Preprint
Article

This version is not peer-reviewed.

Targeting MERS-CoV Spike Fusion Machinery with Antiviral Peptides (AVPs): In Silico Exploration of the Heptad Repeat 2 (HR2) Domain

Submitted:

31 May 2025

Posted:

02 June 2025

You are already at the latest version

Abstract
Middle East Respiratory Syndrome Coronavirus (MERS-CoV) remains a significant global health threat, necessitating the development of effective antiviral therapeutics. Targeting the heptad repeat 2 (HR2) domain of the MERS-CoV spike protein offers a promising strategy to inhibit viral fusion and entry into host cells. This study investigates a panel of antiviral peptides (AVPs), focusing on Griffithsin, Brevinin-2, and CCL20, to evaluate their potential as fusion inhibitors against the HR2 domain. Employing comprehensive computational approaches, including molecular docking, molecular dynamics (MD) simulations, and MM/PBSA binding free energy calculations, we characterized the peptide-protein interactions and stability of these AVPs in complex with HR2. Our results demonstrate that Griffithsin, Brevinin-2, and CCL20 exhibit stronger binding affinities (−213.69, −168.83, and −165.17 kcal/mol, respectively) compared to the standard inhibitor Peptide-6 (−49.73 kcal/mol). MD simulations reveal stable complexes and indicate disruption of critical hydrogen bonds in the Ile1255–Gln1271 region of HR2, essential for six-helix bundle formation and viral fusion. Physicochemical analyses further suggest favorable stability, half-life, and low hemolytic potential, supporting their suitability as therapeutic candidates. These findings align with prior studies highlighting the broad-spectrum antiviral activity of Griffithsin and validate the therapeutic promise of Brevinin-2 and CCL20. While this computational investigation lays the groundwork, further in vitro and in vivo validation and optimization of pharmacokinetics and delivery are necessary for clinical development. This study advances the rational design of peptide-based fusion inhibitors targeting MERS-CoV and provides valuable insights into antiviral strategies against emerging coronaviruses.
Keywords: 
;  ;  ;  ;  

1. Introduction

The emergence of Middle East Respiratory Syndrome Coronavirus (MERS-CoV) in 2012 marked a significant addition to the list of zoonotic pathogens with pandemic potential [1]. First identified in Saudi Arabia, MERS-CoV has since caused sporadic outbreaks with a high case fatality rate, estimated at approximately 43% [2]. Despite global surveillance and containment efforts, the absence of approved vaccines or specific antiviral therapies underscores the urgent need for effective therapeutic strategies against MERS-CoV infections [3]. MERS-CoV is an enveloped, positive-sense single-stranded RNA virus belonging to the Betacoronavirus genus [4]. Its spike (S) glycoprotein, a trimeric class I fusion protein, facilitates viral entry into host cells and is divided into two functional subunits: S1, responsible for receptor binding, and S2, which mediates membrane fusion [5,6]. The S1 subunit contains the receptor-binding domain (RBD) that specifically interacts with the human dipeptidyl peptidase 4 (DPP4) receptor, initiating viral attachment. Subsequent conformational changes in the S2 subunit lead to the fusion of viral and host membranes, a critical step for viral entry and replication [7,8].
Two heptad repeat regions within the S2 subunit are central to the membrane fusion process: heptad repeat 1 (HR1) and heptad repeat 2 (HR2) [9]. HR1 forms a central trimeric coiled-coil structure upon activation, exposing hydrophobic grooves that serve as binding sites for HR2 [10]. The interaction between HR1 and HR2 culminates in the formation of a six-helix bundle (6-HB), effectively bringing viral and cellular membranes into proximity to facilitate fusion [11,12]. Disrupting this HR1-HR2 interaction presents a viable target for antiviral intervention. Similar strategies have been explored for MERS-CoV, drawing parallels from HIV-1 research, where HR2-derived peptides like enfuvirtide (T20) have been successfully employed as fusion inhibitors [13]. Peptides derived from the HR2 region can competitively bind to HR1, preventing the native HR1-HR2 interaction and subsequent 6-HB formation [14]. The HR2-derived peptide HR2P has demonstrated potent inhibitory effects on MERS-CoV S-mediated cell-cell fusion and viral replication in vitro [15]. Modifications to HR2P, such as the introduction of hydrophilic residues, have further enhanced its stability, solubility, and antiviral activity, leading to the development of analogs like HR2P-M2 [12]. In addition to HR2P and its analogs, other HR2-derived peptides have been identified with significant anti-MERS-CoV activity [16]. For instance, peptides derived from the HR2 region of bat coronavirus HKU4, such as HKU4-HR2P2 and HKU4-HR2P3, have shown potent inhibitory effects on MERS-CoV S-mediated cell-cell fusion and pseudovirus infection, with IC₅₀ values in the submicromolar range [14]. These findings highlight the potential of HR2-targeting peptides as broad-spectrum coronavirus fusion inhibitors.
The advancement of computational tools has revolutionized the drug discovery process, enabling in silico methods to predict and optimize peptide-protein interactions [17,18]. Molecular docking and dynamics simulations provide insights into peptide candidates’ binding affinities and conformational stability, facilitating the rational design of potent inhibitors [19,20]. Such approaches have been instrumental in identifying HR2-derived peptides with enhanced binding properties and antiviral efficacy. Despite these promising developments, challenges remain in translating HR2-targeting peptides into clinical therapeutics. Peptide stability, bioavailability, and potential immunogenicity necessitate further optimization [21]. Strategies including peptide stapling, incorporating non-natural amino acids, and conjugating with delivery systems are being explored to overcome these limitations and improve the pharmacokinetic profiles of peptide-based antivirals [22,23].
In this study, we aimed to identify and characterize antiviral peptides targeting the HR2 domain of the MERS-CoV spike protein through comprehensive in silico analyses. Utilizing molecular docking and molecular dynamics (MD) simulations, we evaluated the binding interactions and stability of candidate peptides with the HR1 region, seeking to disrupt the critical HR1–HR2 interface essential for viral fusion. Furthermore, we performed a detailed physicochemical characterization of the selected antiviral peptides, including theoretical isoelectric point (pI), extinction coefficients, estimated half-life, instability index, aliphatic index, and grand average of hydropathicity (GRAVY), to assess their drug-like properties. In addition, the haemolytic activity of the peptides was predicted to evaluate their safety profile and potential cytotoxicity. Our objective was to elucidate the structural, energetic, and biophysical parameters governing peptide efficacy, thereby informing the rational design of potent and safe MERS-CoV fusion inhibitors.

2. Results

2.1. Selection and Structural Profiling of Antiviral Peptides (AVPs)

Out of 264 AVPs initially obtained from the APD3, a refined set of 161 peptides with structural identifiers (SwissProt and/or PDB ID) was prioritized for structure-based computational analysis. This selection ensured sufficient structural fidelity for downstream modeling, interaction prediction, and simulation studies. Table 1 presents a representative sample of 10 randomly selected AVPs from the dataset to illustrate the diversity in molecular and structural characteristics across the selection. Peptides range in molecular size from 2.32 to 12.69 kDa, reflecting a broad spectrum of sequence lengths and structural complexities. For example, Griffithsin, the largest peptide in this subset, spans 12.69 kDa and possesses multiple predicted binding residues (e.g., positions 4, 6, 12, 16–18, and 56–58), indicating extensive potential for multivalent interactions. In contrast, smaller peptides like Brevinin-2 and Varv peptide E (2.32 and 2.92 kDa, respectively) have more localized binding sites but may benefit from compact structures that facilitate target accessibility.
The predicted binding site residues vary significantly among peptides. Highly structured peptides such as CCL20 and Human defensin 5 display densely distributed binding hotspots across the sequence, suggesting potential for extensive interface complementarity with protein receptors. Notably, An1a shows concentrated binding regions clustered in the C-terminal half of the peptide (residues 20–30 and 55), indicating a potentially focused interaction motif. Structural confidence, assessed through AlphaFold3 average pLDDT scores, was available for seven of the ten peptides in this subset. The scores ranged from moderate (e.g., 63.00 for Neutrophil cationic peptide 1 type B) to very high (e.g., 90.55 for Varv peptide E), underscoring variation in model reliability. Peptides with high pLDDT values (> 80) generally exhibited well-folded domains suitable for detailed binding energy calculations. Peptides with existing crystal or NMR structures (e.g., Griffithsin, CCL20, Lactoferricin B) were not assigned pLDDT values, as their tertiary structures were experimentally determined.

