Submitted:
23 January 2024
Posted:
24 January 2024
You are already at the latest version
Abstract
Keywords:
1. Background on Immunological Peptides
2. Metrics of Peptide Structure Similarity
2.1. TM-score and the RMSD metric
2.2. Peptide Structure Data
| curl -O https://ftp.ebi.ac.uk/pub/databases/alphafold/latest/UP000000589_10090_MOUSE_v4.tar |
| tar -xvf UP000000589_10090_MOUSE_v4.tar *.pdb.gz |
| gzip -d *.gz |
2.2.1. Parsing the PDB Data Files
| https://www.cgl.ucsf.edu/chimera/docs/UsersGuide/tutorials/pdbintro.html |
2.2.2. Format of Data Files for TM-score
3. Peptide Structure Analysis in Immunogenetics
3.1. Significance Levels for TM-score
3.2. Local versus Global Factors of Protein Structure
4. Recognition of Peptides by T Cells
5. Model of T Cell Receptor Structure
5.1. Overview of the ImmuneBuilder Method
5.2. Usage of TCRBuilder2
5.3. Verification of the TCRBuilder2 Model
| tmscore 5d2l_prediction_A.pdb 5d2l_ChainA-I.pdb > 5d2l_A_RMSD.out tmscore 5d2l_prediction_B.pdb 5d2l_ChainB-J.pdb > 5d2l_B_RMSD.out |
| tmscore 5d2l_prediction_A.pdb 5d2l_ChainA-I.pdb -o 5d2l_A_SUP tmscore 5d2l_prediction_B.pdb 5d2l_ChainB-J.pdb -o 5d2l_B_SUP |
5.4. Comments on TCR Modeling by Deep Learning
6. Molecular Signature of Peptide Immunogenicity
7. Deep Learning and Immunogenetics
7.1. Deep Learning Architectures
7.2. Meta-Learning Systems
7.3. Interpolation and Extrapolation in Deep Learning
8. Conclusion
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
Appendix A
| https://www.cgl.ucsf.edu/chimera/docs/UsersGuide/tutorials/pdbintro.html |
| import glob from Bio.PDB.PDBParser import PDBParser # assign functions parser = PDBParser() # input file for file in glob.glob('./*.pdb'): print("file: ", file) # retrieve PDB structure structure = parser.get_structure(file, file) # iterate over models and chains in file for model in structure: print("model: ", model) for chain in model: print("chain: ", chain) |
| import os directory = 'C:/Peptide3d/data' files = os.listdir(directory) for file in files: if file.endswith('pdb'): print(file) pdb_file = file with open(pdb_file, 'r') as f: lines = f.readlines() current_residue = None start_residue = 1 current_residue_number = start_residue - 1 for i, line in enumerate(lines): if line.startswith('ATOM'): residue = line[22:26] if residue != current_residue: current_residue = residue current_residue_number += 1 lines[i] = line[:22] + str(current_residue_number).rjust(4) \ + line[26:] if line.startswith('TER'): residue = line[22:26] if residue != current_residue: current_residue = residue lines[i] = line[:22] + \ str(current_residue_number).rjust(4) + line[26:] with open(pdb_file, 'w') as f: f.writelines(lines) |
Appendix B
| # Edit sequence_1, sequence_2, filename - the input data for prediction of 3d structure # The Colab runtime may report a crash from an expected restart during installation of a library # Comment out this line to enable verbose output %%capture !pip install ImmuneBuilder # use Python installer to install ImmuneBuilder (TCRBuilder2) !pip install -q condacolab # google colab-compatible access to conda import condacolab, sys # import modules to access their functions condacolab.install_mambaforge() # use of mamba to install conda modules !mamba install openmm # install openmm (toolkit for molecular simulation; refine prediction) !mamba install pdbfixer # install pdbfixer (fix problems in PDB formatted files) !conda install -y -c bioconda anarci # install anarci module from bioconda distribution |
