Preprint
Review

This version is not peer-reviewed.

Significance of Conserved Regions in Coronavirus Spike Protein for Developing a Novel Vaccine against SARS-Cov-2 Infection

A peer-reviewed version of this preprint was published in:
Vaccines 2023, 11(3), 545. https://doi.org/10.3390/vaccines11030545

Submitted:

16 January 2023

Posted:

23 January 2023

You are already at the latest version

Abstract
Abstract: Over the years, several distinct pathogenic coronaviruses have emerged, including the pandemic SARS-CoV-2 which is difficult to curtail despite the availability of licensed vaccines. The difficulty in managing SARS-CoV-2 is linked to changes in the variants’ proteins, especially in the spike protein (S) used for viral entry. These mutations, especially in the S, enable the virus to evade the immune responses induced by natural infection or vaccination. However, some parts of the SP in the S1 subunit and the S2 subunit are considered conserved among coronaviruses. In this review, we will discuss the epitopes in the SARS-CoV-2 S1 and S2 subunit proteins that have been demonstrated by various studies to be conserved among coronaviruses and may be immunogenic for the development of vaccine. Considering the higher conservancy of the S2, we will further discuss the likely challenges that could limit the S2 subunit from inducing robust immune responses and the promising approaches to increase their immunogenicity.
Keywords: 
;  ;  ;  ;  

1. Introduction

In the history of humans, the Coronavirus disease (COVID-19) caused by the severe acute respiratory syndrome coronavirus -2 (SARS-CoV-2) has made an indelible mark characterized by a contagious respiratory pandemic [1,2]. Consequently, 660 million cases and approximately 6.6 million deaths have been reported as of December 2022 [3]. Since its emergence, studies have been focusing on developing preventive and therapeutic measures against this disease and several vaccines have been licensed [4,5]. Yet, the constant mutation of the virus resulting in different variants narrows the effectivity of the licensed vaccines against SARS-CoV-2 infections. Thus suggesting a needed continuous effort in developing a SARS-CoV-2 universal vaccine [6]. Besides the pandemic caused by SARS-CoV-2, other human coronaviruses (huCoVs) including human CoV (HCoV)-229E (1962), HCoV-OC43 (1967), SARS-CoV (2002), HCoV-NL63 (2004), HCoV-HKUI (2005), Middle East respiratory syndrome coronavirus (MERS)-CoV (2012) and SARS-CoV-2 (2019) have been implicated in different outbreaks since the start of the 21st century [7,8,9,10,11]. Although the trend of the emergence of coronaviruses remains unclear, adequate preparation must be made for a possible emerging or re-emerging strain. In this case, developing an effective universal vaccine against CoVs should take the advantage of the conserved portions of the virus, especially the SP.
Levels of similarities have been observed among the emerged CoVs [12,13,14]. For instance, the SARS-CoV-2 viral genome sequence analysis revealed its phylogenetic similarity with SARS-CoV (79%) and MERS-CoV (50%) [15,16,17]. Like other betacoronavirus, the SARS-CoV-2 genome consists of 27 proteins encoded by 14 open reading frames (ORF) including non-structural proteins (nsp) that are encoded by the ORF 1 and 2 present at the 5’-terminal region [18,19]. More importantly, the SARS-CoV-2 structural proteins SP, an envelope protein (E), membrane protein (M), nucleocapsid (N) and eight accessory proteins encoded by the 3’-terminal region of the genomes are in like manner with other betacoronaviruses [19].
Sequence analysis of SARS-CoV-2 SP revealed a close association with SARS-CoV regarding amino acid composition as well as comparable binding affinity to human angiotensin-converting enzyme 2 (hACE2) [20,21]. The SP which is a highly N-glycosylated class I transmembrane fusion protein plays a critical role during coronavirus infection. SP mediates the attachment of the virus into the cell receptor and facilitates the viral-host membrane fusion [22,23]. SP also assembles into trimers on the virus surface and cleaves into two subunits, S1 and S2, during the cell infection [24,25]. The large protein S1 domain contains the RBD that is responsible for binding to the host cell receptor and varies extensively in all isolates of the CoVs [20,24,25]. Meanwhile, the S2 domain which facilitates the virus-cell fusion is made up of the fusion peptide (FP) and heptad repeat regions (HR1 and HR2) that are conserved among the isolates of the CoVs [26,27], the conserved membrane-proximal external region (MPER) and the transmembrane domain (TM) [28,29,30,31,32,33,34]. After the binding of the S1 RBD domain to the ACE2, the S2 subunit then inserts its FP into the cell membrane leading to the assemblage of the HR1 and HR2 into a six-helix structure to drive the cellular and viral membrane closely together for viral entry [35]. Notably, the major determinant of cell tropism in most coronaviruses is typically linked to the structure of the SP [21,25,36,37,38,39,40]. Phylogenetic, bioinformatic and homology structural modelling analyses showed that the RBD of SARS-CoV-2 only has 64% identity with the SARS-CoV while the NTD has 51% similarity [41]. However, the study revealed that within the S2, the fusion protein (FP) is 93% identical, HR1 is 88% identical while the HR2 and the TM are respectively 100% and 93% similar.
SARS-CoV-2 and other SARS-related coronaviruses (e.g., SARS-CoV) can utilize distinct domains within the S1 subunit to identify different attachment and entry receptors in the host cell surface [20,40]. For instance, the differences in SP of the known huCoVs contribute to their difference in pathogenesis, and the site of infection (lower or upper respiratory) [36]. Taking a closer look at SARS-CoV-2 as an example, Laporte et al., described that the higher transmissibility experienced with the SARS-CoV-2 compared to other human coronavirus is due to their abundant replication in the upper respiratory tracts [42]. They mentioned that the SARS-CoV-2 SP has an intrinsic temperature preference of 33ºC like the temperature of the human respiratory tracts instead of the 37ºC required by other human CoVs. In addition to this, it was revealed that the SARS-CoV-2 has multiple cell entry activators including TMPRSS2 and TMPRSS13 protease broadening its tropism. As mentioned by Korber et al., a D614G mutation observed in the SARS-CoV-2 variant S1 also resulted in the wider spread of the virus at different geographical regions with higher viral loads in the respiratory tracts [43]. These differences observed in the SP of the CoVs contribute to the difficulties in developing a sustainable vaccine against the emerging variants of SARS-CoV-2. It is therefore of a necessity to develop vaccine that can prevent the spread of all present or emerging variants of SARS-CoV-2.
Notably, certain conserved epitopes in the S1 and S2 regions can be utilized to develop universal vaccines against CoV infections [44,45,46]. However, some varying challenges surround these conserved epitopes including the presence of immunodominant epitopes [44], weak immunogens and non-neutralizing antibodies stimulants [46]. This review aims to shed light on the conserved epitopes capable of inducing a broad immune response against multiple CoVs and highlight how to circumvent the associated possible challenges with lessons gleaned from SARS-CoV-2.