2.2. Molecular Docking of Antiviral Peptides (AVPs) to the HR2 Target Site

The HR2 domain is a crucial target in disrupting viral entry by interfering with 6-HB formation, a conserved mechanism in class I viral fusion proteins. We employed HADDOCK-based docking, complemented with PRODIGY-derived binding affinity (ΔG) estimations and KD (dissociation constant) predictions. A binding affinity threshold of −10.0 kcal/mol was set to identify promising AVP candidates, using Peptide-6 (ΔG = −7.0 kcal/mol) as a standard inhibitor. Peptide-6, shown in red, exhibits a relatively peripheral binding mode along the surface of the HR2 domain (cyan) (Figure 1A). While it aligns along a shallow groove, the interaction appears more surface-level and linear, suggesting moderate blocking potential. This configuration may limit its ability to effectively interfere with the structural rearrangements required for viral membrane fusion. The docking results, summarized in Table 2, revealed that all selected AVPs surpassed the binding affinity threshold of −10.0 kcal/mol, suggesting a strong and energetically favorable interaction landscape with the HR2 domain. This consistent binding efficacy across diverse AVP structures reinforces the conserved nature of the HR2 pocket and its potential as a viable therapeutic target in disrupting viral fusion mechanisms. Among the tested AVPs, An1a recorded the highest binding affinity (ΔG = −11.5 kcal/mol) and a substantial HADDOCK score of −69.0 a.u., with a cluster size of 19 and a root mean square deviation (RMSD) of 1.6 Å. These parameters indicate a highly stable and reproducible docking conformation. An1a, visualized in magenta (Figure 1B), adopts a deep-penetrating binding pose, anchoring itself well into the hydrophobic cleft of HR2. This orientation suggests stronger steric hindrance against the 6-HB formation, a critical step in class I viral fusion. The peptide’s extended surface contact implies high-affinity binding and potentially broad-spectrum inhibitory activity, especially given its excellent docking parameters. Melittin, a well-studied membrane-active peptide, was closely followed with a binding affinity of −11.2 kcal/mol, a HADDOCK score of −65.7 a.u., and an RMSD of 1.9 Å. Despite its known cytolytic activity, the docking results suggest Melittin's amphipathic helical structure aligns effectively within the HR2 interface, facilitating energetically stable binding.
Meanwhile, CCL20, an endogenous chemokine with known antimicrobial activity, achieved a ΔG of −10.9 kcal/mol and a HADDOCK score of −77.7. The structural model (Figure 1C) reveals that CCL20 interacts compactly with the HR2 region, utilizing a broad surface area to form multiple stabilizing contacts, as evidenced by its low RMSD of 1.4 Å. Similarly, Labyrinthopeptin A2, a lantibiotic with complex ring topology, exhibited a notable HADDOCK score of −80.3 a.u. and ΔG of −10.9 kcal/mol, supported by an RMSD of 1.1 Å, suggesting a tightly packed and highly stable interaction. Griffithsin, a mannose-binding lectin with broad-spectrum antiviral properties, demonstrated the most favorable HADDOCK score at −84.4 a.u., indicative of an exceptionally stable complex with HR2. Despite a slightly lower binding affinity (−10.7 kcal/mol), its large cluster size (n = 16) and a low RMSD of 1.7 Å indicate that the docking simulation converged consistently to a well-defined binding pose (Figure 1D). The peptide spans a large area of the HR2 interface, likely stabilizing the complex via multiple hydrogen bonds and polar contacts. Its spatial occupation of shallow and moderately recessed grooves reinforces its antiviral potential, albeit limited by pharmacokinetic liabilities like a shorter half-life.
Human Defensin 5 (HD5) binds to a shallow pocket on the HR2 surface. Although it retains a respectable binding energy (ΔG = −10.4 kcal/mol), its smaller interaction surface area and cluster size suggest less conformational adaptability (Figure 1E). As a result, HD5 may offer only partial blockade of HR2 activity, potentially functioning more effectively in synergy with other peptides or inhibitors. Brevinin-2, although presenting a modest binding affinity of −10.2 kcal/mol compared to the top candidates, struck an optimal balance among docking parameters: a solid HADDOCK score (−70.8 a.u.), favorable RMSD (1.5 Å), and a compact binding orientation as shown in Figure 1F. The docking visualization reveals that Brevinin-2 accesses the deeper region of the HR2 binding pocket, allowing for extensive hydrophobic and hydrogen bonding interactions, thereby ensuring strong anchoring and potential to block HR2-mediated viral fusion events. In contrast, while Griffithsin and Labyrinthopeptin A2 demonstrate superior docking energetics, their structural complexity and potentially lower stability in vivo might pose formulation challenges. Therefore, although binding affinity and HADDOCK scores are critical for identifying potent inhibitors, complementary parameters such as structural convergence (RMSD), reproducibility (cluster size), and predicted pharmacokinetics are essential for prioritizing AVPs for further experimental validation. The complete molecular docking results can be seen in Supplementary Data S2.
The atomic contact analysis between AVPs and the HR2 domain of the MERS-CoV spike protein revealed intricate interaction patterns across a variety of physicochemical contact types. These interactions, broken down into charged–charged, charged–polar, charged–apolar, polar–polar, polar–apolar, and apolar–apolar atomic contacts, provide deeper insights into the binding mechanisms underlying peptide-HR2 complex stability. The number of each contact type, along with the non-interacting surface (NIS) area categorized by charge polarity, gives a comprehensive structural profile of each AVP–HR2 interaction interface (Table 3). High-affinity peptides such as An1a, Melittin, and Griffithsin exhibited extensive interactions across polar and apolar categories. Notably, An1a and Melittin formed a large number of charged–apolar (17 and 12, respectively) and polar–apolar (20 and 24, respectively) contacts, which are critical for stabilizing peptide orientation in the amphipathic groove of the HR2 domain. This abundance of mixed hydrophilic and hydrophobic contacts may contribute to their exceptional binding energies reported in earlier docking analyses. Griffithsin, the peptide with the strongest HADDOCK score, displayed the highest number of charged–polar (11) and charged–apolar (25) contacts, along with substantial apolar–apolar contacts (23), supporting its robust and multi-faceted binding interface.
Peptides such as Labyrinthopeptin A2 and CCL20 also exhibited diverse contact profiles. Labyrinthopeptin A2 showed a relatively balanced spread of interactions, with significant numbers of polar–polar (8) and charged–polar (9) contacts, indicating that hydrogen bonding and electrostatic complementarity play a strong role in its binding stability. Its NIS values (16.39% charged, 44.59% apolar) were in line with a relatively well-encapsulated interface, suggesting efficient utilization of binding surface area. Similarly, CCL20 exhibited a high number of charged–apolar (19) and apolar–apolar (20) contacts, suggesting deep embedding into the hydrophobic core of HR2, complemented by a charged NIS of 17.48%, the highest among top binders, possibly contributing to its notable interface complementarity. Interestingly, Brevinin-2, despite a slightly lower binding affinity (−10.2 kcal/mol), exhibited a remarkably high number of apolar–apolar contacts (31) (the highest among all peptides), highlighting strong van der Waals interactions that may contribute to its favorable structural stability and pharmacokinetics. It had one of the lowest polar contact counts, underscoring its reliance on hydrophobic packing rather than polar or ionic interactions. On the other hand, Peptide-6, the standard inhibitor, demonstrated limited interaction versatility, with only 2 charged–charged and 3 charged–apolar contacts. Its relatively low binding affinity (−7.0 kcal/mol) and modest NIS values (16.13% charged, 44.84% apolar) indicate weaker and less specific interactions, aligning with its lower performance in docking simulations. Several other peptides, such as Tricyclic peptide RP 71955 and Myticin C, also showed strong hydrophobic contributions, with high apolar–apolar contact numbers (26 and 17, respectively) and relatively large polar–apolar interfaces. These features are consistent with stable docking conformations in their cluster RMSDs and suggest favorable entropic contributions during binding. The complete molecular interactions are provided in Supplementary Data S3.
Figure 2A presents a scatter plot of the HADDOCK scores (in arbitrary units) plotted against the RMSD (Å) for each docking pose. The HADDOCK score represents a weighted sum of several energy terms, including van der Waals, electrostatic, desolvation, and restraint energies. In general, lower HADDOCK scores denote more favorable and stable docking interactions. A visual inspection of the plot shows a dense clustering of data points in the RMSD range between 1.2 and 1.8 Å, which indicates that the docked complexes share a common binding orientation or convergence pattern around a preferred pose. Moreover, this distribution suggests that many peptide candidates are capable of binding HR2 with consistent and reproducible geometries. The HADDOCK scores range from around −20 to as low as −100, with the most favorable (lowest) scores associated with RMSD values closer to 1.2 Å. This supports the reliability of the docking results, implying that multiple docking simulations yielded similar conformations, reinforcing the structural stability of the peptide-HR2 complexes. Overall, this panel highlights that favorable binding interactions are not outliers but a repeated trend across several peptides. Figure 2B further investigates the energetic landscape by plotting HADDOCK scores against the predicted binding affinity (ΔG, kcal/mol) for each complex. As expected, a general inverse relationship is observed: more negative HADDOCK scores (indicating favorable binding) are associated with more negative ΔG values, signifying stronger predicted binding affinities. This correlation validates the HADDOCK scoring function as being qualitatively consistent with thermodynamic predictions. However, the relationship is not strictly linear, and some dispersion is noticeable. This deviation may stem from differences in individual energy contributions, such as electrostatic versus van der Waals interactions, or desolvation effects that may influence ΔG differently than HADDOCK scoring weights. Importantly, a significant number of complexes cluster around a ΔG of −10 to −11 kcal/mol, coupled with HADDOCK scores between −60 and −100, indicating highly favorable interactions and robust complex formation potential.
Figure 2C provides a ranked bar chart summarizing the binding affinities (ΔG, kcal/mol) of 20 AVPs docked with HR2. This visualization identifies the top-performing peptide candidates. HR2_Ana-1 exhibits the most favorable binding affinity at −11.5 kcal/mol, followed closely by HR2_Melittin (−11.2 kcal/mol) and HR2_CCL20 (−11.0 kcal/mol). These values suggest strong molecular interactions, likely due to complementary shape, electrostatics, and hydrophobic interactions at the binding interface. Other peptides such as HR2_Labyrinthopeptin A2, HR2_Lactoferricin B, and HR2_Griffithsin also demonstrate potent binding with ΔG values ranging from −10.5 to −10.8 kcal/mol, suggesting their potential as therapeutic leads. This strong performance likely results from the amphipathic and cationic nature of AVPs, which allows them to interact with protein targets efficiently. Figure 2D displays a correlation matrix (numerical values and ellipses) for the various energetic contributions influencing binding affinity. The binding affinity (ΔG) shows a positive correlation with van der Waals energy (r = 0.52) and desolvation energy (r = 0.29), indicating these components are primary drivers of strong binding in the AVP–HR2 complexes. Notably, electrostatic energy has almost no correlation with ΔG (r = −0.072), suggesting that polar interactions or charged residues are less influential in this specific interaction model than hydrophobic or packing forces. The negative correlation between restraint violation energy and ΔG (r = −0.29) implies that binding affinity improves when fewer violations in docking restraints occur, supporting the validity of the top-ranked models. This analysis suggests that hydrophobic interactions and optimal structural accommodation (i.e., low RMSD and low restraint violations) are the most crucial determinants for effective AVP binding to HR2.
Based on the provided molecular docking and interaction analysis results, a detailed examination of hydrogen bonding interactions between AVPs and the HR2 domain reveals a consistent binding pattern with the standard inhibitor, Peptide-6 (Table 4). This observation is especially evident at key residues Glu1265 and Ser1268, which play crucial roles in stabilizing peptide interactions at the HR2 binding site. Peptide-6, used as a reference standard due to its established inhibitory role, forms multiple hydrogen bonds with HR2 residues, including Glu1265 and Ser1268. Specifically, Glu1265 forms a hydrogen bond with Ser18 (OG) at a distance of 2.87 Å, while Ser1268 interacts with Lys24 (NZ) at a distance of 2.79 Å. These interactions are critical for anchoring the inhibitor within the HR2 pocket and enhancing binding affinity, which is reflected by its favorable HADDOCK score and binding energy profile. Several AVPs replicate these key hydrogen bonding patterns, indicating similar binding behavior and potential inhibitory function. The AVP Ana-1a exhibits two hydrogen bond interactions involving Glu1265: one with Phe26 (N, 3.11 Å) and another with Gly27 (N, 2.67 Å). Additionally, Ana-1a forms a hydrogen bond with Ser1268 via His38 (NE2, 2.99 Å). These interactions closely mirror those of Peptide-6, suggesting that Ana-1a may effectively mimic the binding mode of the standard inhibitor. Griffithsin, another potent AVP, also engages HR2 residue Glu1265 through a hydrogen bond with Gln102 (NE2, 2.68 Å), while Ser1268 forms a hydrogen bond with Arg5 (N, 2.90 Å). These interactions further underscore the AVP’s ability to engage critical HR2 residues, reinforcing the hypothesis of similar binding mechanisms. Griffithsin also shows additional interactions with other HR2 residues, such as Tyr1264 and Leu1260, enhancing its binding stability. Brevinin-2, likewise, forms hydrogen bonds with both Glu1265 and Ser1268. Specifically, Glu1265 (SD) interacts with Lys28 (NZ, 3.12 Å), while Ser1268 is involved in two separate hydrogen bonds with Ser5 (OG, 2.70 Å) and Leu2 (N, 3.17 Å). Although the distances vary slightly, preserving hydrogen bonding at these crucial residues highlights Brevinin-2's potential for HR2 targeting.