| # Delete and restart Colab runtime to avoid unexpected errors in the following code # Comment out this line to enable verbose output %%capture !pip install -q ImmuneBuilder # use Python installer to install ImmuneBuilder (TCRBuilder2) protein_type = "TCR" from anarci import number # github.com/oxpig/ANARCI; aligns sequence to canonical protein from ImmuneBuilder import TCRBuilder2 # prediction of 3d structure # Select model predictor = TCRBuilder2() # "TCRBuilder2" or "ABodyBuilder2" model # Inspect that TCR sequences are annotated as TCR alpha and beta chains # Below is sequence data from www.rcsb.org/structure/5d2l sequence_1 = 'MILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSP\ EALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAFITGNQFYF\ GTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDK\ CVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESS' sequence_2 = 'MGAGVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQRLGQGLE\ FLIYFQGNSAPDKSGLPSDRFSAERTGESVSTLTIQRTQQEDSAVYLCASSQTQLWET\ QYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSW\ WVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQF\ YGLSENDEWTQDRAKPVTQIVSAEAWGRAD' sequence_1 = "".join(sequence_1.split()) # Remove whitespace sequence_2 = "".join(sequence_2.split()) # Remove whitespace filename = 'output.pdb' # output file name as PDB formatted file (viewable in RasMol) # Anarci will reject the sequence if it is not an expected match to the immunoprotein _, chain1 = number(sequence_1) # set key for chain 1 to input sequence _, chain2 = number(sequence_2) # set key for chain 2 to input sequence input = dict() # initialize hash table of key-value pairs if chain1: input[chain1] = sequence_1 # add sequence value to key for hash table if chain2: input[chain2] = sequence_2 # add sequence value to key for hash table predictor.predict(input).save(filename) # run 3d prediction of TCR, save to file |
References
- Wieczorek, M.; Abualrous, E.T.; Sticht, J.; Álvaro-Benito, M.; Stolzenberg, S.; Noé, F.; Freund, C. Major Histocompatibility Complex (MHC) Class I and MHC Class II Proteins: Conformational Plasticity in Antigen Presentation. Front. Immunol. 2017, 8, 292. [Google Scholar] [CrossRef] [PubMed]
- Dhatchinamoorthy, K.; Colbert, J.D.; Rock, K.L. Cancer Immune Evasion Through Loss of MHC Class I Antigen Presentation. Front. Immunol. 2021, 12, 636568. [Google Scholar] [CrossRef]
- Peters, B.; Nielsen, M.; Sette, A. T Cell Epitope Predictions. Annu. Rev. Immunol. 2020, 38, 123–145. [Google Scholar] [CrossRef] [PubMed]
- Engelhard, V.H. Structure of peptides associated with MHC class I molecules. Curr. Opin. Immunol. 1994, 6, 13–23. [Google Scholar] [CrossRef] [PubMed]
- Davis, M.M.; Bjorkman, P.J. T-cell antigen receptor genes and T-cell recognition. Nature 1988, 335, 744–744. [Google Scholar] [CrossRef]
- Serwold, T.; Gonzalez, F.; Kim, J.; Jacob, R.; Shastri, N. ERAAP customizes peptides for MHC class I molecules in the endoplasmic reticulum. Nature 2002, 419, 480–483. [Google Scholar] [CrossRef] [PubMed]
- Clevers, H. The T Cell Receptor/Cd3 Complex: A Dynamic Protein Ensemble. Annu. Rev. Immunol. 1988, 6, 629–662. [Google Scholar] [CrossRef] [PubMed]
- Theofilopoulos, A.N.; Kono, D.H.; Baccala, R. The multiple pathways to autoimmunity. Nat. Immunol. 2017, 18, 716–724. [Google Scholar] [CrossRef]