2. Impact of Mutations on SARS-CoV-2 SP to the Evasion and Resistance of Immune Responses

Understanding the possible ways by which the SARS-CoV-2 SP escapes immune responses will shed light on the importance of using conserved regions of the SP in developing a universal vaccine against variants of coronaviruses. The SARS-CoV-2 SP has been demonstrated to regulate the innate immune response through the activation of the NF-κB pathway in human macrophages and monocytes thus increasing the production of inflammatory responses (IL-8) [47,48]. Continuous mutation of the SARS-CoV-2 SP impacts the innate immune responses and could further increase virulence, pathogenicity, and immune evasion of the virus given that one of the strategies by which SARS-CoV-2 evades immune response is through cytokine shock [49].
The adaptive immune response regarded as the second line of defence during infection is regulated by the antigen-presenting cells (APCs) and comprises the antibodies (B cells), T helper cells (CD4+ T cell) and cytotoxic T cells (CD8+ T cells) [50]. In the case of SARS-CoV-2 infection, the DCs present peptides derived from the SP on the major histocompatibility complex I or II (MHC-I or II) for the activation of the specific T-cells (CD4+ and CD8+) [51]. The SARS-CoV-2 specific CD4+ T cells help to trigger the induction of SARS-CoV-2 specific B cells that further generate most of the neutralizing antibodies as well as memory B cells and long-term humoral immunity, while the CD8+ T cells regulate antiviral activities, recruit innate cells, kill infected cells and facilitate tissue repair [50,52,53,54,55,56]. Notably, among the SARS-CoV-2 structural proteins, the SP is the most promising antigen for the induction of neutralizing antibodies (including IgM, IgA and IgG) and cell-mediated immune responses (including CD4+ T, CD8+ T cells and T follicular helper cells (Tfh) ) during COVID-19 disease [57,58,59,60,61,62,63,64,65].
However, the SARS-CoV-2 SP could escape these adaptive immune responses because of the mutation in its genetic constituent thus leading to the ineffectiveness of vaccine-induced immunity [21,66]. Vaccine development against SARS-CoV-2, like all other vaccines, depends on the induction of neutralizing, adaptive, and memory immune responses. Although the current COVID-19 vaccine reduces the severity of the disease, the re-infection of SARS-CoV-2 in previously infected people or fully vaccinated individuals has been well documented suggesting that the sterilizing immunity towards SARS-CoV-2 is partial, short-lived, and narrow [67,68,69].
Since the emergence of the SARS-CoV-2 virus in 2019, various variants have emerged with mutations leading to amino acid changes in the SP which contribute largely to the immune evasion [70,71]. Most of the mutations are found in the S1 subunit protein that contains the RBD (319-541 aa). Altogether, there are about 71 mutations in Alpha, Delta, and Omicron with 33 being shared among at least two variants of the SARS-CoV-2 [69]. Among all, Omicron variants and subvariants contain the highest number of changes in the SP relative to the ancestral virus. Compared to the wild type, Delta has 17 mutations including 3 RBD mutations (K417N, E484Q, L452R) and D614G, whereas Omicron has more than 32 mutations in the SP with 15 mutations in the RBD thus influencing its transmissibility and infectivity [72].
The mutations on the RBD impact its ability to bind with the host ACE2 receptors. For instance, the RBD of the SARS-CoV-2 has a greater affinity for the hACE2 than the RBD of SARS-CoV due to the differences in their amino acids [24]. These following mutations have been identified as the RBD mutation of concerns present in the VOCs resulting in the compromising of the immune responses by the Food and Drug Agency (FDA): P337H/L/R/T, K417E/N, E484K/Q/P/D, N439K, K444Q, S494P, V445A, N450D, L452R, Y453F, E340A/K/G, L455F, F486V, N460K/S/T, D420N, V483A, F490S, Q493K/R and N501Y/T [73]. A study by Hoffmann et al. showed that the Delta variant with E484Q mutation on the RBD had a reduced neutralizing sensitivity to bamlanivimab or plasma from vaccinated patients [74]. Moreover, the N439K has been demonstrated by Thomson et al. to enhance infectivity and escape humoral immune response by enhancing the binding of RBD to hACE2 [75]. Interestingly, before the emergence of the omicron variant, a CR3022 neutralizing antibody isolated from a SARS-CoV-2 convalescent patient was revealed to target highly conserved epitopes of the RBD of the SARS-CoV-2 and SARS-CoV [70]. However, with the emergence of the Omicron variants which contain 15 mutations on the RBD, the sensitivity of the CR3022 was reduced [76]. Aside from the impacts of the mutations on the RBD in the escape of the immune response, the D614G mutation on the non-RBD of the S1 found in most VOCs also contributes to the enhancement of the virulence and immune evasion of SARS-CoV-2 variants [43,77].
Therefore, it is not surprising to find that other variants of SARS-CoV-2 such as Beta (B.1.351), Gamma (B.1.1.28), Delta (B.1.617.2), and especially Omicron (B.1.1.529) substantially resist the immune responses induced by the licensed vaccines [78,79,80,81]. Supportably, a report showed that 21 out of 33 people that have been vaccinated 3 times with the licensed vaccine were still susceptible to the Omicron variants infection [82]. By using a pseudotyped lentivirus system [83], a study also revealed that Omicron SP had 26-fold resistance to neutralizing antibodies among the convalescent donor, 26 to 34-fold resistance to antibodies elicited by Pfizer BNT162b2 and Moderna 2 dosages vaccines. In addition, the Omicron spike resisted most therapeutic antibodies except sotrovimab and evaded immune induced in the individual vaccinated with BNT162b2 with 12–44-fold resistance than the Delta variant. Similarly, the third dosage of BNT162b2 or vaccination with ChAdOx1 induced neutralizing antibodies against the Omicron but lower than the Delta [84]. The observed compromise of the immune response by the variants is particularly due to the mutations on the RBD of the S1 [82,85].
The SARS-CoV-2 S2 subunit protein also has about 12 mutations which are not shared among the variants and may influence the immune evasion of SARS-CoV-2 [86]. Nevertheless, the S2 region is less affected by the spontaneous mutation because of its importance in the fusion process that leads to infection [87]. Indeed, despite the variation impacted by mutations of the SP of the CoVs, some certain epitopes that could induce neutralizing antibodies, memory B cells and memory T cell responses remain conserved in the S1 and S2 subunits across the CoVs. Therefore, attention should be placed on these conserved regions for developing a universal vaccine.