2.3. Structural Dynamics and MM/PBSA-Based Evaluation of Antiviral Peptide (AVP)–HR2 Complexes

To understand the biophysical basis underlying the inhibitory activity of selected AVPs against the HR2 domain of the MERS-CoV spike protein, MD simulations were conducted for each AVP–HR2 complex. These simulations were benchmarked against Peptide-6, a known HR2-targeting standard inhibitor, to assess conformational stability, residue-level flexibility, and interaction strength. The root mean square fluctuation (RMSF) profiles (Figure 3A) revealed the time-averaged positional fluctuations of individual residues within the HR2 domain in both apo and peptide-bound states. Across most of the HR2 backbone, the complexes demonstrated a conserved pattern of low fluctuation, indicating overall structural rigidity. However, a notable increase in residue flexibility was consistently observed in the Ile1255–Gln1271 region, an essential region involved in the fusion process that undergoes conformational rearrangement during the pre-fusion to post-fusion transition. This elevated fluctuation peak is particularly informative, as it reflects dynamic motions that could either facilitate or inhibit conformational changes depending on the nature of peptide binding. In the case of Peptide-6, this region exhibited moderate but localized flexibility, consistent with partial stabilization that interferes with the necessary conformational dynamics for membrane fusion. Such behavior is characteristic of effective HR2 antagonists, which bind in a manner that disrupts critical intramolecular interactions (hydrogen bonds), thereby locking HR2 in a non-functional state. Interestingly, Griffithsin (blue), Brevinin-2 (green), and CCL20 (purple) demonstrated RMSF profiles that closely mirrored that of Peptide-6 (red) in the Ile1255–Gln1271 region. This congruence in fluctuation amplitude and position suggests that these peptides likely engage the HR2 helix with similar binding mechanics, potentially destabilizing the local hydrogen-bond network essential for the heptad repeat’s structural rearrangement. Such disruption likely hinders the 6-HB formation required for fusion, reinforcing their proposed antagonist-like mode of action.
The MM/PBSA-based per-residue binding free energy decomposition (Figure 3B) provides insights into the key HR2 residues contributing to AVP affinity. Critical residues such as Glu1265 and Ser1268 exhibited highly favorable ΔG binding contributions across all top-performing AVPs and Peptide-6. Particularly, Glu1265, previously identified as part of the fusion antagonist hotspot, showed consistently substantial binding contributions across Peptide-6, Griffithsin, Brevinin-2, and CCL20. This suggests that these AVPs occupy the same antagonist binding pocket and interact with HR2 in a mechanistically conserved manner. Similarly, Ser1268 displayed comparable energy profiles, reinforcing the notion of convergent binding behavior among these peptides. Interestingly, while the peptides varied in their amino acid sequences and origins (Griffithsin, Brevinin-2, and CCL20), they converged on similar biophysical interaction patterns with HR2. This is evident from the overlapping energy and the alignment of their high-binding residues with those of Peptide-6. The antagonistic region highlighted in red (residues Glu1265 and Ser1268) underscores the shared inhibitory mechanism via blockade of the 6-HB formation critical for viral fusion.
The average RMSD values across the simulated AVP–HR2 complexes ranged from 2.244 Å to 2.572 Å, offering a measure of structural deviation from the initial complex geometry (Table 5). Lower RMSD values suggest greater conformational stability over the 100 ns simulation. Among the peptides, Griffithsin (2.301 Å), Human Defensin 5 (2.244 Å), and Brevinin-2 (2.322 Å) displayed the lowest RMSD values, indicating exceptional dynamic stability and minimal deviation during the simulation. In contrast, the standard inhibitor Peptide-6 (2.572 Å) showed the highest RMSD, suggesting that several natural AVPs may maintain the HR2 complex with greater structural fidelity than the control peptide. The RoG values, reflecting the compactness of the HR2–peptide complexes, were found within a narrow range, from 2.161 Å (Griffithsin) to 2.298 Å (Piscidin 2 and Myticin C). A lower RoG indicates a tighter and more compact complex, which typically correlates with enhanced binding efficiency and reduced solvent exposure. Griffithsin, once again, showed the most compact structure (2.161 Å), followed closely by Brevinin-2 (2.168 Å), CCL20 (2.171 Å), and hBD-1 (2.170 Å). These values highlight that these AVPs not only bind stably but also maintain HR2 in a highly compact conformation, a desirable feature for fusion inhibition. On the other hand, HR2 complexes with Piscidin 2 and Myticin C had the highest RoG values (2.298 Å), potentially suggesting less favorable folding or slightly looser binding interactions. Hydrogen bonding is a primary driver of intermolecular stability in peptide–protein interactions. Griffithsin again topped the list with 43 hydrogen bonds, closely followed by Brevinin-2 (42), CCL20 (40), hBD-1 (41), and Labyrinthopeptin A2 (39). These peptides formed dense and stable hydrogen-bonding networks, significantly exceeding that of Peptide-6, which only formed 24 hydrogen bonds. Such high hydrogen bond counts indicate robust and sustained binding, enhancing inhibitory potential by anchoring the peptide in the HR2 binding pocket throughout the simulation. Several other AVPs also demonstrated strong hydrogen bonding profiles. For instance, Melittin (37), Human Defensin 5 (36), An1a (35), and Latarcin 1 (34) all showed elevated hydrogen bond numbers, indicating promising stability profiles. Conversely, Piscidin 2 (24) and Peptide-6 (24) had the lowest hydrogen bond counts, potentially reflecting less stable interactions and a more transient binding interface, which may limit their inhibitory effectiveness.
The binding free energy (ΔG_binding) obtained from MM/PBSA calculations provides quantitative insight into the binding affinity of AVPs toward the HR2 domain of the MERS-CoV spike protein (Table 6). Lower (more negative) ΔG_binding values indicate stronger and more thermodynamically favorable interactions, and are used as a benchmark to identify potent inhibitors. In this study, Peptide-6, a known HR2 inhibitor, served as the standard reference with a ΔG_binding of −49.73 ± 4.08 kcal/mol. This baseline provides a comparative context to assess the relative binding strengths of other candidate AVPs. Among the tested peptides, several demonstrated significantly stronger binding affinities than Peptide-6. Griffithsin notably exhibited the most favorable binding energy at −213.69 ± 4.73 kcal/mol, suggesting a highly stable complex formation with the HR2 domain. This is particularly interesting given Griffithsin’s known antiviral properties, and the strong binding energy implies a potential to lock HR2 into a non-fusogenic conformation, thereby acting as an effective fusion inhibitor. Similarly, Brevinin-2 (−168.83 ± 2.66 kcal/mol), human β-defensin-1 (hBD-1, −166.63 ± 4.15 kcal/mol), CCL20 (−165.17 ± 2.91 kcal/mol), and Labyrinthopeptin A2 (−165.13 ± 1.87 kcal/mol) formed a top-tier group of high-affinity binders, all outperforming Peptide-6 by a wide margin. Their strong interaction energies suggest robust molecular engagement with the HR2 domain, which could effectively inhibit membrane fusion events essential for viral entry. Interestingly, Shepherin II (−106.17 ± 2.59 kcal/mol) and Varv peptide E (−98.99 ± 4.92 kcal/mol) exhibited comparatively weaker binding among the AVP cohort, although still significantly stronger than Peptide-6. Their moderate ΔG_binding values suggest that while they may contribute to partial inhibition of HR2, their utility as standalone inhibitors might be limited or require further sequence optimization or chemical modifications to enhance efficacy.

2.4. Predicted Hemolytic Activity Profiles of Antiviral Peptides (AVPs)

The hemolytic potential of AVPs is a critical safety parameter when evaluating their candidacy as therapeutic agents. Hemolysis, or the rupture of red blood cells, can lead to toxic side effects and limit the clinical applicability of peptide-based therapeutics [24]. Table 7 presents the predicted hemolytic activity profiles for a panel of AVPs targeting the MERS-CoV HR2 domain. These predictions are based on hybrid scoring derived from machine learning (ML) classifiers and motif enrichment (MERCI) scores. The hybrid score integrates statistical and pattern-based features to generate a single probability metric, where a value approaching 1.0 indicates a high risk of hemolytic activity. In contrast, values near 0.0 suggest non-hemolytic behavior. Among the 20 peptides evaluated, 19 were predicted to be non-hemolytic, including the standard inhibitor Peptide-6, which had a hybrid score of 0.0, indicating a very low likelihood of inducing hemolysis. This is consistent with its previous safe usage as a model fusion inhibitor. Most peptides, including Griffithsin, An1a, Melittin, Lactoferricin B, and Labyrinthopeptin A2, also showed hybrid scores of 0.0, despite some of them (like Melittin) having known cytolytic effects in other contexts. This suggests that their sequence-specific interactions with erythrocyte membranes may be minimal under physiological conditions or in the computational context assessed here. The only peptide flagged as hemolytic was Varv peptide E, which had a hybrid score of 0.742. This value indicates a high likelihood of inducing hemolysis and aligns with its sequence characteristics, which likely include amphipathic and highly cationic domains typical of membrane-lytic peptides. Despite showing moderate binding affinity in molecular docking and MM/PBSA evaluations, its predicted toxicity poses a significant limitation. Further engineering, such as alanine scanning or residue substitution, may be necessary to mitigate its hemolytic potential while preserving antiviral efficacy.

2.5. Predicted Physicochemical Properties of Antiviral Peptides (AVPs)

Table 8 summarizes key parameters such as theoretical isoelectric point (pI), extinction coefficients, estimated in vitro half-lives, instability indices, aliphatic indices, and GRAVY (grand average of hydropathicity) scores, each contributing to a holistic evaluation of peptide performance. The instability index is a widely used predictor of peptide degradation propensity, where values below 40 suggest stable peptides. Based on this metric, Peptide-6, CCL20, Human defensin 5, Brevinin-2, and Latarcin 1 exhibit strong stability, supporting their viability for therapeutic application. Conversely, peptides like Lactoferricin B (77.92), Human neutrophil peptide-1 (55.71), and Labyrinthopeptin A2 (59.12) have high instability scores, suggesting a greater likelihood of rapid degradation unless stabilized via formulation or chemical modification. Estimated half-lives also vary, with many peptides, such as An1a, Melittin, Myticin C, and Brevinin-2, demonstrating relatively long half-lives (up to 30 hours), indicating promising pharmacokinetic profiles. In contrast, peptides like Lactoferricin B and Human defensin hBD-1 have shorter half-lives around 1–1.2 hours, which may necessitate sustained-release delivery systems for therapeutic use. The GRAVY score reflects the hydropathicity of a peptide, where negative values imply hydrophilicity and likely solubility in aqueous environments—an essential trait for systemic delivery. Peptides like Peptide-6 (−0.083), Griffithsin (−0.240), and CCL20 (−0.106) fall in this range, indicating a balance between water solubility and potential membrane interaction. On the other hand, Shepherin II (−1.224) and Latarcin 1 (−1.248) show highly negative GRAVY scores, suggesting extreme hydrophilicity that could limit membrane permeability or require formulation aids for intracellular access. Meanwhile, highly positive GRAVY values, such as for Tricyclic peptide RP 71955 (1.157), imply hydrophobicity, which can enhance membrane penetration but also raise concerns regarding aggregation or non-specific toxicity.
The aliphatic index estimates a peptide’s thermostability, with higher values generally correlating with improved stability under physiological conditions. Melittin (135.00) and Peptide-6 (127.22) demonstrate high aliphatic indices, indicating their strong thermal resilience and potential for bioactivity across varying conditions. In contrast, Shepherin II (0.00), with no aliphatic side chains, may be more structurally vulnerable in fluctuating environments unless stabilized by cyclization or secondary structure constraints. The theoretical pI values suggest the pH at which the peptide carries no net charge. This affects solubility and interaction with cell membranes or target proteins. Most peptides range from mildly acidic to fundamental pI values. For example, Melittin (pI 12.02) and Lactoferricin B (11.84) are strongly cationic, favoring electrostatic interaction with negatively charged viral membranes or receptors. Conversely, Tricyclic peptide RP 71955 (pI 3.80) and Labyrinthopeptin A2 (4.35) are more acidic, which might influence their biodistribution and target selectivity.