- Uemura, Y.; Senju, S.; Maenaka, K.; Iwai, L.K.; Fujii, S.; Tabata, H.; Tsukamoto, H.; Hirata, S.; Chen, Y.Z.; Nishimura, Y.; et al. Systematic Analysis of the Combinatorial Nature of Epitopes Recognized by TCR Leads to Identification of Mimicry Epitopes for Glutamic Acid Decarboxylase 65-Specific TCRs. J Immunol. 2003, 170, 947–960. [Google Scholar] [CrossRef]
- Borrman, T.; Pierce, B.G.; Vreven, T.; Baker, B.M.; Weng, Z. High-throughput modeling and scoring of TCR-pMHC complexes to predict cross-reactive peptides. Bioinform. 2020, 36, 5377–5385. [Google Scholar] [CrossRef]
- Prinz, J.C. Immunogenic self-peptides - the great unknowns in autoimmunity: Identifying T-cell epitopes driving the autoimmune response in autoimmune diseases. Front. Immunol. 2023, 13, 1097871. [Google Scholar] [CrossRef] [PubMed]
- Yanagi, Y.; Yoshikai, Y.; Leggett, K.; Clark, S.P.; Aleksander, I.; Mak, T.W. A human T cellspecific cDNA clone encodes a protein having extensive homology to immunoglobulin chains. Nature 1984, 308, 145–149. [Google Scholar] [CrossRef] [PubMed]
- Hedrick, S.M.; Cohen, D.I.; Nielsen, E.A.; Davis, M.M. Isolation of cDNA clones encoding T cell-specific membrane-associated proteins. Nature 1984, 308, 149–153. [Google Scholar] [CrossRef] [PubMed]
- Yang, Q.; Bell, J.J.; Bhandoola, A. T-cell lineage determination. Immunol. Rev. 2010, 238, 12–22. [Google Scholar] [CrossRef] [PubMed]
- Nikolich-Žugich, J.; Slifka, M.K.; Messaoudi, I. The many important facets of T-cell repertoire diversity. Nat. Rev. Immunol. 2004, 4, 123–132. [Google Scholar] [CrossRef]
- Ashby, K.M.; Hogquist, K.A. A guide to thymic selection of T cells. Nat. Rev. Immunol. 2023, 23, 697. [Google Scholar] [CrossRef]
- George, J.T.; Kessler, D.A.; Levine, H. Effects of thymic selection on T cell recognition of foreign and tumor antigenic peptides. Proc. Natl. Acad. Sci USA 2017, 114, E7875–E7881. [Google Scholar] [CrossRef] [PubMed]
- Smith, D.A.; Germolec, D.R. Introduction to Immunology and Autoimmunity. Environ. Heal. Perspect. 1999, 107, 661. [Google Scholar]
- J Klein; F Figueroa Evolution of the major histocompatibility complex. Crit. Rev. Immunol. 1986, 6, 295–386.
- Germain, R.N. MHC-dependent antigen processing and peptide presentation: Providing ligands for T lymphocyte activation. Cell 1994, 76, 287–299. [Google Scholar] [CrossRef]
- Nielsen, M.; Andreatta, M.; Peters, B.; Buus, S. Immunoinformatics: Predicting Peptide–MHC Binding. Annu. Rev. Biomed. Data Sci. 2020, 3, 191–215. [Google Scholar] [CrossRef] [PubMed]
- Radwan, J.; Babik, W.; Kaufman, J.; Lenz, T.L.; Winternitz, J. Advances in the Evolutionary Understanding of MHC Polymorphism. Trends Genet. 2020, 36, 298–311. [Google Scholar] [CrossRef] [PubMed]
- Jorde, L.B. Genetic variation and human evolution. American Society of Human Genetics 2003, 7, 28–33. [Google Scholar]
- Bjorkman, P.J.; Saper, M.A.; Samraoui, B.; Bennett, W.S.; Strominger, J.L.; Wiley, D.C. Structure of the human class I histocompatibility antigen, HLA-A2. Nature 1987, 329, 506–512. [Google Scholar] [CrossRef] [PubMed]
- Antunes, D.A.; Devaurs, D.; Moll, M.; Lizée, G.; Kavraki, L.E. General Prediction of Peptide-MHC Binding Modes Using Incremental Docking: A Proof of Concept. Sci. Rep. 2018, 8, 4327. [Google Scholar] [CrossRef] [PubMed]