3. SARS-CoV-2 S Conserved Regions as a Potential Target for Vaccine Development

Developing a vaccine for viruses with multiple strains or variants tends to take advantage of the conserved epitopes present in the virus. Conserved epitopes are epitopes that are relatively the same among different strains of a pathogen. For example, due to the multiple strains of influenza over the years, the means of developing a universal vaccine has been with the use of the conserved epitopes on the hemagglutinin (HA stalk) or the matrix ectodomain (M2e) [88,89,90,91,92,93,94]. The strategy of using conserved epitopes has also been in the development for preventative vaccines for HIV, dengue virus, Lassa fever virus (LASV), hepatitis virus, and Kaposi’s sarcoma-associated herpesvirus (KSHV) [95,96,97,98,99,100,101,102,103]. Therefore, identifying the conserved regions in the SP of SARS-CoV variants will be of great importance in developing a universal vaccine against CoVs. Although mutations in SARS-CoV-2 had a great impact on the SP, studies have revealed that certain conserved epitopes in S1 can induce the neutralizing antibodies [104]. Interestingly, some monoclonal antibodies (including 7B11, 18F3, S309 and its Fab, S315, 154C, S304, 240C, VHH-72) recognizing SARS-CoV and MERS-CoV could cross-react and cross-neutralize SARS-CoV-2 by recognizing the ACE2 binding sites on the SARS-CoV-2 RBD [105].
Jaiswal et al. mathematically (in-house developed PERL scripts) revealed sets of epitopes on the S1 subunit around 453 to 538 that interact with the ACE are 99% conserved among the variants of SARS-CoV-2 [106]. Their study further identified conserved common neutralizing epitopes on the SARS-CoV-2 including YLTPGDSSSGWTAGAAAYYV (247-267 aa), TFKCYGVSPTKLNDL (376- 390 aa) on S1 and LNEVAKNLNESLIDLQELGK (1186-1205 aa) on the S2 [106]. A recent immunoinformatic study predicted conserved and highly immunogenic CTL-induced epitopes on S1 VRFPNITNL (327-335 aa), and PYRVVVLSF (507 -515 aa) (Table 1), while the CTL-induced epitopes on S2 were identified to be VVFLHVTYV (1060-1068 aa) and GVVFLHVTY (1059-1067 aa) (Table 2) [107]. Based on the conservancy, antigenicity, allergenicity, population coverage and transmembrane location, another study chose potential conserved epitopes from S1 (FNATRFASVYAWNRK, 342-356aa) (Table 1), S2 (FLHVTYVPAQEKNFT,1062-1072 aa) (Table 2) and E/M protein to construct a SARS-CoV-2 vaccine and reveal that it has high immunogenicity and broad neutralizing activity against the SARS-CoV-2 RBD [108]. Jiang et al., with web-based analytic tools, also predicted potential T cell epitopes induced by the SARS-CoV-2 SP and narrowed them down to CD4 or CD8 T cell epitopes using ELIspot and cytolytic assay [109]. In their observation, YYVGYLQPRTFLLKY (264-278 aa) located at the end of the NTD and the upstream of the RBD is highly conserved among 11 variants of SARS-CoV-2 VOCs and variants of Interests (VOIs) and could induce the T cells. Further studies also suggested that these epitopes could be well recognized by the HLA alleles globally.
Considering the role played by the S2 subunit during SARS-CoV-2 infection, it could also be targeted to induce immune responses against SARS-CoV-2. Interestingly, Ladner et al. generated an epitope-resolved analysis of IgG cross-reactivity among all CoVs in COVID-19-negative and recovered patients using a highly multiplexed peptide assay (PepSeq) and discovered that the epitopes at the FP which is 93% similar among strains of betacoronaviruses and alphacoronaviruses produced broadly neutralizing antibodies against the endemic coronaviruses including SARS-CoV, MERS-CoV, and SARS-CoV-2 [41,110]. Likewise, the HR2 region of the S2 is 100% conserved among the variants of the SARS-CoV-2 [41,111]. The S2 subunit proteins could also induce cross-reactive antibodies against the SP SARS-CoV and the endemic CoVs [81]. The S2 has been reported to induce neutralizing antibodies or T cell responses targeting the FP proximal region and HR2 domain of S2 in COVID-19 patients or animals vaccinated or infected with different CoVs [112,113,114,115]. Interestingly, due to prior population exposure to common cold coronaviruses, nAbs and memory B- and T-cells against SARS-CoV-2 were found in some individuals who have never been infected by SARS-CoV-2 [116,117]. The Pre-existing antibodies against conserved epitopes of S2, such as residues 901-906, 810-816, 851-856, 1040-1044, and 1205-1212, showed the greatest cross-reactivity and hinder SARS-CoV-2 entry into cells [116]. Another identified region that is most widely recognized SARS-CoV-2 linear epitopes in convalescent donors is EELDKYF (1150 -1156 aa) within the stem helix of the HR2 terminal, EDLLFN (819-824 aa) which overlaps the FP and adjacent to the S2 cleavage [110,118]. Moreover, a study conducted by Song et al. revealed that a monoclonal antibody CC9.3 isolated from individuals before SARS-CoV-2 infection was characterized to recognize the S2 subunit of the SARS-CoV-2 and other huCoVs [119].
From the sera of patients recovered from SARS-CoV-2, Pinto et al. isolated five monoclonal antibodies that could recognize the stem-helix (SH) of the S2 subunits of other betacoronaviruses including the OC43 strain [118]. In addition, Lu et al. identified and crystallized T cell follicle helper cells (cTfh) among patients that recovered from the mild symptoms of COVID-19 and revealed that these cTfh could recognize SARS-CoV-2 S2 subunit epitopes (864 -882 aa) that are conserved among the emerging variants [54]. In a recent publication, Wu et al. identified a monoclonal antibody hMab5.17 that could recognize the SARS-CoV-2 HR2 domain that is adjacent to TM (SPDVDLGDISGINAS; 1161-1175 aa) and could protect against SARS-CoV-2 in the Syrian hamster. They further cloned the mAb hMab5.17 and demonstrated that it could neutralize SARS-CoV-2 variants [111].
Another highly conserved region located at S2 region is the SARS-CoV-2 MPER-like region (MPER) (GKYEQYIK; 1204-1211 aa) which has a great potential of being used as antigen for broadly neutralizing antibodies (bnAbs) [34,72,120]. Yu et al. have demonstrated that lipopeptide directed towards the SARS-CoV-2 MPER could inhibit viral entry indicating the importance of MPER in viral entry and fusion [34]. Like the MPER of HIV-1, the MPER of SARS-CoV-2 could possibly induce bnAbs against the variants of SARS-CoV-2. Studies have shown that bnAbs 4E10, 2F5, 10E8, and LN01 could interact with the MPER of the HIV-1 gp41 to prevent infection [121,122,123]. Likewise, the SARS-CoV-2 MPER could be a suitable immunogen for inducing neutralizing antibodies.
The above findings suggested that the S2 subunit of the SARS-CoV-2 is conserved among the previous strains of human coronaviruses and the SARS-CoV-2 variants and can induce cross-reactive antibodies.

4. Possible challenges and promising approaches with the conserved SARS-CoV-2 S2 subunit in vaccine development

Structural positioning and immunodominance: The structural positioning of the S2 subunit might limit its ability to induce sterilizing immunity. The S2 is hidden under the S1 subunit protein, thereby being masked by the S1 subunit protein resulting in the induction of weak immune responses during natural infection or when the whole spike protein is used in the vaccine development [124]. Studies have demonstrated that a vaccine targeting the S2 can induce IgG but in a lesser amount when compared with the S1 subunit protein [125,126]. Wang et al. also demonstrated that S1 of MERS-CoV in a DNA-based vaccine regimen elicited more neutralizing antibodies than the S2 subunit of the MERS-CoV vaccine [127,128]. Using an in vitro pseudotyped neutralization assay, the study revealed that combined human monoclonal antibodies against the HR1, HR2 and S1 of SARS-CoV had better cell entry inhibition compared with the human monoclonal antibody against HR2. Interestingly, the human monoclonal antibodies against HR1 or HR2 of the SARS-CoV have more broadly neutralization activity against different strains of human coronaviruses than the monoclonal antibodies of the S1 ectodomain [129], suggesting the SARS-CoV S2 subunit protein is the very promising epitope for developing a universal vaccine against the various strains of coronaviruses.
The immunodominance epitopes on the S1 subunit protein could also contribute to the induction of the immune responses toward the S2. The analysis of the immunodominance and immunoprevalent SARS-CoV-2 epitopes of CD4 T cell or CD8 T cell revealed that the SARS-CoV-2 has conserved immunodominant epitopes in the SP, M and the ORF1 [130,131,132]. Three immunodominant epitopes (TRFASVYAWNRKRISNCVAD; 345- 364 aa, DEVRQIAPGQTGKIADYNYK; 420-439 aa, ERDISTEIYQAGSTPCNGVE; 480-499 aa) located at the SARS-CoV-2 RBD have been identified [133]. The epitopes 350VYAWN354 and 407VRQIAP412 are highly conserved for the variants of SARS-CoV-2 and SARS-CoV, while 473YQAGSTP479 within the RBD is only conserved among the strains of SARS-CoV. In addition, Polyiam et al. also highlighted some immunodominance epitopes in the SARS-CoV-2 RBD including NNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGST(439-478 aa.) and LFRKSNLKPFERDISTEIYQAGST (455-478 aa.) [134].
Short epitopes and low immunogenicity: Another possible challenge for using the S2 subunit protein as universal vaccine is the shortness of the highly conserved epitopes in the S2 subunit. Examples include the FP (788-806 aa; 18 amino acids), HR2 (1127-1177 aa; 50 amino acids) and MPER (1204-1211 aa; 7 amino acids) [135]. These epitopes are too short to induce immune response except if it is used with adjuvants or fusion with other immunogenic proteins as observed in the influenza HA stalk universal vaccine designs [92,94,136].
Despite the concerns mentioned above, there are possible ways to increase the immunogenicity of the S2 protein.
aRepeating epitopes or multiple epitopes: The fusion of the conserved epitopes can be used to develop an immunogen to induce broad and neutralizing antibodies. As observed in the licensed dengue multi-epitope-based vaccine - Dengvaxia®, which carries the prM and E genes of different dengue virus serotypes, induced a high amount of B cells and T cells [137]. We have also generated influenza vaccines that carried M2 ectodomain and/or HA stalk epitopes and could protect mice from influenza H1N1 and H3N2 challenges. In this study, four M2e sequences, from human (two copies), swine (one copy), and bird (one copy) were fused by GGG linker to form tM2e while a copy of M2e from the human influenza strain was combined with the conserved regions of HA stalk using a GSA linker to form HM2e. Then, the tM2e or HM2e was further fused with Ebola glycoprotein dendritic cell (DC)-targeting domain (E∆M) to form E∆M-tM2e or E∆M-HM2e respectively. Animal studies showed that VSV carrying E∆M-tM2e or E∆M-HM2e mediated rapid and potent induction of M2 or/and HA antibodies in mice sera and mucosa [94]. This technique can as well be used to fuse the selected conserved epitopes in the S1 region and/or S2 region as a multi-epitope-based vaccine.
Dendritic cell (DC)-targeting approach: The development of a vaccine using the DC-targeting approach has recently gained much attention [136,138,139]. Targeting SARS-CoV-2 S2 conserved antigens to antigen-presenting cells (APCs) could increase the immunogenicity of the antigens. In a study by Marlin et al. SARS-CoV-2 RBD was targeted to the cluster of differentiation (CD)-40 (αCD40.RBD ) to increase the immunogenicity of the RBD [140]. The formed vaccine candidate αCD40.RBD induced significantly high amounts of T and B cells in humanized mice while a single dose of the αCD40.RBD rapidly increased broadly neutralizing antibodies in previously SARS-CoV-2 exposed convalescent non-human primates. Moreover, CoVs SP can also be targeted to DCs by using CpG or CD205 (DEC-205) to increase the immunogenicity of the SP [136,141]. Our recent publication has demonstrated another technology for targeting DC with the use of the DC targeting domain of the Ebola GP [65,142,143]. We demonstrated that targeting the SARS-CoV-2 S2 subunit protein to DC using the DC-targeting domain of Ebola glycoprotein could induce protective immune responses in hamsters [65].
The use of adjuvants: Adjuvants such as chemokine encoding plasmids, co-stimulatory molecule encoding plasmid and Plasmids Encoding Pathogen-Recognition Receptor (PRR) Ligands and Immune-Signaling Molecules can be incorporated into plasmids and either co-express it with SARS-CoV-2 antigen or administer separately during immunization [144]. Hui et al. demonstrated that the co-expression of IL-2 with the SARS-CoV S protein in a DNA vaccine increased the immunogenicity of the SP by inducing a higher amount of IgG than the SARS-CoV S protein alone [145]. In addition, their study revealed that the electroporation method of immunization had better immune responses than intramuscular or oral administration. Gary et al. also demonstrated that the co-formulation of the plasmid-encoded mucosal chemokine cutaneous T cell-attracting chemokine (pCTACK; CCL27) with SARS-CoV-2 SP in a DNA, vaccine increased the immunogenicity against SARS-CoV-2 and confer 100% protection against the Delta VOC in mice [146]. An adjuvant can also act as a delivery system e.g., the nanoparticles increase the immunogenicity of the conserved S2 epitopes to boost T cells and B cells' immune responses [147,148,149]. The LNP-based vaccine can induce both Th1 and Th2-based immune responses with more dominant Th1-type B cells and biased Th2-type B cells [149,150]. Ma et al. developed a nanoparticle-based vaccine with the fusion of the self-assembly 24-mer ferritin with the RBD and HR or RBD alone. They showed that nanoparticle immunization in rhesus hACE2 transgenic mice reduced the lung viral loads and induced persistent neutralizing antibodies, T cells and B cells in rhesus macaques [148].