3. Discussion

Griffithsin, Brevinin-2, and CCL20 have emerged as leading AVP candidates targeting the HR2 domain of the MERS-CoV spike protein. Their potential efficacy has been comprehensively evaluated through an integrated approach involving peptide-protein docking, MD simulations, hemolytic activity predictions, and detailed assessments of physicochemical properties. These multi-faceted analyses provide critical insights into their prospective use as therapeutic agents, particularly when compared to the benchmark standard inhibitor, Peptide-6. The promising antiviral activities of Griffithsin, Brevinin-2, and CCL20 targeting the MERS-CoV HR2 domain are strongly supported by a growing body of literature emphasizing the therapeutic potential of HR2-derived peptides and other fusion inhibitors. Prior studies on HR2P peptides and their engineered analogs have consistently demonstrated their ability to disrupt the 6-HB formation during the membrane fusion process of coronaviruses [25,26]. This 6-HB structure, formed by the interaction of HR1 and HR2 domains within the viral spike protein, is indispensable for bringing the viral and host membranes into proximity, facilitating viral entry [27,28]. By competitively binding to HR1 or HR2 regions, these peptides effectively prevent the conformational rearrangements necessary for 6-HB assembly, thereby blocking viral fusion and subsequent infection.
Specifically, HR2P peptides have been experimentally validated to inhibit MERS-CoV fusion in vitro, showing dose-dependent reductions in viral entry and replication. These peptides also exhibit synergistic effects when combined with other antiviral agents, suggesting potential for combination therapies [29]. Griffithsin, a lectin-derived antiviral peptide isolated from red algae, has garnered significant attention for its broad-spectrum antiviral properties, including potent activity against diverse coronaviruses such as SARS-CoV and MERS-CoV. Its mechanism primarily involves high-affinity binding to high-mannose glycans on viral envelope glycoproteins, thereby blocking viral attachment and fusion processes [30,31,32]. Beyond direct viral neutralization, Griffithsin also modulates host immune responses, enhancing antiviral defense pathways without eliciting significant cytotoxicity [33]. Similarly, Brevinin-2, originally isolated from amphibian skin secretions, exhibits a broad range of antimicrobial activities, including antiviral effects. Studies suggest that Brevinin-2 disrupts viral envelope integrity and interferes with protein-protein interactions critical for viral entry [34]. Its amphipathic and cationic nature facilitates membrane binding and destabilization, enhancing its inhibitory potential against enveloped viruses [35]. CCL20, a chemokine with inherent antimicrobial and immunomodulatory functions, has also been implicated in antiviral defense. It can recruit immune cells to infection sites and directly inhibit viral replication through mechanisms that may include interference with viral-host membrane fusion [36,37]. The alignment of our computational findings with these experimental insights strengthens the validity of Griffithsin, Brevinin-2, and CCL20 as effective MERS-CoV fusion inhibitors. The convergence of peptide-protein binding data, stability assessments, and safety predictions with well-established literature highlights their translational potential. Moreover, these peptides’ distinct but complementary modes of action provide opportunities for designing multi-targeted antiviral strategies, potentially overcoming viral resistance mechanisms.

4. Limitations, Clinical Implications, and Future Works

While the current computational study provides valuable insights into the potential efficacy of Griffithsin, Brevinin-2, and CCL20 as antiviral peptides targeting the MERS-CoV HR2 domain, several limitations must be acknowledged. First, the findings are primarily based on in silico approaches, including molecular docking, MD simulations, and binding free energy calculations. Although these techniques are powerful for predicting molecular interactions and stability, they cannot fully replicate the complexity of biological systems, such as cellular uptake, peptide degradation, immune system interactions, or pharmacokinetics. Secondly, the predicted half-lives and hemolytic activity scores are estimations based on physicochemical properties and computational models. Experimental validation through in vitro and in vivo assays is essential to confirm these safety profiles and stability metrics. Additionally, the peptides’ antiviral activity against MERS-CoV must be corroborated by cell culture infection models and ultimately in animal studies to assess efficacy and toxicity comprehensively. Lastly, the potential for immunogenicity and peptide-induced off-target effects remains unknown. As peptides can trigger immune responses or interact with unintended molecular targets, detailed immunotoxicological studies will be necessary before clinical translation.
Despite these limitations, identifying Griffithsin, Brevinin-2, and CCL20 as strong binders to the HR2 domain with favorable safety and stability profiles highlights their potential as novel therapeutic agents against MERS-CoV. These peptides could be developed as fusion inhibitors, representing a strategic approach to block viral entry at an early stage, reducing viral load and transmission risk. Moreover, Griffithsin's broad-spectrum antiviral activity suggests potential applicability beyond MERS-CoV, including other coronaviruses and enveloped viruses, making it a valuable candidate for pandemic preparedness. The relatively favorable physicochemical and safety profiles of Brevinin-2 and CCL20 further support their possible use in combination therapies, which may mitigate the emergence of resistant viral strains. From a formulation perspective, the peptides’ stability and solubility parameters suggest potential for development as injectable or inhalable therapeutics, targeting respiratory tract infections directly. However, appropriate delivery systems, dosage regimens, and pharmacodynamics require further optimization.
Future research should prioritize experimental validation of Griffithsin, Brevinin-2, and CCL20 through in vitro antiviral assays and in vivo efficacy and safety studies to confirm their therapeutic potential. Investigations into their pharmacokinetic and pharmacodynamic profiles will be essential to optimize dosing strategies. Additionally, efforts to enhance peptide stability and bioavailability via structural modifications and the development of targeted delivery systems will be critical for clinical translation. Exploring combination therapies with other antivirals could further improve efficacy and reduce resistance risk. Collectively, these steps will advance these promising peptides from computational candidates to effective antiviral agents against MERS-CoV and related viruses.

5. Materials and Methods

5.1. Selection and Preparation of Antiviral Peptides (AVPs)

To assemble a dataset of biologically relevant AVPs targeting the HR2 domain of the MERS-CoV spike protein, we utilized the Antimicrobial Peptide Database (APD3) [38], a widely recognized repository of antimicrobial and antiviral peptides curated by the University of Nebraska Medical Center, Omaha, Nebraska, USA (last updated in January 2025). The data extracted included the APD ID, peptide name, amino acid sequence, and corresponding SwissProt and PDB IDs (where available). Peptides with experimentally determined structures (PDB ID) were downloaded and assessed for structural completeness. Where residues were missing, the peptide structures were refined using MODELLER v10.3 [39]. For peptides with only SwissProt entries and no known 3D structures, predictions were generated using AlphaFold3 [40] , and the average predicted Local Distance Difference Test (pLDDT) score was recorded to assess confidence in the models. Peptides lacking both a PDB and SwissProt ID were excluded from further analysis due to insufficient structural data. The molecular size of each AVP (in kilodaltons, kDa) was calculated using the Protein Molecular Weight Calculator provided by the Science Gateway portal [41], based on the primary amino acid sequence. Additionally, binding site predictions were performed using Computed Atlas of Surface Topography of the universe of protein Folds (CASTpFold), a structure-based tool that identifies surface pockets and functional residues, to determine the number of potential peptide–target binding residues [42].
As a reference for comparative docking and dynamic simulation analyses, Peptide-6 (sequence: SLTQINWTLLDLTYEMESLQQVVKALNEYYIDLKHL) was employed as a standard HR2 inhibitor, based on previously validated in vitro findings. In a prior study, eight HR2-derived peptides exhibited strong inhibition of spike-mediated MERS-CoV cell–cell fusion, with IC₅₀ values ranging from 0.25 to 2.3 µM. Peptides 4–6 demonstrated particularly high efficacy, inhibiting 95–98.3% of MERS-CoV plaque formation. Specifically, Peptide-4 achieved an EC₅₀ of 0.302 µM, confirming its potent antiviral activity. Importantly, none of the peptides exhibited cytotoxic effects at concentrations up to 10 µM, indicating a favorable safety profile [43]. These findings support the therapeutic potential of HR2-derived peptides and validate Peptide-6 as a positive control in the context of this study. A compiled dataset containing peptide names, APD IDs, SwissProt or PDB IDs, molecular sizes, AlphaFold pLDDT scores (when applicable), amino acid sequences, and CASTpFold-predicted binding residues is provided in Supplementary Data S1.

5.2. Peptide-Protein Docking Simulation

Peptide-protein docking simulations were carried out to elucidate the molecular interactions between selected AVPs and the HR2 domain of the MERS-CoV spike protein. The primary objective of this analysis was to characterize the binding mechanisms of AVPs, including identification of key interacting residues, the nature of intermolecular forces, binding orientations, and overall binding affinities within the AVP–HR2 complexes. Prior to docking, the structural features and potential binding sites of the HR2 domain were analyzed using PDBsum [44], a specialized tool for generating comprehensive structural annotations and interaction summaries of protein complexes. This step allowed for a detailed mapping of the functional residues and spatial configuration of the HR2 domain involved in peptide recognition and binding (residue numbers: 1031, 1034, 1035, 1037, 1038, 1255, 1259, 1261, 1263, 1264, 1267, 1271). To ensure high-quality input for docking simulations, the HR2 receptor structure was energy-minimized and refined using Swiss-PdbViewer v4.1.1 [45], which helped correct minor structural inconsistencies and optimize side-chain conformations. Following structural refinement, docking simulations were performed using the standalone version of HADDOCK v2.4 (High Ambiguity Driven Protein–Protein Docking), utilizing its advanced interface settings. HADDOCK is a highly regarded docking platform that integrates experimental or predicted interaction restraints to guide the docking process and simulate realistic protein–peptide binding scenarios [46,47].
Each docking simulation generated a range of possible complex conformations, which were then evaluated based on two main criteria: the number of conformations per cluster (indicative of structural convergence and reliability), and the HADDOCK score, a weighted sum of energy terms that reflects the overall binding strength between peptide and protein. The top-ranking docked complexes were selected for further analysis based on these parameters. To complement the docking evaluation, binding free energy predictions were conducted using PROtein binDIng enerGY prediction (PRODIGY) [48], a computational tool designed to estimate the thermodynamic stability (ΔG in kcal/mol) of biomolecular complexes. PRODIGY’s calculations are based on the structural interface features of the docked models, including the number and type of interfacial contacts, desolvation energy, and residue pairing patterns. Together, HADDOCK and PRODIGY provided a comprehensive understanding of the structural and energetic landscape governing AVP–HR2 interactions, enabling the identification of peptides with high binding potential and favorable interaction profiles.