- Mei, S.; Li, F.; Leier, A.; Marquez-Lago, T.T.; Giam, K.; Croft, N.P.; Akutsu, T.; Smith, A.I.; Li, J.; Rossjohn, J.; et al. A comprehensive review and performance evaluation of bioinformatics tools for HLA class I peptide-binding prediction. Briefings Bioinform. 2020, 21, 1119–1135. [Google Scholar] [CrossRef] [PubMed]
- Sohail, M.S.; Ahmed, S.F.; Quadeer, A.A.; McKay, M.R. In silico T cell epitope identification for SARS-CoV-2: Progress and perspectives. Adv. Drug Deliv. Rev. 2021, 171, 29–47. [Google Scholar] [CrossRef] [PubMed]
- Raoufi, E.; Hemmati, M.; Eftekhari, S.; Khaksaran, K.; Mahmodi, Z.; Farajollahi, M.M.; Mohsenzadegan, M. Epitope Prediction by Novel Immunoinformatics Approach: A State-of-the-art Review. Int. J. Pept. Res. Ther. 2019, 26, 1155–1163. [Google Scholar] [CrossRef]
- Bradley, P. Structure-based prediction of T cell receptor:peptide-MHC interactions. eLife 2023, 12, e82813. [Google Scholar] [CrossRef]
- Jumper, J.; Evans, R.; Pritzel, A.; Green, T.; Figurnov, M.; Ronneberger, O.; Tunyasuvunakool, K.; Bates, R.; Žídek, A.; Potapenko, A.; et al. Highly accurate protein structure prediction with AlphaFold. Nature 2021, 596, 583–589. [Google Scholar] [CrossRef]
- Zhang, Y.; Skolnick, J. Scoring function for automated assessment of protein structure template quality. Proteins: Struct. Funct. Bioinform. 2004, 57, 702–710. [Google Scholar] [CrossRef] [PubMed]
- Zemla, A. LGA: a method for finding 3D similarities in protein structures. Nucleic Acids Res. 2003, 31, 3370–3374. [Google Scholar] [CrossRef] [PubMed]
- Leman, J.K.; Szczerbiak, P.; Renfrew, P.D.; Gligorijevic, V.; Berenberg, D.; Vatanen, T.; Taylor, B.C.; Chandler, C.; Janssen, S.; Pataki, A.; et al. Sequence-structure-function relationships in the microbial protein universe. Nat. Commun. 2023, 14, 1–11. [Google Scholar]
- Vita, R.; Overton, J.A.; Greenbaum, J.A.; Ponomarenko, J.; Clark, J.D.; Cantrell, J.R.; Wheeler, D.K.; Gabbard, J.L.; Hix, D.; Sette, A.; et al. The immune epitope database (IEDB) 3.0. Nucleic Acids Res. 2014, 43, D405–D412. [Google Scholar] [CrossRef]
- Johnson, K. Natural history as stamp collecting: a brief history. Arch. Nat. Hist. 2007, 34, 244–258. [Google Scholar] [CrossRef]
- Frede, M. Plato’s Sophist on False Statements; In The Cambridge Companion to, Plato, Richard Kraut, Eds.; Cambridge University Press: Cambridge, United Kingdom, 1992; pp. 397–424. [Google Scholar]
- Bero, S.A.; Muda, A.K.; Choo, Y.H.; Muda, N.A.; Pratama, S.F. Similarity Measure for Molecular Structure: A Brief Review. J. Phys.: Conf. Ser. 2017, 892, 012015. [Google Scholar] [CrossRef]
- Xu, J.; Zhang, Y. How significant is a protein structure similarity with TM-score = 0.5? Bioinform. 2010, 26, 889–895. [Google Scholar] [CrossRef] [PubMed]
- Wei, P.; Jordan, K.R.; Buhrman, J.D.; Lei, J.; Deng, H.; Marrack, P.; Dai, S.; Kappler, J.W.; Slansky, J.E.; Yin, L.; et al. Structures suggest an approach for converting weak self-peptide tumor antigens into superagonists for CD8 T cells in cancer. Proc. Natl. Acad. Sci. USA 2021, 118, e2100588118. [Google Scholar] [CrossRef] [PubMed]
- 6L9M. RCSB Protein Data Bank. Available online: www.rcsb.org/structure/6L9M. Retrieved 2023-09-22.
- 6L9N. RCSB Protein Data Bank. Available online: www.rcsb.org/structure/6L9N. Retrieved 2023-09-22.
- 1HV4. RCSB Protein Data Bank. Available online: www.rcsb.org/structure/1HV4. Retrieved 2023-09-06.
- Python code to help process files of 3d protein structure (PDB format). Available online: github.com/bob-friedman/pdb-file-utilities. Retrieved 2023-08-21.