5. Conclusions

Herd immunity is achieved either through natural infection and/or immunization and it is expected to reduce or effectively eliminate the infection in a community [151]. Despite the high threshold of COVID-19 infection and massive vaccination of the public, it still seems unlikely to achieve herd immunity due to the emergence of several variants of SARS-CoV-2 [152,153,154,155]. Development of a universal vaccine against all SARS-CoV-2 variants, other endemic CoVs and potential emerging CoVs, looks promising with the use of highly conserved epitopes on the SARS-CoV-2 SP, especially the S2 subunit which can induce broadly neutralizing antibody, humoral and cell-mediated immune responses.
In the S2 subunit protein, the FP, MPER and HR2 have greater conservation among the members of both betacoronavirus and alphacoronavirus genera. However, these conserved regions can be weak immunogens. Nevertheless, the fusion of these epitopes with adjuvants, nanoparticles or in form of a multi-epitope-based vaccine can increase their immunogenicity in vaccine design. In addition, DC targeting strategy is also expected to be able to optimize the efficiency of the conserved region-based vaccine. Although different in silico, immunoinformatic or bioinformatic, and immunophenotyping studies have demonstrated the presence of conserved epitopes immunogenicity among CoVs, more in vivo studies are required to validate the broad immunogenicity of these epitopes for viral designs.

Author Contributions

T.A.O., Z-j.A., and R.U., Writing-Original Draft Preparation, T.A.O., Z-j.A and B.W. review and revision, D.K. and X-j.Y. provided conceptual advice to the manuscript, reviewed and revised the paper.

Funding

T.A.O is a recipient of the Allan Rolland Studentship Award of Department of Medical Microbiology and Infectious Diseases. This work was supported by Mitacs Accelerate Award in collaboration with North Forge and Lab2Market West to X-J.Y and T.A.O. This work was also supported by the Canadian 2019 Novel Coronavirus (COVID-19) Rapid Research Funding (OV5-170710) by the Canadian Institutes of Health Research and Research Manitoba, and CIHR COVID-19 Variant Supplement grant (VS1-175520).

Institutional Review Board Statement

Not applicable.

Data Availability Statement

Not applicable.

Conflicts of Interest

There is no conflict of interest.