5.3. Molecular Dynamics (MD) Simulation

MD simulations were performed to explore the dynamic behavior and structural stability of AVP complexes with the HR2 domain of the MERS-CoV spike protein. These simulations were carried out using GROMACS v2025.1, a widely adopted and highly efficient software suite for simulating the motions of biomolecular systems with atomic-level detail [49]. The OPLS-AA/L force field (Optimized Potentials for Liquid Simulations – All Atom/Long-range) [50] was employed to accurately model atomic interactions and force parameters within the peptide–protein complexes. A cubic simulation box was created with adequate spacing around the complex to avoid edge effects and periodic boundary interactions. The system was solvated with SPCE (Single Point Charge Extended) [51] water molecules to emulate a realistic aqueous environment. To neutralize the overall system charge, counterions were added as required. Prior to running the production simulations, the system underwent energy minimization using the steepest descent algorithm, which alleviated steric clashes and brought the system to a local energy minimum. Following minimization, a two-step equilibration protocol was executed. First, equilibration under NVT conditions (constant Number of particles, Volume, and Temperature) was performed to stabilize the system's temperature. This was followed by NPT equilibration (constant Number of particles, Pressure, and Temperature) to ensure system stability under physiological pressure and temperature conditions.
Upon completion of equilibration, 100-nanosecond production MD simulations were conducted to monitor the temporal evolution of each AVP–HR2 complex. Throughout the simulation period, various structural and energetic parameters were tracked to assess the integrity and performance of the complexes. These included RMSD to evaluate conformational stability, RMSF to measure residue-level flexibility, RoG to gauge compactness, potential energy profiles, and the number of intermolecular hydrogen bonds, which are critical for peptide–protein interactions. Post-simulation analyses were performed to visualize and interpret binding interactions and structural transitions. PyMOL v3.1.4 [52] and UCSF ChimeraX v1.9 [53] were employed for high-resolution 3D visualization of the trajectories, enabling detailed inspection of binding residues, conformational changes, and interaction networks within the AVP–HR2 complexes. These visual and quantitative analyses provided comprehensive insights into the mechanistic aspects of antiviral peptide binding, supporting the rational assessment of candidate peptides as potential fusion inhibitors targeting the MERS-CoV HR2 domain.

5.4. Molecular Mechanics/Poisson–Boltzmann Surface Area (MM/PBSA) Calculations

To further elucidate the energetics underlying the interaction between AVPs and the HR2 domain of the MERS-CoV spike protein, Molecular Mechanics/Poisson–Boltzmann Surface Area (MM/PBSA) calculations were conducted. This computational method combines molecular mechanics energy terms with solvation effects to estimate the binding free energy of biomolecular complexes [54]. Following the 100 ns MD simulations, representative conformational snapshots of each peptide–HR2 complex were extracted at regular intervals. These frames were selected to provide a statistically robust sampling of the conformational space occupied by the complex during the simulation. For each snapshot, MM/PBSA calculations were performed to decompose the total binding energy into multiple energetic components, including gas-phase interaction energy, solvation energy based on a continuum dielectric model, and entropic contributions. Calculations were carried out using the gmx_MMPBSA tool [55,56], an integrated script compatible with the GROMACS platform, that facilitates the efficient computation of binding energies across MD-generated ensembles. This tool incorporates standard MM/PBSA workflows and supports precise evaluation of interaction thermodynamics for biomolecular complexes [57]. The binding free energy (ΔG_binding) of each complex was calculated using the following thermodynamic expression:
ΔG_binding = ΔG_complex - ΔG_peptideX - ΔG_proteinY
where:
ΔG_binding: the binding free energy associated with forming the peptide-protein complex.
ΔG_complex: the free energy of the fully solvated peptide-protein complex.
ΔG_peptideX: the free energy of AVP in its solvated state when unbound.
ΔG_proteinY: the free energy of HR2 in its solvated state when unbound.
This approach allowed for the quantification of energetic changes upon peptide binding, offering valuable insights into interaction strength, stability, and the likelihood of effective inhibition of the HR2 fusion interface. The MM/PBSA method was critical in identifying peptides with the most favorable thermodynamic profiles for disrupting MERS-CoV membrane fusion by integrating structural and energetic analyses.

5.5. Haemolytic Activity Prediction of Antiviral Peptides (AVPs)

To assess the potential cytotoxic effects of AVPs, particularly their propensity to induce red blood cell lysis, the hemolytic activity of the selected peptides was evaluated using HemoPI2 [58], an advanced web-based predictive tool. This platform applies machine learning algorithms trained on datasets comprising experimentally validated hemolytic and non-hemolytic peptides to estimate the likelihood of hemolysis based on sequence features. The Hybrid1 classification model within HemoPI2 was employed for this study due to its enhanced predictive performance. This model integrates two complementary techniques: ESM2-t6, a transformer-based protein language model that captures contextual information from peptide sequences, and MERCI (Motif-EmeRging and with Classes-Identification), which identifies motifs typically associated with hemolytic peptides. The hybrid model combines the strengths of both sequence-wide and motif-based analyses. A threshold value of 0.58 was used as the cut-off for classification, in accordance with the model’s validated parameters for balancing sensitivity and specificity. Each AVP sequence, including the standard inhibitor (Peptide-6), was processed through HemoPI2 to obtain three key outputs: the ESM2 score, reflecting contextual sequence confidence; the MERCI score, denoting motif-driven associations; and the hybrid score, a composite index representing the combined predictive power of both methods. The final prediction output, categorized as either hemolytic or non-hemolytic, was determined by whether the hybrid score exceeded the defined threshold. A hybrid score approaching 1.00 indicated a high probability of hemolytic activity, suggesting potential safety concerns, whereas a score nearing 0.00 implied non-hemolytic behavior and improved biocompatibility. The integration of hemolytic activity predictions helped ensure that the selected candidates maintained a desirable balance between antiviral efficacy and minimal host toxicity.

5.6. Physicochemical Characterization of Antiviral Peptides (AVPs)

The physicochemical profiles of the selected AVPs, including the standard inhibitor (Peptide-6), were systematically evaluated using the ProtParam tool (ExPASy Bioinformatics Resource Portal) [59]. This tool computes a range of biochemical and biophysical parameters directly from amino acid sequences, enabling in silico assessment of peptide drug-likeness and stability. For each AVP, we determined the theoretical isoelectric point, extinction coefficient (expressed in M⁻¹ cm⁻¹ at 280 nm), estimated half-life in mammalian reticulocytes (in vitro), instability index, aliphatic index, and GRAVY. The extinction coefficient was calculated based on the number of tyrosine, tryptophan, and cystine residues, which contribute to UV absorbance at 280 nm. The estimated half-life was predicted using the N-end rule, reflecting peptide stability in mammalian cells. The instability index was used to classify peptides as either stable (≤ 40.00) or unstable (> 40.00), indicating their susceptibility to degradation. The aliphatic index, which reflects the relative volume occupied by aliphatic side chains (alanine, valine, isoleucine, and leucine), served as an indicator of thermostability. Meanwhile, GRAVY values were computed by averaging the hydropathy values of all amino acids in the peptide, offering insights into overall hydrophilicity or hydrophobicity. Together, these physicochemical descriptors provide valuable insights into each AVP’s solubility, stability, and potential bioavailability, thereby informing the selection of promising candidates for further structural and functional validation.

6. Conclusions

In conclusion, this study highlights Griffithsin, Brevinin-2, and CCL20 as promising antiviral peptide candidates targeting the HR2 domain of the MERS-CoV spike protein. Through comprehensive computational analyses, including molecular docking, molecular dynamics simulations, binding free energy calculations, and physicochemical property assessments, these peptides demonstrated superior binding affinity, stability, and safety profiles compared to the standard inhibitor Peptide-6. Their ability to disrupt critical HR2 interactions necessary for viral fusion suggests strong potential to inhibit MERS-CoV entry effectively. While these findings provide a solid foundation for therapeutic development, further experimental validation is essential to confirm antiviral efficacy and safety in vitro and in vivo. Additionally, future work should focus on optimizing pharmacokinetic properties, minimizing immunogenicity, and developing effective delivery systems to enhance bioavailability and target specificity. Investigating combination therapies with existing antivirals may also improve clinical outcomes and reduce resistance risk. Overall, this work advances our understanding of peptide-based fusion inhibitors and contributes valuable insights toward the design and development of novel antiviral agents against coronaviruses.

Supplementary Materials

The following supporting information can be downloaded at the website of this paper posted on Preprints.org. Supplementary Data S1: Antiviral Peptides (AVPs) Dataset; Supplementary Data S2: Molecular Docking Results; Supplementary Data S3: Molecular Interactions.

Author Contributions

Conceptualization, N.A.; Data curation, N.A.; Formal analysis, N.A.; Funding acquisition, N.A.; Investigation, N.A.; Methodology, N.A.; Project administration, N.A.; Resources, N.A.; Software, N.A.; Supervision, N.A.; Validation, N.A.; Visualization, N.A.; Writing – original draft, N.A.; Writing – review & editing, N.A. All authors have read and agreed to the published version of the manuscript

Funding

This work was supported and funded by the Deanship of Scientific Research at Imam Mohammad Ibn Saud Islamic University (IMSIU) (grant number IMSIU-DDRSP2501).

Institutional Review Board Statement

Not applicable.

Data Availability Statement

The original contributions presented in this study are included in the article/Supplementary Material. Further inquiries can be directed to the corresponding author(s).

Conflicts of Interest

The authors declare no conflicts of interest.