- Lianga, Y.; Huaa, Z.; Liang, X.; Xu, Q.; Lua, G. The crystal structure of bar-headed goose hemoglobin in deoxy form: the allosteric mechanism of a hemoglobin species with high oxygen affinity. J. Mol. Biol. 2001, 313, 123–137. [Google Scholar] [CrossRef] [PubMed]
- Lin, H.H.; Ray, S.; Tongchusak, S.; Reinherz, E.L.; Brusic, V. Evaluation of MHC class I peptide binding prediction servers: Applications for vaccine research. BMC Immunol. 2008, 9, 8. [Google Scholar] [CrossRef] [PubMed]
- Nielsen, M.; Lundegaard, C.; Worning, P.; Lauemøller, S.L.; Lamberth, K.; Buus, S.; Brunak, S.; Lund, O. Reliable prediction of T-cell epitopes using neural networks with novel sequence representations. Protein Sci. 2003, 12, 1007–1017. [Google Scholar] [CrossRef] [PubMed]
- Chen, G.; Yang, X.; Go, A.; Gao, M.; Zhang, Y.; Shi, A.; Sun, X.; Mariuzza, R.A.; Weng, N.-P. Sequence and structural analyses reveal distinct and highly diverse human CD8+ TCR repertoires to immunodominant viral antigens. Cell Rep. 2017, 19, 569–583. [Google Scholar] [CrossRef] [PubMed]
- Szeto, C.; Lobos, C.A.; Nguyen, A.T.; Gras, S. TCR Recognition of Peptide–MHC-I: Rule Makers and Breakers. Int. J. Mol. Sci. 2020, 22, 68. [Google Scholar] [CrossRef] [PubMed]
- Grazioli, F.; Mösch, A.; Machart, P.; Li, K.; Alqassem, I.; O’Donnell, T.J.; Min, M.R. On TCR binding predictors failing to generalize to unseen peptides. Front. Immunol. 2022, 13, 1014256. [Google Scholar] [CrossRef] [PubMed]
- Paul, S.; Croft, N.P.; Purcell, A.W.; Tscharke, D.C.; Sette, A.; Nielsen, M.; Peters, B. Benchmarking predictions of MHC class I restricted T cell epitopes in a comprehensively studied model system. PLOS Comput. Biol. 2020, 16, e1007757. [Google Scholar] [CrossRef] [PubMed]
- Yewdell, J.W.; Bennink, J.R. Immunodominance in major histocompatibility complex class I-restricted T lymphocyte responses. Annu. Rev. Immunol. 1999, 17, 51–88. [Google Scholar] [CrossRef] [PubMed]
- Gao, Y.; Gao, Y.; Fan, Y.; Zhu, C.; Wei, Z.; Zhou, C.; Chuai, G.; Chen, Q.; Zhang, H.; Liu, Q.; et al. Pan-Peptide Meta Learning for T-cell receptor–antigen binding recognition. Nat. Mach. Intell. 2023, 5, 236–249. [Google Scholar] [CrossRef]
- PanPep: Pan-Peptide Meta Learning for T-Cell Receptor-Antigen Binding Recognition. Available online: github.com/bm2-lab/PanPep. Retrieved 2023-9-18.
- Nahm, F.S. Receiver operating characteristic curve: overview and practical use for clinicians. Korean J. Anesthesiol. 2022, 75, 25–36. [Google Scholar] [CrossRef]
- Parra, Z.E.; Baker, M.L.; Schwarz, R.S.; Deakin, J.E.; Lindblad-Toh, K.; Miller, R.D. A unique T cell receptor discovered in marsupials. Proc. Natl. Acad. Sci. USA 2007, 104, 9776–9781. [Google Scholar] [CrossRef] [PubMed]
- Bassing, C.H.; Alt, F.W.; Hughes, M.M.; D'Auteuil, M.; Wehrly, T.D.; Woodman, B.B.; Gärtner, F.; White, J.M.; Davidson, L.; Sleckman, B.P. Recombination signal sequences restrict chromosomal V (D) J recombination beyond the 12/23 rule. Nature 2000, 405, 583–586. [Google Scholar] [CrossRef] [PubMed]
- Max, E.E.; Seidman, J.G.; Leder, P. Sequences of five potential recombination sites encoded close to an immunoglobulin kappa constant region gene. Proc. Natl. Acad. Sci. USA 1979, 76, 3450–3454. [Google Scholar] [CrossRef]
- Davies, D.R.; Sheriff, S.; Padlan, E.A. Antibody-Antigen Complexes. Annu. Rev. Biochem. 1990, 59, 439–473. [Google Scholar] [CrossRef] [PubMed]
- Abanades, B.; Wong, W.K.; Boyles, F.; Georges, G.; Bujotzek, A.; Deane, C.M. ImmuneBuilder: Deep-Learning models for predicting the structures of immune proteins. Commun. Biol. 2023, 6, 1–8. [Google Scholar] [CrossRef] [PubMed]
- Evans, R.; O'Neill, M.; Pritzel, A.; Antropova, N.; Senior, A.; Green, T.; Žídek, A.; Bates, R.; Blackwell, S.; Yim, J. Protein complex prediction with AlphaFold-Multimer; Cold Spring Harbor Laboratory: Woodbury, NY, United States, 2021; pp. 2021.10.04.463034.