References

  1. Gralinski, L.E. and V.D. Menachery, Return of the Coronavirus: 2019-nCoV. Viruses, 2020. 12(2): p. 135.
  2. Huang, C. , et al., Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China. The Lancet, 2020. 395(10223): p. 497-506.
  3. Worldometer. Coronavirus disease. 2022 September 2022]; Available from: https://www.google.com/search?q=coronavirus+death+toll&rlz=1C5CHFA_enCA1017CA1017&oq=coronavirus+death&aqs=chrome.0.0i131i433i512j69i57j0i512l8.6462j1j4&sourceid=chrome&ie=UTF-8#colocmid=/m/02j71&coasync=0.
  4. Lopez Bernal, J. , et al., Effectiveness of Covid-19 vaccines against the B. 1.617. 2 (Delta) variant. N Engl J Med, 2021: p. 585-594.
  5. Kumar, S., M. K. Saurabh, and V. Maharshi, Efficacy and safety of potential vaccine candidates against coronavirus disease 2019: A systematic review. Journal of Advanced Pharmaceutical Technology & Research, 2021. 12(3): p. 215.
  6. Zhao, F. , et al., Challenges and developments in universal vaccine design against SARS-CoV-2 variants. npj Vaccines, 2022. 7(1): p. 1-12.
  7. Van Den Brand, J.M., S. L. Smits, and B.L. Haagmans, Pathogenesis of Middle East respiratory syndrome coronavirus. The Journal of pathology, 2015. 235(2): p. 175-184.
  8. Mackay, I.M. and K.E. Arden, MERS coronavirus: diagnostics, epidemiology and transmission. Virology journal, 2015. 12(1): p. 1-21.
  9. Alharbi, N.K., S. S. Kulkarni, and D. Falzarano, Immune Responses to MERS-CoV in Humans and Animals, in Microbial Pathogenesis. 2021, Springer. p. 85-97.
  10. Cui, J., F. Li, and Z.-L. Shi, Origin and evolution of pathogenic coronaviruses. Nature reviews Microbiology, 2019. 17(3): p. 181-192.
  11. Cueno, M.E. and K. Imai, Structural comparison of the SARS CoV 2 spike protein relative to other human-infecting coronaviruses. Frontiers in Medicine, 2021. 7: p. 594439.
  12. Salian, V.S. , et al., COVID-19 transmission, current treatment, and future therapeutic strategies. Molecular pharmaceutics, 2021. 18(3): p. 754-771.
  13. Petrosillo, N. , et al., COVID-19, SARS and MERS: are they closely related? Clinical microbiology and infection, 2020. 26(6): p. 729-734.
  14. Chen, Y., Q. Liu, and D. Guo, Emerging coronaviruses: genome structure, replication, and pathogenesis. Journal of medical virology, 2020. 92(4): p. 418-423.
  15. Gorbalenya, A.E. , et al., Severe acute respiratory syndrome-related coronavirus: The species and its viruses–a statement of the Coronavirus Study Group. BioRxiv, 2020.
  16. Lu, R. , et al., Genomic characterisation and epidemiology of 2019 novel coronavirus: implications for virus origins and receptor binding. The Lancet, 2020.
  17. Beyer, D.K. and A. Forero, Mechanisms of antiviral immune evasion of SARS-CoV-2. Journal of Molecular Biology, 2022. 434(6): p. 167265.
  18. Wu, A. , et al., Genome composition and divergence of the novel coronavirus (2019-nCoV) originating in China. Cell host & microbe, 2020. 27(3): p. 325-328.
  19. Malik, Y.S. , et al., Emerging novel coronavirus (2019-nCoV)—current scenario, evolutionary perspective based on genome analysis and recent developments. Veterinary quarterly, 2020. 40(1): p. 68-76.
  20. Lan, J. , et al., Structure of the SARS-CoV-2 spike receptor-binding domain bound to the ACE2 receptor. Nature, 2020. 581(7807): p. 215-220.
  21. Li, Q. , et al., The impact of mutations in SARS-CoV-2 spike on viral infectivity and antigenicity. Cell, 2020. 182(5): p. 1284-1294. e9.
  22. Ao, Z. , et al., SARS-CoV-2 Delta Spike Protein Enhances the Viral Fusogenicity and Inflammatory Cytokine Production. bioRxiv, 2021.
  23. Daniloski, Z. , et al., The Spike D614G mutation increases SARS-CoV-2 infection of multiple human cell types. Elife, 2020. 10: p. e65365-e65379.
  24. Walls, A.C. , et al., Structure, function, and antigenicity of the SARS-CoV-2 spike glycoprotein. Cell, 2020. 181(2): p. 281-292. e6.
  25. Li, W. , et al., Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus. Nature, 2003. 426(6965): p. 450-454.
  26. Reguera, J. , et al., A structural view of coronavirus–receptor interactions. Virus research, 2014. 194: p. 3-15.
  27. Tang, T. , et al., Coronavirus membrane fusion mechanism offers a potential target for antiviral development. Antiviral research, 2020. 178: p. 104792.
  28. Poston, D. , et al., Absence of severe acute respiratory syndrome coronavirus 2 neutralizing activity in prepandemic sera from individuals with recent seasonal coronavirus infection. Clinical Infectious Diseases, 2021. 73(5): p. e1208-e1211.
  29. Elko, E.A. , et al., COVID-19 vaccination elicits an evolving, cross-reactive antibody response to epitopes conserved with endemic coronavirus spike proteins. Cell reports, 2022. 40(1): p. 111022.
  30. Grobben, M. , et al., Cross-reactive antibodies after SARS-CoV-2 infection and vaccination. Elife, 2021. 10: p. e70330.
  31. Millet, J.K. and G.R. Whittaker, Physiological and molecular triggers for SARS-CoV membrane fusion and entry into host cells. Virology, 2018. 517: p. 3-8.
  32. Chambers, P., C. R. Pringle, and A.J. Easton, Heptad repeat sequences are located adjacent to hydrophobic regions in several types of virus fusion glycoproteins. Journal of General Virology, 1990. 71(12): p. 3075-3080.
  33. Xia, S. , et al., Peptide-based membrane fusion inhibitors targeting HCoV-229E spike protein HR1 and HR2 domains. International journal of molecular sciences, 2018. 19(2): p. 487.
  34. Yu, D. , et al., Structure-based design and characterization of novel fusion-inhibitory lipopeptides against SARS-CoV-2 and emerging variants. Emerging microbes & infections, 2021. 10(1): p. 1227-1240.
  35. Wang, Q. , et al., Structural and functional basis of SARS-CoV-2 entry by using human ACE2. Cell, 2020. 181(4): p. 894-904. e9.
  36. Masters, P.S. , The molecular biology of coronaviruses. Advances in virus research, 2006. 66: p. 193-292.
  37. Glowacka, I. , et al., Evidence that TMPRSS2 activates the severe acute respiratory syndrome coronavirus spike protein for membrane fusion and reduces viral control by the humoral immune response. Journal of virology, 2011. 85(9): p. 4122-4134.
  38. Lu, G. , et al., Molecular basis of binding between novel human coronavirus MERS-CoV and its receptor CD26. Nature, 2013. 500(7461): p. 227-231.
  39. Wang, N. , et al., Structure of MERS-CoV spike receptor-binding domain complexed with human receptor DPP4. Cell research, 2013. 23(8): p. 986-993.
  40. Hulswit, R.J. , et al., Human coronaviruses OC43 and HKU1 bind to 9-O-acetylated sialic acids via a conserved receptor-binding site in spike protein domain A. Proceedings of the National Academy of Sciences, 2019. 116(7): p. 2681-2690.
  41. Jaimes, J.A. , et al., Phylogenetic analysis and structural modeling of SARS-CoV-2 spike protein reveals an evolutionary distinct and proteolytically sensitive activation loop. Journal of molecular biology, 2020. 432(10): p. 3309-3325.
  42. Laporte, M. , et al., The SARS-CoV-2 and other human coronavirus spike proteins are fine-tuned towards temperature and proteases of the human airways. PLoS pathogens, 2021. 17(4): p. e1009500.
  43. Korber, B. , et al., Tracking changes in SARS-CoV-2 spike: evidence that D614G increases infectivity of the COVID-19 virus. Cell, 2020. 182(4): p. 812-827. e19.
  44. Lu, S. , et al., The immunodominant and neutralization linear epitopes for SARS-CoV-2. Cell reports, 2021. 34(4): p. 108666.
  45. VanBlargan, L.A. , et al., A potently neutralizing SARS-CoV-2 antibody inhibits variants of concern by utilizing unique binding residues in a highly conserved epitope. Immunity, 2021. 54(10): p. 2399-2416. e6.
  46. Lv, H. , et al., Cross-reactive antibody response between SARS-CoV-2 and SARS-CoV infections. Cell reports, 2020. 31(9): p. 107725.
  47. Ao, Z. , et al., SARS-CoV-2 Delta spike protein enhances the viral fusogenicity and inflammatory cytokine production. Iscience, 2022. 25(8): p. 104759.