Abbreviations

The following abbreviations are used in this manuscript:
6-HB Six-helix bundle
APD3 Antimicrobial peptide database 3
CASTpFold Computed atlas of surface topography of the universe of protein folds
DPP4 Dipeptidyl peptidase 4
GRAVY Grand average of hydropathicity
HADDOCK High ambiguity driven protein-protein docking
HD5 Human defensin 5
HR1 Heptad repeat 1
HR2 Heptad repeat 2
ICs Intermolecular contacts
MD Molecular dynamics
MERCI Motif-emerging and with classes-identification
MERS-CoV Middle East respiratory syndrome coronavirus
MM/PBSA Molecular mechanics/Poisson-Boltzmann surface area
ML Machine learning
NIS Non-interacting surface areas
NPT Number of particles, pressure, and temperature
NVT Number of particles, volume, and temperature
OPLS-AA/L Optimized potentials for liquid simulations
pI Isoelectric point
pLDDT Predicted local distance difference test
PME Particle mesh Ewald
PRODIGY PROtein binDIng enerGY prediction
RBD Receptor-binding domain
RMSD Root mean square deviation
RMSF Root mean square fluctuation
RoG Radius of gyration
SPCE Single point charge extended

References

  1. Fehr, A.R., R. Channappanavar, and S. Perlman, Middle East Respiratory Syndrome: Emergence of a Pathogenic Human Coronavirus. Annu Rev Med, 2017. 68: p. 387-399.
  2. Al-Raddadi, R.M. , et al., Burden of Middle East respiratory syndrome coronavirus infection in Saudi Arabia. Journal of Infection and Public Health, 2020. 13(5): p. 692-696.
  3. Wang, Q. , et al., MERS-CoV spike protein: Targets for vaccines and therapeutics. Antiviral Res, 2016. 133: p. 165-77.
  4. Goyal, R. , et al., Comparative highlights on MERS-CoV, SARS-CoV-1, SARS-CoV-2, and NEO-CoV. Excli j, 2022. 21: p. 1245-1272.
  5. Li, Y.H. , et al., Molecular Characteristics, Functions, and Related Pathogenicity of MERS-CoV Proteins. Engineering (Beijing), 2019. 5(5): p. 940-947.
  6. Abdelrahman, Z., M. Li, and X. Wang, Comparative Review of SARS-CoV-2, SARS-CoV, MERS-CoV, and Influenza A Respiratory Viruses. Front Immunol, 2020. 11: p. 552909.
  7. Bassendine, M.F. , et al., COVID-19 and comorbidities: A role for dipeptidyl peptidase 4 (DPP4) in disease severity? Journal of Diabetes, 2020. 12(9): p. 649-658.
  8. Yuan, H.-W. and H.-L. Wen, Research progress on coronavirus S proteins and their receptors. Archives of Virology, 2021. 166(7): p. 1811-1817.
  9. Forni, D. , et al., The heptad repeat region is a major selection target in MERS-CoV and related coronaviruses. Scientific Reports, 2015. 5(1): p. 14480.
  10. Xu, Y. , et al., Crystal structure of severe acute respiratory syndrome coronavirus spike protein fusion core. J Biol Chem, 2004. 279(47): p. 49414-9.
  11. Wang, C. , et al., Discovery of Hydrocarbon-Stapled Short α-Helical Peptides as Promising Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Fusion Inhibitors. Journal of Medicinal Chemistry, 2018. 61(5): p. 2018-2026.
  12. Lu, L. , et al., Structure-based discovery of Middle East respiratory syndrome coronavirus fusion inhibitor. Nat Commun, 2014. 5: p. 3067.
  13. Xia, S. , et al., Middle East respiratory syndrome coronavirus (MERS-CoV) entry inhibitors targeting spike protein. Virus Res, 2014. 194: p. 200-10.
  14. Xia, S. , et al., Potent MERS-CoV Fusion Inhibitory Peptides Identified from HR2 Domain in Spike Protein of Bat Coronavirus HKU4. Viruses, 2019. 11(1).
  15. Du, L. , et al., MERS-CoV spike protein: a key target for antivirals. Expert Opin Ther Targets, 2017. 21(2): p. 131-143.
  16. Safiriyu, A.A. , et al., The fusion peptide of the spike protein S2 domain may be a mimetic analog of β-coronaviruses and serve as a novel virus-host membrane fusion inhibitor. Antiviral Research, 2025. 237: p. 106144.
  17. Alotaiq, N., D. Dermawan, and N.E. Elwali, Leveraging Therapeutic Proteins and Peptides from Lumbricus Earthworms: Targeting SOCS2 E3 Ligase for Cardiovascular Therapy through Molecular Dynamics Simulations. International Journal of Molecular Sciences, 2024. 25(19): p. 10818.
  18. Dermawan, D. and N. Alotaiq, Computational analysis of antimicrobial peptides targeting key receptors in infection-related cardiovascular diseases: molecular docking and dynamics insights. Scientific Reports, 2025. 15(1): p. 8896.
  19. Alotaiq, N. and D. Dermawan Evaluation of Structure Prediction and Molecular Docking Tools for Therapeutic Peptides in Clinical Use and Trials Targeting Coronary Artery Disease. International Journal of Molecular Sciences, 2025. 26. [CrossRef]
  20. Doni Dermawan, F.A. , Nasr Eldin Elwali, Nasser Alotaiq, Therapeutic potential of earthworm-derived proteins: Targeting NEDD4 for cardiovascular disease intervention. Vol. Volume: 15. 2024: Issue: 1. 216-232.
  21. Rosson, E. , et al., Focus on therapeutic peptides and their delivery. International Journal of Pharmaceutics, 2025. 675: p. 125555.
  22. Xiao, W. , et al., Advance in peptide-based drug development: delivery platforms, therapeutics and vaccines. Signal Transduction and Targeted Therapy, 2025. 10(1): p. 74.
  23. Ricardo, M.G. , et al., Multicomponent Peptide Stapling as a Diversity-Driven Tool for the Development of Inhibitors of Protein-Protein Interactions. Angew Chem Int Ed Engl, 2020. 59(13): p. 5235-5241.
  24. Yang, S. and P. Xu, HemoDL: Hemolytic peptides prediction by double ensemble engines from Rich sequence-derived and transformer-enhanced information. Analytical Biochemistry, 2024. 690: p. 115523.
  25. Xia, S. , et al., A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike. Science Advances, 2019. 5: p. eaav4580.
  26. Xia, S. , et al., A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike. Science Advances. 5(4): p. eaav4580.
  27. Santopolo, S., A. Riccio, and M.G. Santoro, The biogenesis of SARS-CoV-2 spike glycoprotein: multiple targets for host-directed antiviral therapy. Biochemical and Biophysical Research Communications, 2021. 538: p. 80-87.
  28. Zhu, Y. , et al., Nanometer resolution in situ structure of SARS-CoV-2 post-fusion spike. 2021.
  29. Channappanavar, R. , et al., Protective Effect of Intranasal Regimens Containing Peptidic Middle East Respiratory Syndrome Coronavirus Fusion Inhibitor Against MERS-CoV Infection. J Infect Dis, 2015. 212(12): p. 1894-903.
  30. Lee, C. , Griffithsin, a Highly Potent Broad-Spectrum Antiviral Lectin from Red Algae: From Discovery to Clinical Application. Mar Drugs, 2019. 17(10).
  31. Bains, A., et al. The Antiviral Activity of the Lectin Griffithsin against SARS-CoV-2 Is Enhanced by the Presence of Structural Proteins. Viruses, 2023. 15. [CrossRef]
  32. Decker, J., R. Menacho Melgar, and M. Lynch, Low-Cost, Large-Scale Production of the Anti-viral Lectin Griffithsin. Frontiers in Bioengineering and Biotechnology, 2020. 8: p. 1020.
  33. Ahan, R.E. , et al., A Highly Potent SARS-CoV-2 Blocking Lectin Protein. ACS Infectious Diseases, 2022. 8(7): p. 1253-1264.
  34. Xiong, W. , et al., Brevinin-2GHk, a Peptide Derived from the Skin of Fejervarya limnocharis, Inhibits Zika Virus Infection by Disrupting Viral Integrity. Viruses, 2021. 13(12).
  35. Loffredo, M.R. , et al., Antimicrobial peptides for novel antiviral strategies in the current post-COVID-19 pandemic. J Pept Sci, 2024. 30(1): p. e3534.
  36. Kallal, L.E. , et al., CCL20/CCR6 blockade enhances immunity to RSV by impairing recruitment of DC. Eur J Immunol, 2010. 40(4): p. 1042-52.
  37. Bayat, M. , et al., An overview of some potential immunotherapeutic options against COVID-19. Int Immunopharmacol, 2021. 95: p. 107516.
  38. Wang, G., X. Li, and Z. Wang, APD3: the antimicrobial peptide database as a tool for research and education. Nucleic Acids Res, 2016. 44(D1): p. D1087-93.
  39. Šali, A. and T.L. Blundell, Comparative Protein Modelling by Satisfaction of Spatial Restraints. Journal of Molecular Biology, 1993. 234(3): p. 779-815.
  40. Jumper, J. , et al., Highly accurate protein structure prediction with AlphaFold. Nature, 2021. 596(7873): p. 583-589.
  41. Science-Gateway. Protein Molecular Weight Calculator. 2025 [cited 2025 10th February]; Available from: https://www.sciencegateway.org/tools/proteinmw.htm.
  42. Ye, B. , et al., CASTpFold: Computed Atlas of Surface Topography of the universe of protein Folds. Nucleic Acids Research, 2024. 52(W1): p. W194-W199.
  43. Kandeel, M. , et al., Discovery of New Potent anti-MERS CoV Fusion Inhibitors. Front Pharmacol, 2021. 12: p. 685161.
  44. Laskowski, R.A. , et al., PDBsum: Structural summaries of PDB entries. Protein Sci, 2018. 27(1): p. 129-134.
  45. Johansson, M.U. , et al., Defining and searching for structural motifs using DeepView/Swiss-PdbViewer. BMC Bioinformatics, 2012. 13(173): p. 1-10.
  46. Dominguez, C., R. Boelens, and A.M.J.J. Bonvin, HADDOCK:  A Protein−Protein Docking Approach Based on Biochemical or Biophysical Information. Journal of the American Chemical Society, 2003. 125(7): p. 1731-1737.
  47. van Zundert, G.C.P. , et al., The HADDOCK2.2 Web Server: User-Friendly Integrative Modeling of Biomolecular Complexes. J Mol Biol, 2016. 428(4): p. 720-725.