- Leem, J.; de Oliveira, S.H.P.; Krawczyk, K.; Deane, C.M. STCRDab: the structural T-cell receptor database. Nucleic Acids Res. 2017, 46, D406–D412. [Google Scholar] [CrossRef]
- Carugo, O.; Pongor, S. A normalized root-mean-spuare distance for comparing protein three-dimensional structures. Protein Sci. 2008, 10, 1470–1473. [Google Scholar] [CrossRef]
- Dunbar, J.; Fuchs, A.; Shi, J.; Deane, C.M. ABangle: characterising the VH-VL orientation in antibodies. Protein Eng. Des. Sel. 2013, 26, 611–620. [Google Scholar] [CrossRef] [PubMed]
- Leem, J.; Georges, G.; Shi, J.; Deane, C.M. Antibody side chain conformations are position-dependent. Proteins: Struct. Funct. Bioinform. 2018, 86, 383–392. [Google Scholar] [CrossRef] [PubMed]
- ImmuneBuilder. GitHub (accessed on 2 November 2023). Available online: github.com/oxpig/ImmuneBuilder. Retrieved 2023-11-2.
- Bisong, E. Google Colaboratory; Springer Science and Business Media LLC: Dordrecht, GX, Netherlands, 2019; pp. 59–64. [Google Scholar]
- Sayle, R.A.; Milner-White, E.J. RASMOL: biomolecular graphics for all. Trends Biochem. Sci. 1995, 20, 374–376. [Google Scholar] [PubMed]
- Berman, H.; Henrick, K.; Nakamura, H.; Markley, J.L. The worldwide Protein Data Bank (wwPDB): ensuring a single, uniform archive of PDB data. Nucleic Acids Res. 2007, 35, D301–D303. [Google Scholar] [CrossRef] [PubMed]
- Yang, X.; Gao, M.; Chen, G.; Pierce, B.G.; Lu, J.; Weng, N.-P.; Mariuzza, R.A. Structural Basis for Clonal Diversity of the Public T Cell Response to a Dominant Human Cytomegalovirus Epitope. J. Biol. Chem. 2015, 290, 29106–29119. [Google Scholar] [CrossRef] [PubMed]
- ClustalW. Available online: www.genome.jp/tools-bin/clustalw. Retrieved 2023-11-2.
- Ma, Y.J.; Liang, W.; Wang, G.; Huang, D.-A.; Bastani, O.; Jayaraman, D.; Zhu, Y.; Fan, L.; Anandkumar, A. Eureka: Human-Level Reward Design via Coding Large Language Models. arXiv 2023, arXiv:2310.12931. [Google Scholar]
- Bickle, J. The first two decades of CREB-memory research: data for philosophy of neuroscience. AIMS Neuroscience 2021, 8, 322. [Google Scholar] [CrossRef] [PubMed]
- Li, W.-H. Unbiased estimation of the rates of synonymous and nonsynonymous substitution. J. Mol. Evol. 1993, 36, 96–99. [Google Scholar] [CrossRef] [PubMed]
- Moss, P. The T cell immune response against SARS-CoV-2. Nat. Immunol. 2022, 23, 186–193. [Google Scholar] [CrossRef] [PubMed]
- Scharloo, W. Canalization: Genetic And Developmental Aspects. Annu. Rev. Ecol. Syst. 1991, 22, 65–93. [Google Scholar] [CrossRef]
- Waddington, C.H. Canalization of Development and the Inheritance of Acquired Characters. Nature 1942, 150, 563–565. [Google Scholar] [CrossRef]
- Meyer, A.; Zardoya, R. Recent Advances in the (Molecular) Phylogeny of Vertebrates. Annu. Rev. Ecol. Evol. Syst. 2003, 34, 311–338. [Google Scholar] [CrossRef]
- Bengio, Y.; Lecun, Y.; Hinton, G. Deep learning for AI. Commun. ACM. 2021, 64, 58–65. [Google Scholar] [CrossRef]
- Park, M.; Seo, S-W.; Park, E.; Kim, J. EpiBERTope: A sequence-based pre-trained BERT model improves linear and structural epitope prediction by learning long-distance protein interactions effectively. bioRxiv 2022, bioRxiv:2022.02.27.481241. [Google Scholar]