  48. Dosch, S.F., S. D. Mahajan, and A.R. Collins, SARS coronavirus spike protein-induced innate immune response occurs via activation of the NF-κB pathway in human monocyte macrophages in vitro. Virus research, 2009. 142(1-2): p. 19-27.
  49. Taefehshokr, N. , et al., Covid-19: perspectives on innate immune evasion. Frontiers in immunology, 2020. 11: p. 580641.
  50. Sette, A. and S. Crotty, Adaptive immunity to SARS-CoV-2 and COVID-19. Cell, 2021. 184(4): p. 861-880.
  51. O’Connell, P. and Y.A. Aldhamen, Systemic innate and adaptive immune responses to SARS-CoV-2 as it relates to other coronaviruses. Human Vaccines & Immunotherapeutics, 2020. 16(12): p. 2980-2991.
  52. Liu, X., R. I. Nurieva, and C. Dong, Transcriptional regulation of follicular T-helper (Tfh) cells. Immunological reviews, 2013. 252(1): p. 139-145.
  53. Kaneko, N. , et al., Loss of Bcl-6-expressing T follicular helper cells and germinal centers in COVID-19. Cell, 2020. 183(1): p. 143-157. e13.
  54. Lu, X. , et al., Identification of conserved SARS-CoV-2 spike epitopes that expand public cTfh clonotypes in mild COVID-19 patients. Journal of Experimental Medicine, 2021. 218(12).
  55. Crotty, S. , T follicular helper cell differentiation, function, and roles in disease. Immunity, 2014. 41(4): p. 529-542.
  56. Crotty, S. , T follicular helper cell biology: a decade of discovery and diseases. Immunity, 2019. 50(5): p. 1132-1148.
  57. Moderbacher, C.R. , et al., Antigen-specific adaptive immunity to SARS-CoV-2 in acute COVID-19 and associations with age and disease severity. Cell, 2020. 183(4): p. 996-1012. e19.
  58. Meckiff, B.J. , et al., Imbalance of regulatory and cytotoxic SARS-CoV-2-reactive CD4+ T cells in COVID-19. Cell, 2020. 183(5): p. 1340-1353. e16.
  59. Meyer, B., C. Drosten, and M.A. Müller, Serological assays for emerging coronaviruses: challenges and pitfalls. Virus research, 2014. 194: p. 175-183.
  60. Suthar, M.S. , et al., Rapid generation of neutralizing antibody responses in COVID-19 patients. Cell Reports Medicine, 2020. 1(3): p. 100040.
  61. Burbelo, P.D. , et al., Sensitivity in detection of antibodies to nucleocapsid and spike proteins of severe acute respiratory syndrome coronavirus 2 in patients with coronavirus disease 2019. The Journal of infectious diseases, 2020. 222(2): p. 206-213.
  62. Grifoni, A. , et al., Targets of T cell responses to SARS-CoV-2 coronavirus in humans with COVID-19 disease and unexposed individuals. Cell, 2020. 181(7): p. 1489-1501. e15.
  63. Juno, J.A. , et al., Humoral and circulating follicular helper T cell responses in recovered patients with COVID-19. Nature medicine, 2020. 26(9): p. 1428-1434.
  64. Peng, Y. , et al., Broad and strong memory CD4+ and CD8+ T cells induced by SARS-CoV-2 in UK convalescent individuals following COVID-19. Nature immunology, 2020. 21(11): p. 1336-1345.
  65. Ao, Z. , et al., A Recombinant VSV-Based Bivalent Vaccine Effectively Protects against Both SARS-CoV-2 and Influenza A Virus Infection. Journal of Virology, 2022: p. e01337-22.
  66. Sahni, C. , et al., SARS-CoV-2 Mutations Responsible for Immune Evasion Leading to Breakthrough Infection. Cureus, 2022. 14(9).
  67. Watson, O.J. , et al., Global impact of the first year of COVID-19 vaccination: a mathematical modelling study. The Lancet Infectious Diseases, 2022. 22(9): p. 1293-1302.
  68. Hall, V.J. , et al., SARS-CoV-2 infection rates of antibody-positive compared with antibody-negative health-care workers in England: a large, multicentre, prospective cohort study (SIREN). The Lancet, 2021. 397(10283): p. 1459-1469.
  69. Ao, D. , et al., SARS-CoV-2 Omicron variant: Immune escape and vaccine development. MedComm, 2022. 3(1): p. e126.
  70. Yuan, M. , et al., A highly conserved cryptic epitope in the receptor binding domains of SARS-CoV-2 and SARS-CoV. Science, 2020. 368(6491): p. 630-633.
  71. Mohammadi, M., M. Shayestehpour, and H. Mirzaei, The impact of spike mutated variants of SARS-CoV2 [Alpha, Beta, Gamma, Delta, and Lambda] on the efficacy of subunit recombinant vaccines. Brazilian Journal of Infectious Diseases, 2021. 25.
  72. Shah, M. and H.G. Woo, Omicron: a heavily mutated SARS-CoV-2 variant exhibits stronger binding to ACE2 and potently escapes approved COVID-19 therapeutic antibodies. Frontiers in immunology, 2022: p. 6031.
  73. LLC, G.
  74. 74. EMERGENCY USE AUTHORIZATION (EUA) OF SOTROVIMAB, /: 2022 , 2022]; Available from: https, 29 September 2022.
  75. Hoffmann, M. , et al., SARS-CoV-2 variant B. 1.617 is resistant to bamlanivimab and evades antibodies induced by infection and vaccination. Cell reports, 2021. 36(3): p. 109415.
  76. Thomson, E.C. , et al., Circulating SARS-CoV-2 spike N439K variants maintain fitness while evading antibody-mediated immunity. Cell, 2021. 184(5): p. 1171-1187. e20.
  77. Cao, Y. , et al., Omicron escapes the majority of existing SARS-CoV-2 neutralizing antibodies. Nature, 2022. 602(7898): p. 657-663.
  78. Ao, Z. , et al., SARS-CoV-2 Delta Spike Protein Enhances the Viral Fusogenicity and Inflammatory Cytokine Production (preprint). 2021.
  79. Edara, V.V. , et al., Infection-and vaccine-induced antibody binding and neutralization of the B. 1.351 SARS-CoV-2 variant. Cell host & microbe, 2021. 29(4): p. 516-521. e3.
  80. Emary, K.R. , et al., Efficacy of ChAdOx1 nCoV-19 (AZD1222) vaccine against SARS-CoV-2 variant of concern 202012/01 (B. 1.1. 7): an exploratory analysis of a randomised controlled trial. The Lancet, 2021. 397(10282): p. 1351-1362.
  81. Wu, M. , et al., Three-dose vaccination elicits neutralising antibodies against omicron. The Lancet, 2022. 399(10326): p. 715-717.
  82. Ng, K.T., N. K. Mohd-Ismail, and Y.-J. Tan, Spike S2 subunit: the dark horse in the race for prophylactic and therapeutic interventions against SARS-CoV-2. Vaccines, 2021. 9(2): p. 178.
  83. Helmsdal, G. , et al., Omicron outbreak at a private gathering in the Faroe Islands, infecting 21 of 33 triple-vaccinated healthcare workers. Clinical Infectious Diseases, 2022. 75(5): p. 893-896.
  84. Tada, T. , et al., Increased resistance of SARS-CoV-2 Omicron variant to neutralization by vaccine-elicited and therapeutic antibodies. EBioMedicine, 2022. 78: p. 103944.
  85. Hoffmann, M. , et al., The Omicron variant is highly resistant against antibody-mediated neutralization: Implications for control of the COVID-19 pandemic. Cell, 2022. 185(3): p. 447-456. e11.
  86. Mengist, H.M. , et al. Mutations of SARS-CoV-2 spike protein: Implications on immune evasion and vaccine-induced immunity, 2021. [Google Scholar]
  87. Simon-Loriere, E. and O. Schwartz, Towards SARS-CoV-2 serotypes? Nature Reviews Microbiology, 2022. 20(4): p. 187-188.
  88. Walls, A.C. , et al., Tectonic conformational changes of a coronavirus spike glycoprotein promote membrane fusion. Proceedings of the National Academy of Sciences, 2017. 114(42): p. 11157-11162.
  89. Erbelding, E.J. , et al., A universal influenza vaccine: the strategic plan for the National Institute of Allergy and Infectious Diseases. The Journal of infectious diseases, 2018. 218(3): p. 347-354.
  90. Nachbagauer, R. and F. Krammer, Universal influenza virus vaccines and therapeutic antibodies. Clinical Microbiology and Infection, 2017. 23(4): p. 222-228.
  91. Neirynck, S. , et al., A universal influenza A vaccine based on the extracellular domain of the M2 protein. Nature medicine, 1999. 5(10): p. 1157-1163.
  92. Saelens, X. , The role of matrix protein 2 ectodomain in the development of universal influenza vaccines. The Journal of infectious diseases, 2019. 219(Supplement_1): p. S68-S74.
  93. Uranowska, K. , et al., Hemagglutinin stalk domain from H5N1 strain as a potentially universal antigen. Acta Biochimica Polonica, 2014. 61(3).
  94. Turley, C.B. , et al., Safety and immunogenicity of a recombinant M2e–flagellin influenza vaccine (STF2. 4xM2e) in healthy adults. Vaccine, 2011. 29(32): p. 5145-5152.