  48. Vangone, A. and A. Bonvin, PRODIGY: A Contact-based Predictor of Binding Affinity in Protein-protein Complexes. BIO-PROTOCOL, 2017. 7.
  49. Pronk, S. , et al., GROMACS 4.5: a high-throughput and highly parallel open source molecular simulation toolkit. Bioinformatics, 2013. 29(7): p. 845-854.
  50. Robertson, M.J., J. Tirado-Rives, and W.L. Jorgensen, Improved Peptide and Protein Torsional Energetics with the OPLSAA Force Field. J Chem Theory Comput, 2015. 11(7): p. 3499-509.
  51. Yuet, P. and D. Blankschtein, Molecular Dynamics Simulation Study of Water Surfaces: Comparison of Flexible Water Models. The journal of physical chemistry. B, 2010. 114: p. 13786-13795.
  52. Schrödinger, The PyMOL Molecular Graphics System. 2020.
  53. Pettersen, E.F. , et al., UCSF Chimera--a visualization system for exploratory research and analysis. J Comput Chem, 2004. 25(13): p. 1605-1612.
  54. Tian, S. , et al., Assessing an ensemble docking-based virtual screening strategy for kinase targets by considering protein flexibility. J Chem Inf Model, 2014. 54(10): p. 2664-2679.
  55. Valdés-Tresanco, M.S. , et al., gmx_MMPBSA: A New Tool to Perform End-State Free Energy Calculations with GROMACS. Journal of Chemical Theory and Computation, 2021. 17(10): p. 6281-6291.
  56. Miller, B.R. , 3rd, et al., MMPBSA.py: An Efficient Program for End-State Free Energy Calculations. Journal of chemical theory and computation, 2012. 8(9): p. 3314-3321.
  57. Panday, S.K. and E. Alexov, Protein-Protein Binding Free Energy Predictions with the MM/PBSA Approach Complemented with the Gaussian-Based Method for Entropy Estimation. ACS Omega, 2022. 7(13): p. 11057-11067.
  58. Rathore, A.S. , et al., Prediction of hemolytic peptides and their hemolytic concentration. Communications Biology, 2025. 8(1): p. 176.
  59. Gasteiger, E. , et al., Protein Identification and Analysis Tools on the ExPASy Server, in The Proteomics Protocols Handbook, J.M. Walker, Editor. 2005, Humana Press: Totowa, NJ. p. 571-607.
Figure 1. Structural visualization of docked complexes between the HR2 domain of the MERS-CoV spike protein and top-ranked antiviral peptides (AVPs). Surface-rendered models illustrate the binding interactions between the HR2 domain of the MERS-CoV spike protein (shown in cyan) and selected AVPs, each represented in a distinct color. (A) Peptide-6 (red) is a reference inhibitor that binds peripherally along the HR2 surface. (B) An1a (magenta) penetrates deeper into the HR2 groove, suggesting robust interference with the fusion core formation. (C) CCL20 (orange) exhibits compact and stable surface binding at the HR2 site. (D) Griffithsin (slate blue) engages a broad contact interface, which is consistent with its low HADDOCK score. (E) Human Defensin 5 (green) interacts with a moderate surface area, reflecting intermediate docking performance. (F) Brevinin-2 (yellow) binds deeply within a hydrophobic cleft of HR2, indicating high structural complementarity and potential inhibitory efficiency.
Figure 1. Structural visualization of docked complexes between the HR2 domain of the MERS-CoV spike protein and top-ranked antiviral peptides (AVPs). Surface-rendered models illustrate the binding interactions between the HR2 domain of the MERS-CoV spike protein (shown in cyan) and selected AVPs, each represented in a distinct color. (A) Peptide-6 (red) is a reference inhibitor that binds peripherally along the HR2 surface. (B) An1a (magenta) penetrates deeper into the HR2 groove, suggesting robust interference with the fusion core formation. (C) CCL20 (orange) exhibits compact and stable surface binding at the HR2 site. (D) Griffithsin (slate blue) engages a broad contact interface, which is consistent with its low HADDOCK score. (E) Human Defensin 5 (green) interacts with a moderate surface area, reflecting intermediate docking performance. (F) Brevinin-2 (yellow) binds deeply within a hydrophobic cleft of HR2, indicating high structural complementarity and potential inhibitory efficiency.
Preprints 161882 g001
Figure 2. Molecular docking analysis of antiviral peptides (AVPs) targeting the HR2 domain. (A) Scatter plot showing the correlation between HADDOCK scores (a.u.) and root-mean-square deviation (RMSD, Å) across all docked AVP–HR2 complexes. Lower HADDOCK scores with low RMSD values indicate more stable and structurally consistent binding conformations. (B) Scatter plot illustrating the relationship between HADDOCK scores and predicted binding affinities (ΔG, kcal/mol). A general trend is observed where more negative HADDOCK scores correlate with stronger binding affinities. (C) Bar graph ranking the top-performing AVP–HR2 complexes based on their predicted binding affinity (ΔG), with a cutoff value of −10.0 kcal/mol. (D) Correlation matrix depicting the relationships between binding affinity and individual energetic components, including van der Waals, electrostatic, desolvation, and restraint violation energies. Correlation coefficients range from −1 to +1, with values closer to ±1 indicating strong linear relationships.
Figure 2. Molecular docking analysis of antiviral peptides (AVPs) targeting the HR2 domain. (A) Scatter plot showing the correlation between HADDOCK scores (a.u.) and root-mean-square deviation (RMSD, Å) across all docked AVP–HR2 complexes. Lower HADDOCK scores with low RMSD values indicate more stable and structurally consistent binding conformations. (B) Scatter plot illustrating the relationship between HADDOCK scores and predicted binding affinities (ΔG, kcal/mol). A general trend is observed where more negative HADDOCK scores correlate with stronger binding affinities. (C) Bar graph ranking the top-performing AVP–HR2 complexes based on their predicted binding affinity (ΔG), with a cutoff value of −10.0 kcal/mol. (D) Correlation matrix depicting the relationships between binding affinity and individual energetic components, including van der Waals, electrostatic, desolvation, and restraint violation energies. Correlation coefficients range from −1 to +1, with values closer to ±1 indicating strong linear relationships.
Preprints 161882 g002
Figure 3. Comparative analysis of flexibility and binding contributions of AVPs on the HR2 domain (A) Root Mean Square Fluctuation (RMSF) profiles of HR2 in apo form and complexes with selected AVPs, highlighting dynamic changes around residues Ile1255–Gln1271. (B) Per-residue MM/GBSA binding free energy decomposition for top AVPs, pinpointing key interacting residues (Glu1265 and Ser1268) contributing to antagonistic activity.
Figure 3. Comparative analysis of flexibility and binding contributions of AVPs on the HR2 domain (A) Root Mean Square Fluctuation (RMSF) profiles of HR2 in apo form and complexes with selected AVPs, highlighting dynamic changes around residues Ile1255–Gln1271. (B) Per-residue MM/GBSA binding free energy decomposition for top AVPs, pinpointing key interacting residues (Glu1265 and Ser1268) contributing to antagonistic activity.
Preprints 161882 g003
Table 1. Structural and database annotations of selected antiviral peptides (AVPs), including size, confidence scores, and predicted binding sites. This table presents a representative subset of 10 randomly selected AVPs. The complete list of 161 AVPs and detailed annotations are available in Supplementary Data S1.
Table 1. Structural and database annotations of selected antiviral peptides (AVPs), including size, confidence scores, and predicted binding sites. This table presents a representative subset of 10 randomly selected AVPs. The complete list of 161 AVPs and detailed annotations are available in Supplementary Data S1.
Anviral Peptide APD ID SwissProt ID/ PDB ID Size (kDa) Average pLDDT Peptide Binding Sites
(Position of Residues)
An1a AP03266 A0A5Q1NCA8 6.93 83.62 20, 21, 23, 24, 25, 27, 28, 30, 55
Brevinin-2 AP00599 P32424 2.32 81.49 1, 2, 12, 13, 21 ,22
CCL20 AP02075 1M8A 7.96 N/A 5, 9, 11, 14, 15, 16, 17, 20, 25, 29, 37, 40, 46, 48, 51, 55, 63
Griffithsin AP02133 2GTY 12.69 N/A 4, 6, 12, 16, 17, 18, 26, 27, 28, 35, 56, 57, 58
Human defensin 5 AP00180 1ZMP 3.59 N/A 3, 6, 7, 8, 9, 15, 31
Lactoferricin B AP00026 1LFC 3.13 N/A 11, 12, 13, 15
Neutrophil cationic peptide 1 type B AP00174 Q64365 3.84 63.00 1, 2, 3, 6, 7, 13, 14, 17, 18
Piscidin 2 AP01649 Q8UUG2 9.11 74.76 14, 20, 23
Shepherin II AP00512 Q9FR52 3.26 81.04 7, 9
Varv peptide E AP01030 P83835 2.92 90.55 20, 27, 28, 29
Table 2. Molecular docking and binding affinity parameters of antiviral peptides (AVPs) targeting the HR2 domain of MERS-CoV spike protein.
Table 2. Molecular docking and binding affinity parameters of antiviral peptides (AVPs) targeting the HR2 domain of MERS-CoV spike protein.
AVP-HR2 Complex HADDOCK Score
(a.u.)
Binding Affinity ΔG (kcal/mol) Kd
(M)
Cluster size RMSD
(Å)
HR2_Peptide-6 (standard inhibitor) -45.5 ± 4.6 -7.0 1.10E-05 6 1.8 ± 0.3
HR2_An1a -69.0 ± 10.8 -11.5 8.00E-09 19 1.6 ± 0.3
HR2_Melittin -65.7 ± 11.0 -11.2 1.20E-08 17 1.9 ± 1.2
HR2_CCL20 -77.7 ± 12.2 -10.9 1.90E-08 10 1.4 ± 0.2
HR2_Labyrinthopeptin A2 -80.3 ± 16.7 -10.9 2.20E-08 9 1.1 ± 0.1