- Friedman, R. Tokenization in the Theory of Knowledge. Encycl. 2023, 3, 380–386. [Google Scholar] [CrossRef]
- Lin, Z.; Akin, H.; Rao, R.; Hie, B.; Zhu, Z.; Lu, W.; Smetanin, N.; Verkuil, R.; Kabeli, O.; Shmueli, Y.; et al. Evolutionary-scale prediction of atomic-level protein structure with a language model. Science 2023, 379, 1123–1130. [Google Scholar] [CrossRef] [PubMed]
- François-Lavet, V.; Peter, P.; Islam, R.; Bellemare, M.G.; Pineau, J. An Introduction to Deep Reinforcement Learning. Found. Trends Mach. Learn. 2018, 11, 219–354. [Google Scholar] [CrossRef]
- Fawzi, A.; Balog, M.; Huang, A.; Hubert, T.; Romera-Paredes, B.; Barekatain, M.; Novikov, A.; Ruiz, F.J.R.; Schrittwieser, J.; Swirszcz, G.; et al. Discovering faster matrix multiplication algorithms with reinforcement learning. Nature 2022, 610, 47–53. [Google Scholar] [CrossRef] [PubMed]
- Friedman, R. A Hierarchy of Interactions between Pathogenic Virus and Vertebrate Host. Symmetry 2022, 14, 2274. [Google Scholar] [CrossRef]
- Wei, J.; Wang, X.; Schuurmans, D.; Bosma, M.; Chi, E.; Le, Q.; Zhou, D. Chain-of-thought prompting elicits reasoning in large language models. Advances in Neural Information Processing Systems 2022, 35, 24824–24837. [Google Scholar]
- Zhuge, M.; Liu, H.; Faccio, F.; Ashley, D.R.; Csordás, R.; Gopalakrishnan, A.; Hamdi, A.; Hammoud, H.A.A.K.; Herrmann, V.; Irie, K.; et al. Mindstorms in Natural Language-Based Societies of Mind. arXiv 2023, arXiv:2305.17066. [Google Scholar]
- Zhou, W.; Jiang, Y.E.; Li, L.; Wu, J.; Wang, T.; Qiu, S.; Zhang, J.; Chen, J.; Wu, R.; Wang, S.; et al. Sachan Agents: An Open-source Framework for Autonomous Language Agents. arXiv 2023, arXiv:2309.07870. [Google Scholar]
- Masoudnia, S.; Ebrahimpour, R. Mixture of experts: a literature survey. Artif. Intell. Rev. 2012, 42, 275–293. [Google Scholar] [CrossRef]
- Open, AI. GPT-4 Technical Report. arXiv 2023, arXiv:2303.08774. [Google Scholar]
- Anil, R.; Dai, A.M.; Firat, O.; Johnson, M.; Lepikhin, D.; Passos, A.; Shakeri, S.; Taropa, E.; Bailey, P.; Chen, Z.; et al. PaLM 2 Technical Report. arXiv 2023, arXiv:2305.10403. [Google Scholar]
- Vaswani, A.; Shazeer, N.; Parmar, N.; Uszkoreit, J.; Jones, L.; Gomez, A.N.; Kaiser, L.; Polosukhin, I. Attention Is All You Need. arXiv 2017, arXiv:1706.03762. [Google Scholar]
- Asanovic, K.; Bodik, R.; Demmel, J.; Keaveny, T.; Keutzer, K.; Kubiatowicz, J.; Morgan, N.; Patterson, D.; Sen, K.; Wawrzynek, J.; et al. A view of the parallel computing landscape. Commun. ACM. 2009, 52, 56–67. [Google Scholar] [CrossRef]
- Touvron, H.; Martin, L.; Stone, K.; Albert, P.; Almahairi, A.; Babaei, Y.; Bashlykov, N.; Batra, S.; Bhargava, P.; Bhosale, S.; et al. Llama 2: Open Foundation and Fine-Tuned Chat Models. arXiv 2023, arXiv:2307.09288. [Google Scholar]
- Taylor, R.; Kardas, M.; Cucurull, G.; Scialom, T.; Hartshorn, A.; Saravia, E.; Poulton, A.; Kerkez, V.; Stojnic, R. Galactica: A Large Language Model for Science. arXiv 2022, arXiv:2211.09085. [Google Scholar]
- Wang, X.; Wei, J.; Schuurmans, D.; Le, Q.; Chi, E.; Zhou, D. Self-Consistency Improves Chain of Thought Reasoning in Language Models. arXiv 2022, arXiv:2203.11171. [Google Scholar]