  95. Olukitibi, T. , et al., Development and characterization of influenza M2 ectodomain and/or hemagglutinin stalk-based dendritic cell-targeting vaccines. Frontiers in Microbiology, 2022. 13: p. 937192-937206.
  96. Chauhan, V. , et al., Designing a multi-epitope based vaccine to combat Kaposi Sarcoma utilizing immunoinformatics approach. Scientific reports, 2019. 9(1): p. 1-15.
  97. Guest, J.D. and B.G. Pierce, Structure-based and rational design of a hepatitis C virus vaccine. Viruses, 2021. 13(5): p. 837.
  98. Ahmed, S.F. , et al., Cross-serotypically conserved epitope recommendations for a universal T cell-based dengue vaccine. PLoS neglected tropical diseases, 2020. 14(9): p. e0008676.
  99. Dixit, N.K. , Design of Monovalent and Chimeric Tetravalent Dengue Vaccine Using an Immunoinformatics Approach. International Journal of Peptide Research and Therapeutics, 2021. 27(4): p. 2607-2624.
  100. Ali, M. , et al., Exploring dengue genome to construct a multi-epitope based subunit vaccine by utilizing immunoinformatics approach to battle against dengue infection. Scientific reports, 2017. 7(1): p. 1-13.
  101. Sampath, A. and R. Padmanabhan, Molecular targets for flavivirus drug discovery. Antiviral research, 2009. 81(1): p. 6-15.
  102. Mateo, M. , et al., A single-shot Lassa vaccine induces long-term immunity and protects cynomolgus monkeys against heterologous strains. Science Translational Medicine, 2021. 13(597): p. eabf6348.
  103. ter Meulen, J. , et al., Old and New World arenaviruses share a highly conserved epitope in the fusion domain of the glycoprotein 2, which is recognized by Lassa virus-specific human CD4+ T-cell clones. Virology, 2004. 321(1): p. 134-143.
  104. ter Meulen, J. , et al., Characterization of human CD4+ T-cell clones recognizing conserved and variable epitopes of the Lassa virus nucleoprotein. Journal of virology, 2000. 74(5): p. 2186-2192.
  105. Sankaranarayanan, S., M. Mohkhedkar, and V. Janakiraman, Mutations in spike protein T cell epitopes of SARS-COV-2 variants: Plausible influence on vaccine efficacy. Biochimica et Biophysica Acta (BBA)-Molecular Basis of Disease, 2022: p. 166432.
  106. Kombe Kombe, A.J. , et al., Potent molecular feature-based neutralizing monoclonal antibodies as promising therapeutics against SARS-CoV-2 infection. Frontiers in molecular biosciences, 2021. 8: p. 670815.
  107. Jaiswal, V. and H.-J. Lee, Conservation and Evolution of Antigenic Determinants of SARS-CoV-2: An Insight for Immune Escape and Vaccine Design. Frontiers in immunology, 2022. 13.
  108. Bagherzadeh, M.A. , et al., Considering epitopes conservity in targeting SARS-CoV-2 mutations in variants: a novel immunoinformatics approach to vaccine design. Scientific reports, 2022. 12(1): p. 1-17.
  109. Kibria, K. , et al., A conserved subunit vaccine designed against SARS-CoV-2 variants showed evidence in neutralizing the virus. Applied microbiology and biotechnology, 2022: p. 1-24.
  110. Jiang, S. , et al., Identification of a promiscuous conserved CTL epitope within the SARS-CoV-2 spike protein. Emerging microbes & infections, 2022. 11(1): p. 730-740.
  111. Ladner, J.T. , et al., Epitope-resolved profiling of the SARS-CoV-2 antibody response identifies cross-reactivity with endemic human coronaviruses. Cell Reports Medicine, 2021. 2(1): p. 100189.
  112. Wu, W.-L. , et al., Monoclonal antibody targeting the conserved region of the SARS-CoV-2 spike protein to overcome viral variants. JCI insight, 2022. 7(8).
  113. Li, Y. , et al., Linear epitopes of SARS-CoV-2 spike protein elicit neutralizing antibodies in COVID-19 patients. Cellular & Molecular Immunology, 2020. 17(10): p. 1095-1097.
  114. Poh, C.M. , et al., Two linear epitopes on the SARS-CoV-2 spike protein that elicit neutralising antibodies in COVID-19 patients. Nature Communications, 2020. 11(1): p. 2806.
  115. Xia, S. , et al., A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike. Sci Adv, 2019. 5(4): p. eaav4580.
  116. Smith, T.R.F. , et al., Immunogenicity of a DNA vaccine candidate for COVID-19. Nature Communications, 2020. 11(1): p. 2601.
  117. Ng, K.W. , et al., Preexisting and de novo humoral immunity to SARS-CoV-2 in humans. Science, 2020. 370(6522): p. 1339-1343.
  118. Nguyen-Contant, P. , et al., S protein-reactive IgG and memory B cell production after human SARS-CoV-2 infection includes broad reactivity to the S2 subunit. MBio, 2020. 11(5): p. e01991-20.
  119. Pinto, D. , et al., Broad betacoronavirus neutralization by a stem helix–specific human antibody. Science, 2021. 373(6559): p. 1109-1116.
  120. Song, G. , et al., Cross-reactive serum and memory B-cell responses to spike protein in SARS-CoV-2 and endemic coronavirus infection. Nature communications, 2021. 12(1): p. 1-10.
  121. Zhu, Y. , et al., SARS-CoV-2-derived fusion inhibitor lipopeptides exhibit highly potent and broad-spectrum activity against divergent human coronaviruses. Signal transduction and targeted therapy, 2021. 6(1): p. 1-3.
  122. Pinto, D. , et al., Structural basis for broad HIV-1 neutralization by the MPER-specific human broadly neutralizing antibody LN01. Cell host & microbe, 2019. 26(5): p. 623-637. e8.
  123. Zhang, L. , et al., An MPER antibody neutralizes HIV-1 using germline features shared among donors. Nature communications, 2019. 10(1): p. 1-16.
  124. Pietzsch, J. , et al., Anti-gp41 antibodies cloned from HIV-infected patients with broadly neutralizing serologic activity. Journal of virology, 2010. 84(10): p. 5032-5042.
  125. Ma, C. , et al., From SARS-CoV to SARS-CoV-2: safety and broad-spectrum are important for coronavirus vaccine development. Microbes and Infection, 2020. 22(6-7): p. 245-253.
  126. Zeng, F. , et al., Quantitative comparison of the efficiency of antibodies against S1 and S2 subunit of SARS coronavirus spike protein in virus neutralization and blocking of receptor binding: implications for the functional roles of S2 subunit. FEBS letters, 2006. 580(24): p. 5612-5620.
  127. Guo, Y. , et al., Elicitation of immunity in mice after immunization with the S2 subunit of the severe acute respiratory syndrome coronavirus. DNA and cell biology, 2005. 24(8): p. 510-515.
  128. Wang, L. , et al., Evaluation of candidate vaccine approaches for MERS-CoV. Nature communications, 2015. 6(1): p. 1-11.
  129. Chen, Y. , et al., A novel neutralizing monoclonal antibody targeting the N-terminal domain of the MERS-CoV spike protein. Emerg Microbes Infect 6: e60. 2017.
  130. Elshabrawy, H.A. , et al., Human monoclonal antibodies against highly conserved HR1 and HR2 domains of the SARS-CoV spike protein are more broadly neutralizing. PloS one, 2012. 7(11): p. e50366.
  131. Li, H. , et al., T cell epitopes are largely conserved in the SARS-CoV-2 Omicron subvariant (BA. 1, BA. 2, BA. 3, and GKA). Journal of Medical Virology, 2022. 94(10): p. 4591-4592.
  132. Tarke, A. , et al., Comprehensive analysis of T cell immunodominance and immunoprevalence of SARS-CoV-2 epitopes in COVID-19 cases. Cell Reports Medicine, 2021. 2(2): p. 100204.
  133. Saini, S.K. , et al., SARS-CoV-2 genome-wide T cell epitope mapping reveals immunodominance and substantial CD8+ T cell activation in COVID-19 patients. Science immunology, 2021. 6(58): p. eabf7550.
  134. Jiang, M. , et al., Epitope profiling reveals the critical antigenic determinants in SARS-CoV-2 RBD-based antigen. Frontiers in Immunology, 2021. 12.
  135. Polyiam, K. , et al., Immunodominant linear B cell epitopes in the spike and membrane proteins of SARS-CoV-2 identified by immunoinformatics prediction and immunoassay. Scientific reports, 2021. 11(1): p. 1-17.
  136. Duan, L. , et al., The SARS-CoV-2 spike glycoprotein biosynthesis, structure, function, and antigenicity: implications for the design of spike-based vaccine immunogens. Frontiers in immunology, 2020. 11: p. 576622.
