Submitted:
14 August 2024
Posted:
15 August 2024
You are already at the latest version
Abstract
Keywords:
1. Background
2. Methodology
- -
- >sp|A0A7H0DN80|PG108_MONPV Envelope protein OPG108 OS=Monkeypox virus OX=10244 GN=OPG108 PE=2 SV=1
- -
- >sp|A0A7H0DNB5|PG143_MONPV Virion membrane protein OPG143 OS=Monkeypox virus OX=10244 GN=OPG143 PE=3 SV=1
3. Results & Discussion
Supplementary Materials
Funding
Conflicts of Interest
References
- Masirika LM, et al. Complete Genome Sequencing, Annotation, and Mutational Profiling of the Novel Clade I Human Mpox Virus, Kamituga Strain. J Infect Dev Ctries 2024, 18:600–608. [CrossRef]
- Katoto PDMC, et al. Shifting transmission patterns of human mpox in South Kivu, DR Congo. Lancet Infect Dis. (2024). [CrossRef]
- Ritter JM, et al. Mpox Pathology Working Group. Pathology and Monkeypox virusLocalization in Tissues From Immunocompromised Patients With Severe or Fatal Mpox, The J of Infect Dis, 229 (2), (2024).
- Duarte-Neto AN, et al. Main autopsy findings of visceral involvement by fatal mpox in patients with AIDS: necrotising nodular pneumonia, nodular ulcerative colitis, and diffuse vasculopathy. Lancet Infect Dis. 23(11), (2023). [CrossRef]
- PAVM Framework-for-Action Available at the following url: https://africacdc.org/download/partnershipsfor-african-vaccine-manufacturing-pavm-framework-for-action.
- Vaccine R&D and Vaccine Manufacturing Competency Frameworks – Africa CDC. Available at the following url: https://africacdc.org/download/vaccine-rd-nd-vaccine-manufacturing-competencyframeworks/.
- Business and Operational Models for African Biomanufacturing Training Initiatives – Africa CDC. Available at the following url: https://africacdc.org/download/business-and-operational-models-forafrican-biomanufacturing-training-centres/.
- Wayengera, M.et al. Proteomics of Marburg and Ebola Glycoproteins: Insights into Their Physicochemical Similarities and Irregularities. African Journal of Biotechnology 2009, 8.
- Babirye, P., et al. . Identity and Validity of Conserved B Cell Epitopes of Filovirus Glycoprotein: Towards Rapid Diagnostic Testing for Ebola and Possibly Marburg Virus Disease. BMC Infect Dis 2018, 18, 498. [CrossRef]
- Wayengera M, et al.. Cloning, Expression and Purification of recombinant forms of Full Length and Extracellular Domain EBOV Glycoprotein within Mammalian Cell-Lines. J Antivir Antiretrovir. 2019, 11:187. [CrossRef]
- Bongcam-Rudloff E, et al. Consensus DNA and amino acids sequences of the recombinant panfilovirus glycoprotein specific mAb 4B3B5 and its expression in CHO mammalian cell lines. Research Square. 2023. DOI: https://doi.org/10.21203/rs.3.rs-2532962/v1.
- Vlachakis D, et al. Coding DNA of the recombinant panfilovirus mAb 7C8F1: cloning and expression in CHO mammalian cell lines. Research Square. 2023. [CrossRef]
- Plewczynski D, et al. Sequencing, cloning and expression of the panfilovirus glycoprotein specific recombinant mAb 8C12F11 in a CHO mammalian cell line. Research Square. 2023. DOI: https://doi.org/10.21203/rs.3.rs-2532766/v1.
- Wiśniewski M,et al. Use of in silico approaches, synthesis and profiling of Pan-filovirus GP-1,2 preprotein specific antibodies. Brief Funct Genomics. 2024 Apr 11:elae012. doi: 10.1093/bfgp/elae012. Epub ahead of print. PMID: 38605526.
- Dhanda SK, et al. IEDB-AR: immune epitope database-analysis resource in 2019. Nucleic Acids Res. 2019 Jul 2;47(W1):W502-W506. doi: 10.1093/nar/gkz452. PMID: 31114900; PMCID: PMC6602498.
- de Araújo LP, de Melo Santos NC, Corsetti PP, de Almeida LA. Immunoinformatic Approach for Rational Identification of Immunogenic Peptides Against Host Entry and/or Exit Mpox Proteins and Potential Multiepitope Vaccine Construction. J Infect Dis. 2024 Mar 26;229(Supplement_2):S285-S292. [CrossRef] [PubMed]
- Wang Y, Yang K, Zhou H. Immunogenic proteins and potential delivery platforms for mpox virus vaccine development: A rapid review. Int J Biol Macromol. 2023 Aug 1;245:125515. doi: 10.1016/j.ijbiomac.2023.125515. Epub 2023 Jun 21. PMID: 37353117; PMCID: PMC10284459.
- de Araújo LP, Silva EN, Corsetti PP, de Almeida LA. Shared immunogenic epitopes between host entry and exit proteins from monkeypox and Alaskapox viruses. Lancet Microbe. 2024, 5(7):624-625. doi: 10.1016/S2666-5247(24)00095-8. Epub 2024 Apr 20. PMID: 38653317.
- Lu GW, et al. Structure of the vaccinia virus A16/G9 sub-complex from the orthopoxvirus entry-fusion complex. (2023) Emerg Microbes Infect 2023, 12: 2179351-2179351.
- Yefet R, et al. Monkeypox infection elicits strong antibody and B cell response against A35R and H3L antigens. iScience. 2023, 26(2):105957. doi: 10.1016/j.isci.2023.105957. Epub 2023 Jan 13. PMID: 36687315; PMCID: PMC9838220.
- Zuiani A, et al. A multivalent mRNA monkeypox virus vaccine (BNT166) protects mice and macaques from orthopoxvirus disease. Cell. 2024, 187(6):1363-1373.e12. doi: 10.1016/j.cell.2024.01.017. Epub 2024 Feb 15. PMID: 38366591.
- Ahmed SF, Sohail MS, Quadeer AA, McKay MR. Vaccinia-Virus-Based Vaccines Are Expected to Elicit Highly Cross-Reactive Immunity to the 2022 Monkeypox Virus. Viruses. 2022, 14(9):1960. doi: 10.3390/v14091960. PMID: 36146766; PMCID: PMC9506226.


| Epitope # | Position and amino acids composition |
|---|---|
| 1 | 17-PPSETFPNVHEHINDQKFDDVKDNEVMQEKRDVVIVNDDPDHY-59 |
| 2 | 28-HINDQKFDDVKDNEVMQEKR-47 |
| 3 | 236-YVEHDPRLVAEH-247 |
| Epitope # | Position and amino acids composition |
|---|---|
| 1 | 11-KIETGIADIRD-21 |
| 2 | 44-YMYYYETSPGEI-55 |
| 3 | 104-QNEVTPEYIKDLKYATDYIA-123 |
| 4 | 270-KKDYLLGDSDSVAKCCSKTNTKHCPKIFNNNYKTEHC-290 |
| 5 | 291-CKYVGCTINVNSL-303 |
| 6 | 110-EYIKDLKYA-118 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).