- Yao, S.; Yu, D.; Zhao, J.; Shafran, I.; Griffiths, T.L.; Cao, Y.; Narasimhan, K. Tree of Thoughts: Deliberate Problem Solving with Large Language Models. arXiv 2023, arXiv:2305.10601. [Google Scholar]
- Li, C.; Liang, J.; Zeng, A.; Chen, X.; Hausman, K.; Sadigh, D.; Levine, S.; Fei-Fei, L.; Xia, F.; Ichter, B. Chain of Code: Reasoning with a Language Model-Augmented Code Emulator. arXiv 2023, arXiv:2312.04474. [Google Scholar]
- Friedman, R. Higher Cognition: A Mechanical Perspective. Encycl. 2022, 2, 1503–1516. [Google Scholar] [CrossRef]
- Merchant, A.; Batzner, S.; Schoenholz, S.S.; Aykol, M.; Cheon, G.; Cubuk, E.D. Scaling deep learning for materials discovery. Nature. 2023, 624, 80–85. [Google Scholar] [CrossRef]
- Schrittwieser, J.; Antonoglou, I.; Hubert, T.; Simonyan, K.; Sifre, L.; Schmitt, S.; Guez, A.; Lockhart, E.; Hassabis, D.; Graepel, T.; et al. Mastering Atari, Go, chess and shogi by planning with a learned model. Nature 2020, 588, 604–609. [Google Scholar] [CrossRef]
- Zebari, R.; Abdulazeez, A.; Zeebaree, D.; Zebari, D.; Saeed, J. A Comprehensive Review of Dimensionality Reduction Techniques for Feature Selection and Feature Extraction. J. Appl. Sci. Technol. Trends. 2020, 1, 56–70. [Google Scholar] [CrossRef]
- Pang, R.; Lansdell, B.J.; Fairhall, A.L. Dimensionality reduction in neuroscience. Curr. Biol. 2016, 26, R656–R660. [Google Scholar] [CrossRef] [PubMed]
- Fusi, S.; Miller, E.K.; Rigotti, M. Why neurons mix: high dimensionality for higher cognition. Curr. Opin. Neurobiol. 2016, 37, 66–74. [Google Scholar] [CrossRef] [PubMed]
- Friedman, R. Large Language Models and Logical Reasoning. Encycl. 2023, 3, 687–697. [Google Scholar] [CrossRef]
- Mitra, A.; Corro, L.D.; Mahajan, S.; Codas, A.; Simoes, C.; Agarwal, S.; Chen, X.; Razdaibiedina, A.; Jones, E.; Aggarwal, K.; et al. Orca 2: Teaching Small Language Models How to Reason. arXiv 2023, arXiv:2311.11045. [Google Scholar]
- Balestriero, R.; Pesenti, J.; LeCun, Y. Learning in High Dimension Always Amounts to Extrapolation. arXiv 2021, arXiv:2110.09485. [Google Scholar]
- Zou, X.; Dou, Z.-Y.; Yang, J.; Gan, Z.; Li, L.; Li, C.; Dai, X.; Behl, H.; Wang, J.; Yuan, L.; et al. Generalized Decoding for Pixel, Image, and Language; Institute of Electrical and Electronics Engineers (IEEE): Piscataway, NJ, United States, 2023; pp. 1 5116–15127.
- Nakajima, K. The mechanism of antigenic shift and drift of human influenza virus. Nihon Rinsho. 2003, 61, 1897–1903. [Google Scholar]
- Xiao, C.; Ren, Z.; Zhang, B.; Mao, L.; Zhu, G.; Gao, L.; Su, J.; Ye, J.; Long, Z.; Zhu, Y.; et al. Insufficient epitope-specific T cell clones are responsible for impaired cellular immunity to inactivated SARS-CoV-2 vaccine in older adults. Nat. Aging 2023, 3, 418–435. [Google Scholar] [CrossRef] [PubMed]
- Qi, Q.; Liu, Y.; Cheng, Y.; Glanville, J.; Zhang, D.; Lee, J-Y; Olshen, R.A.; Weyand, C.M.; Scott D. Boyd; Goronzy, J.J. Diversity and clonal selection in the human T-cell repertoire. Proc. Natl. Acad. Sci. USA 2014, 111, 13139–13144.









Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).