  137. Olukitibi, T.A. , et al., Dendritic cells/macrophages-targeting feature of Ebola glycoprotein and its potential as immunological facilitator for antiviral vaccine approach. Microorganisms, 2019. 7(10): p. 402.
  138. Lim, H.X., J. Lim, and C.L. Poh, Identification and selection of immunodominant B and T cell epitopes for dengue multi-epitope-based vaccine. Medical microbiology and immunology, 2021. 210(1): p. 1-11.
  139. Brandão, J.G. , et al., CD40-targeted adenoviral gene transfer to dendritic cells through the use of a novel bispecific single-chain Fv antibody enhances cytotoxic T cell activation. Vaccine, 2003. 21(19): p. 2268-2272.
  140. Fossum, E. , et al., Vaccine molecules targeting Xcr1 on cross-presenting DCs induce protective CD8+ T-cell responses against influenza virus. European journal of immunology, 2014. 45(2): p. 624-635.
  141. Marlin, R. , et al., Targeting SARS-CoV-2 receptor-binding domain to cells expressing CD40 improves protection to infection in convalescent macaques. Nature communications, 2021. 12(1): p. 1-9.
  142. Deng, Y. , et al., Enhanced protection in mice induced by immunization with inactivated whole viruses compare to spike protein of middle east respiratory syndrome coronavirus. Emerging Microbes & Infections, 2018. 7(1): p. 1-10.
  143. Ao, Z. , et al., Incorporation of Ebola glycoprotein into HIV particles facilitates dendritic cell and macrophage targeting and enhances HIV-specific immune responses. PLOS ONE, 2019. 14(5): p. e0216949-e0217067.
  144. Ao, Z. , et al., Development and Evaluation of an Ebola Virus Glycoprotein Mucin-Like Domain Replacement System as a New DC-Targeting Vaccine Approach Against HIV-1. Journal of virology, 2021. 95(15): p. 02368-20.
  145. Sabbaghi, A. and A. Ghaemi, Molecular adjuvants for DNA vaccines: application, design, preparation, and formulation, in DNA Vaccines. 2021, Springer. p. 87-112.
  146. Hu, H. , et al., Induction of specific immune responses by severe acute respiratory syndrome coronavirus spike DNA vaccine with or without interleukin-2 immunization using different vaccination routes in mice. Clinical and Vaccine Immunology, 2007. 14(7): p. 894-901.
  147. Gary, E.N. , et al., Mucosal chemokine adjuvant enhances synDNA vaccine-mediated responses to SARS-CoV-2 and provides heterologous protection in vivo. Cell Reports Medicine, 2022. 3(7): p. 100693.
  148. Eusébio, D. , et al., Methods to improve the immunogenicity of plasmid DNA vaccines. Drug Discovery Today, 2021. 26(11): p. 2575-2592.
  149. Ma, X. , et al., Nanoparticle vaccines based on the receptor binding domain (RBD) and heptad repeat (HR) of SARS-CoV-2 elicit robust protective immune responses. Immunity, 2020. 53(6): p. 1315-1330. e9.
  150. Swaminathan, G. , et al., A novel lipid nanoparticle adjuvant significantly enhances B cell and T cell responses to sub-unit vaccine antigens. Vaccine, 2016. 34(1): p. 110-119.
  151. Dong, Y. , et al., A systematic review of SARS-CoV-2 vaccine candidates. Signal transduction and targeted therapy, 2020. 5(1): p. 1-14.
  152. Desai, A.N. and M.S. Majumder, What is herd immunity? JAMA, 2020. 324(20): p. 2113-2113.
  153. Aschwanden, C. , Five reasons why COVID herd immunity is probably impossible. Nature, 2021: p. 520-522.
  154. Morens, D.M., G. K. Folkers, and A.S. Fauci, The concept of classical herd immunity may not apply to COVID-19. The Journal of Infectious Diseases, 2022.
  155. Ashton, J. , COVID-19 and herd immunity. Journal of the Royal Society of Medicine, 2022. 115(2): p. 76-77.
  156. MacIntyre, C.R., V. Costantino, and M. Trent, Modelling of COVID-19 vaccination strategies and herd immunity, in scenarios of limited and full vaccine supply in NSW, Australia. Vaccine, 2022. 40(17): p. 2506-2513.
  157. Vishwakarma, P. , et al., Severe acute respiratory syndrome coronavirus 2 spike protein based novel epitopes induce potent immune responses in vivo and inhibit viral replication in vitro. Frontiers in immunology, 2021. 12: p. 613045.
  158. Muraoka, D. , et al., Identification of a dominant CD8+ CTL epitope in the SARS-associated coronavirus 2 spike protein. Vaccine, 2020. 38(49): p. 7697-7701.
  159. Lin, J. , et al., Longitudinal Assessment of SARS-CoV-2 Specific T Cell Cytokine-Producing Responses for 1 Year Reveals Persistence of Multi-Cytokine Proliferative Responses, with Greater Immunity Associated with Disease Severity. bioRxiv, 2022.
  160. Martin, W.R. and F. Cheng, A rational design of a multi-epitope vaccine against SARS-CoV-2 which accounts for the glycan shield of the spike glycoprotein. Journal of Biomolecular Structure and Dynamics, 2021: p. 1-15.
  161. Lim, H.X. , et al., Identification of B-Cell Epitopes for Eliciting Neutralizing Antibodies against the SARS-CoV-2 Spike Protein through Bioinformatics and Monoclonal Antibody Targeting. International Journal of Molecular Sciences, 2022. 23(8): p. 4341.
  162. Mallavarpu Ambrose, J. , et al., Comparison of immunological profiles of SARS-CoV-2 variants in the COVID-19 pandemic trends: an immunoinformatics approach. Antibiotics, 2021. 10(5): p. 535.
  163. Cuspoca, A.F., P. I. Estrada, and A. Velez-van-Meerbeke, Molecular mimicry of SARS-CoV-2 spike protein in the nervous system: a bioinformatics approach. Computational and Structural Biotechnology Journal, 2022. 20: p. 6041-6054.
Table 1. Some predicted conserved epitopes on the SARS-CoV-2 S1 subunit that could induce neutralizing antibodies and/or adaptive immune responses.
Table 1. Some predicted conserved epitopes on the SARS-CoV-2 S1 subunit that could induce neutralizing antibodies and/or adaptive immune responses.
Conserved epitopes Position Immune Response induced Type of study Ref.
B cells/Neutralizing antibodies T cells
YLTPGDSSSGWTAGAAAYYV 247-267 aa Yes Yes Mathematically (in-house developed PERL scripts), in vivo [106,156]
YYVGYLQPRTFLLKY 264-278 aa NT Yes Web-based analytic tools [109]
VRFPNITNL 327-335 aa NT Yes Immunoinformatic, In vivo [107,157]
FNATRFASVYAWNRK 342-356 aa Yes Yes In silico, T-cell epitope mapping, molecular dynamics simulations and immunoinformatic [108,158,159]
TFKCYGVSPTKLNDL 376-390 aa Yes Yes Mathematically (in-house developed PERL scripts), Bioinformatic, Monoclonal antibody targeting [106,160]
PYRVVVLSF 507-515 aa NT Yes Immunoinformatic [107]
LPFQQFGRDIADT 543 -589 aa Yes Yes PepSeq Analysis [110]
Table 2. Some predicted conserved epitopes on the SARS-CoV-2 S2 subunit that could induce neutralizing antibodies and/or adaptive immune responses.
Table 2. Some predicted conserved epitopes on the SARS-CoV-2 S2 subunit that could induce neutralizing antibodies and/or adaptive immune responses.
Conserved epitopes Position Immune Response induced Type of study Ref.
Neutralizing antibodies T cells
EDLLFN 819-824 aa Yes NT Epitope-resolved profiling, Structural and functional test [110,118]
EELDKYF 1150 -1156 aa Yes NT Epitope-resolved profiling, structural and functional [110,118]
GVVFLHVTY 1059-1067 aa NT Yes Immunoinformatic [107,161]
VVFLHVTYV 1060-1068 aa NT Yes Immunoinformatic [107,161]
FLHVTYVPAQEKNFT 1062-1072 aa Yes Yes In silico, In vivo [108]
SPDVDLGDISGINAS 1161-1175 aa Neutralizing antibodies NT In vivo [111]
LNEVAKNLNESLIDLQELGK 1186-1205 aa Yes Yes Mathematically (in-house developed PERL scripts), Bioinformatic, in vivo [106,156,162]
GKYEQYIK 1204-1211 aa NT NT Antiviral inhibitory activity [34]
NT- Not tested.
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
Copyright: This open access article is published under a Creative Commons CC BY 4.0 license, which permit the free download, distribution, and reuse, provided that the author and preprint are cited in any reuse.
Prerpints.org logo

Preprints.org is a free preprint server supported by MDPI in Basel, Switzerland.

Subscribe

© 2026 MDPI (Basel, Switzerland) unless otherwise stated

Accessibility

Disclaimer

Terms of Use

Privacy Policy

Privacy Settings