NWU Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in CDR H1
2LPN Solution Structure of N-Terminal domain of human Conserved Dopamine Neurotrophic Factor (CDNF)
4EFV Crystal structure of OIF from Llama seminal plasma
2IFG Structure of the extracellular segment of human TRKA in complex with nerve growth factor
1SG1 Crystal Structure of the Receptor-Ligand Complex between Nerve Growth Factor and the Common Neurotrophin Receptor p75
1HE7 Human Nerve growth factor receptor TrkA
1WWW NGF IN COMPLEX WITH DOMAIN 5 OF THE TRKA RECEPTOR
1BTG CRYSTAL STRUCTURE OF BETA NERVE GROWTH FACTOR AT 2.5 A RESOLUTION IN C2 SPACE GROUP WITH ZN IONS BOUND
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
Copyright: This open access article is published under a Creative Commons CC BY 4.0 license, which permit the free download, distribution, and reuse, provided that the author and preprint are cited in any reuse.
Prerpints.org logo

Preprints.org is a free preprint server supported by MDPI in Basel, Switzerland.

Subscribe

© 2026 MDPI (Basel, Switzerland) unless otherwise stated

Accessibility

Disclaimer

Terms of Use

Privacy Policy

Privacy Settings