HR2_Lactoferricin B -64.1 ± 11.3 -10.8 2.40E-08 8 1.1 ± 0.1
HR2_Griffithsin -84.4 ± 12.2 -10.7 2.80E-08 16 1.7 ± 0.9
HR2_Shepherin II -43.7 ± 3.7 -10.6 3.50E-08 9 1.7 ± 0.3
HR2_Human neutrophil peptide-1 -42.4 ± 10.6 -10.5 3.70E-08 8 1.0 ± 0.7
HR2_Myticin C -64.2 ± 5.1 -10.5 4.00E-08 27 1.6 ± 0.1
HR2_Tricyclic peptide RP 71955 -66.7 ± 5.6 -10.5 3.70E-08 6 1.4 ± 0.1
HR2_Human defensin 5 -52.3 ± 18.5 -10.4 4.60E-08 5 0.9 ± 0.6
HR2_Human defensin hBD-1 -56.1 ± 34.7 -10.3 5.40E-08 5 1.4 ± 0.9
HR2_Neutrophil cationic peptide 1 type B -39.0 ± 16.4 -10.3 5.80E-08 5 1.7 ± 0.3
HR2_Brevinin-2 -70.8 ± 8.9 -10.2 6.20E-08 5 1.5 ± 0.5
HR2_Latarcin 1 -56.5 ± 16.3 -10.2 6.50E-08 8 2.0 ± 0.1
HR2_Human neutrophil peptide-2 -70.3 ± 9.4 -10.1 7.70E-08 6 1.6 ± 0.2
HR2_Piscidin 2 -86.9 ± 15.8 -10.0 9.40E-08 5 1.6 ± 1.6
HR2_Varv peptide E -42.8 ± 10.1 -10.0 8.60E-08 7 1.1 ± 0.6
Table 3. Intermolecular contacts and non-interacting surface areas of AVP-HR2 complexes. This table summarizes the types and frequencies of atomic interactions between antiviral peptides and the HR2 domain, highlighting charged, polar, and apolar contacts alongside their respective non-interacting surface areas.
Table 3. Intermolecular contacts and non-interacting surface areas of AVP-HR2 complexes. This table summarizes the types and frequencies of atomic interactions between antiviral peptides and the HR2 domain, highlighting charged, polar, and apolar contacts alongside their respective non-interacting surface areas.
AVP-HR2 Complex ICs charged-charged ICs charged-polar ICs charged-apolar ICs polar-polar ICs polar-apolar ICs apolar-apolar NIS charged NIS apolar
HR2_Peptide-6 (standard inhibitor) 2 5 3 2 7 3 16.13 44.84
HR2_An1a 3 3 17 1 20 21 15.20 46.50
HR2_Melittin 3 4 12 4 24 21 16.11 46.31
HR2_CCL20 4 5 19 3 18 20 17.48 44.79
HR2_Labyrinthopeptin A2 2 9 19 8 22 12 16.39 44.59
HR2_Lactoferricin B 3 8 13 0 18 16 17.06 45.15
HR2_Griffithsin 3 11 25 7 17 23 15.90 44.47
HR2_Shepherin II 1 6 13 1 19 21 13.78 48.08
HR2_Human neutrophil peptide-1 0 6 11 2 20 20 16.05 45.15
HR2_Myticin C 1 5 6 7 27 17 15.45 46.88
HR2_Tricyclic peptide RP 71955 0 0 12 3 21 26 14.78 46.74
HR2_Human defensin 5 3 4 11 2 18 16 16.78 44.41
HR2_Human defensin hBD-1 3 10 10 4 20 21 16.07 45.25
HR2_Neutrophil cationic peptide 1 type B 1 4 8 3 22 20 17.76 45.63
HR2_Brevinin-2 0 2 12 1 18 31 15.74 46.23
HR2_Latarcin 1 5 9 25 2 11 12 18.46 44.30
HR2_Human neutrophil peptide-2 1 5 10 1 17 28 15.72 45.15
HR2_Piscidin 2 2 6 17 0 13 22 17.00 45.33
HR2_Varv peptide E 1 2 2 6 25 19 15.15 46.13
Note: ICs: Number of intermolecular contacts; NIS: Non-interacting surface.
Table 4. Key residue-level interactions between HR2 and antiviral peptides (AVPs). The molecular docking simulation identified hydrogen bonds and polar contact distances between HR2 residues and interacting AVP residues.
Table 4. Key residue-level interactions between HR2 and antiviral peptides (AVPs). The molecular docking simulation identified hydrogen bonds and polar contact distances between HR2 residues and interacting AVP residues.
AVP-HR2 Complex Residue (Receptor) Protein Atom
(Receptor)
Residue
(Interacting Protein/Peptide)
Protein Atom
(Interacting Protein/Peptide)
Interaction Distance
(Å)
HR2_Peptide-6 (standard inhibitor) Thr1258 N Glu15 OE2 2.98
Thr1258 OG1 Glu15 OE2 2.74
Leu1260 N Tyr14 OH 2.96
Asp1261 O Ser18 OG 2.93
Glu1265 OE2 Ser18 OG 2.87
Ser1268 OG Lys24 NZ 2.79
Gln1271 NE2 Glu28 OE1 2.72
HR2_An1a Asp1261 N Leu21 O 3.21
Glu1265 OE2 Phe26 N 3.11
Glu1265 OE2 Gly27 N 2.67
Ser1268 OG His38 NE2 2.99
HR2_Griffithsin Thr1253 OG1 Gly36 O 3.26
Leu1260 N Ser19 OG 2.85
Tyr1264 OH His4 ND1 2.85
Tyr1264 OH Glu119 OE2 3.21
Glu1265 OE2 Gln102 NE2 2.68
Ser1268 OG Arg5 N 2.90
HR2_Brevinin-2 Thr1258 O Lys31 NZ 2.67
Glu1265 SD Lys28 NZ 3.12
Ser1268 O Ser5 OG 2.70
Ser1268 OG1 Leu2 N 3.17
Table 5. Time-averaged structural properties obtained from the MD simulations of AVP-HR2 complexes.
Table 5. Time-averaged structural properties obtained from the MD simulations of AVP-HR2 complexes.
AVP-HR2 Complex Average RMSD (Å) Average RMSF (Å) Average RoG
(Å)
Number of Hydrogen Bonds Between the Two Proteins
HR2_Peptide-6 (standard inhibitor) 2.572 0.976 2.282 24
HR2_An1a 2.347 0.942 2.176 35
HR2_Melittin 2.341 0.936 2.174 37
HR2_CCL20 2.330 0.924 2.171 40
HR2_Labyrinthopeptin A2 2.433 0.926 2.172 39
HR2_Lactoferricin B 2.455 0.952 2.181 33
HR2_Griffithsin 2.301 0.888 2.161 43
HR2_Shepherin II 2.378 0.971 2.194 29
HR2_Human neutrophil peptide-1 2.359 0.956 2.184 32
HR2_Myticin C 2.411 1.115 2.298 33
HR2_Tricyclic peptide RP 71955 2.365 1.021 2.188 30
HR2_Human defensin 5 2.244 0.938 2.176 36
HR2_Human defensin hBD-1 2.325 0.919 2.170 41
HR2_Neutrophil cationic peptide 1 type B 2.543 1.022 2.187 33
HR2_Brevinin-2 2.322 0.914 2.168 42
HR2_Latarcin 1 2.351 0.948 2.179 34
HR2_Human neutrophil peptide-2 2.362 0.959 2.186 31
HR2_Piscidin 2 2.469 1.124 2.298 24
HR2_Varv peptide E 2.495 0.989 2.201 26
Table 6. Top-performing antiviral peptides (AVPs) targeting the MERS-CoV HR2 Domain: Binding free energies (ΔGbinding) from MM/PBSA calculations.
Table 6. Top-performing antiviral peptides (AVPs) targeting the MERS-CoV HR2 Domain: Binding free energies (ΔGbinding) from MM/PBSA calculations.
AVP-HR2 Complex MM/PBSA Calculation Results ΔGbinding (kcal/mol)
HR2_Peptide-6 (standard inhibitor) −49.73 ± 4.08
HR2_An1a −138.97 ± 2.13
HR2_Melittin −145.99 ± 3.56
HR2_CCL20 −165.17 ± 2.91
HR2_Labyrinthopeptin A2 −165.13 ± 1.87
HR2_Lactoferricin B −130.55 ± 3.42
HR2_Griffithsin −213.69 ± 4.73
HR2_Shepherin II −106.17 ± 2.59
HR2_Human neutrophil peptide-1 −127.17 ± 1.96
HR2_Myticin C −154.63 ± 2.77
HR2_Tricyclic peptide RP 71955 −121.32 ± 1.85
HR2_Human defensin 5 −142.05 ± 3.21
HR2_Human defensin hBD-1 −166.63 ± 4.15
HR2_Neutrophil cationic peptide 1 type B −153.91 ± 3.94
HR2_Brevinin-2 −168.83 ± 2.66
HR2_Latarcin 1 −133.42 ± 1.78
HR2_Human neutrophil peptide-2 −124.60 ± 2.35
HR2_Piscidin 2 −147.04 ± 1.42
HR2_Varv peptide E −98.99 ± 4.92
Table 7. Haemolytic activity prediction of selected antiviral peptides (AVPs). The table presented below furnishes information about the user-input query peptides, encompassing their IDs, pattern names (which signify hemolytic motifs), machine learning scores (indicating the likelihood of toxicity), MERCI scores, hybrid scores (which amalgamate ML and MERCI), and overall predictions (whether they are hemolytic or non-hemolytic). A prediction value (hybrid scores) nearing one implies a high likelihood of hemolysis, while a value nearing zero indicates non-hemolytic properties.
Table 7. Haemolytic activity prediction of selected antiviral peptides (AVPs). The table presented below furnishes information about the user-input query peptides, encompassing their IDs, pattern names (which signify hemolytic motifs), machine learning scores (indicating the likelihood of toxicity), MERCI scores, hybrid scores (which amalgamate ML and MERCI), and overall predictions (whether they are hemolytic or non-hemolytic). A prediction value (hybrid scores) nearing one implies a high likelihood of hemolysis, while a value nearing zero indicates non-hemolytic properties.
Antiviral Peptide Sequence ESM Score MERCI Score Hybrid Scores Prediction
Peptide-6
(standard inhibitor)
SLTQINWTLLDLTYEMESLQQVVKALNEYYIDLKHL 0.675 −1.0 0.0 Non-Haemolytic
An1a METAHVFLLSFLLLCVFAVDLIEAGFGCPLDQMQCHNHCQSVRYRGGYCTNFLKMTCKCYG 0.679 −1.0 0.0 Non-Haemolytic
Melittin GIGAVLKVLTTGLPALISWIKRKRQQ 0.764 −1.0 0.0 Non-Haemolytic
CCL20 SNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM 0.674 −0.5 0.174 Non-Haemolytic
Labyrinthopeptin A2 MASILELQNLDVEHARGENRSDWSLWECCSTGSLFACC 0.724 −1.0 0.0 Non-Haemolytic
Lactoferricin B FKCRRWQWRMKKLGAPSITCVRRAF 0.479 −1.0 0.0 Non-Haemolytic
Griffithsin SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY 0.636 −1.0 0.0 Non-Haemolytic
Shepherin II GYHGGHGGHGGGYNGGGGHGGHGGGYNGGGHHGGGGHG 0.706 −0.5 0.206 Non-Haemolytic
Human neutrophil peptide-1 ACYCRIPACIAGERRYGTCIYQGRLWAFCC 0.742 −1.0 0.0 Non-Haemolytic
Myticin C MKATILLAVVVAVIVGVQEAQSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSRAESPLALSGSARNVNDKNNEMENSPLMNEVVNLDQEMNMF 0.666 −0.5 0.166 Non-Haemolytic
Tricyclic peptide RP 71955 CLGIGSCNDFAGCGYAVVCFW 0.755 −1.0 0.0 Non-Haemolytic
Human defensin 5 ATCYCRTGRCATRESLSGVCEISGRLYRLCCR 0.709 −1.0 0.0 Non-Haemolytic
Human defensin hBD-1 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 0.684 −1.0 0.0 Non-Haemolytic
Neutrophil cationic peptide 1 type B RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC 0.729 −1.0 0.0 Non-Haemolytic
Brevinin-2 GIWDTIKSMGKVFAGKILQNL 0.722 −1.0 0.0 Non-Haemolytic
Latarcin 1 SMWSGMWRRKLKKLRNALKKKLKGE 0.221 −1.0 0.0 Non-Haemolytic
Human neutrophil peptide-2 CYCRIPACIAGERRYGTCIYQGRLWAFCC 0.741 −1.0 0.0 Non-Haemolytic
Piscidin 2 MKCATLSLVLSMVVLMAEPGDAFFHHIFRGIVHVGKTIHKLVTGGKAEQDQQDQQYQQDQQDQQAQQYQRFNRERAAFD 0.679 −1.0 0.0 Non-Haemolytic
Varv peptide E GLPICGETCVGGTCNTPGCSCSWPVCTRN 0.742 0.0 0.742 Hemolytic
Table 8. Physicochemical properties of antiviral peptides (AVPs), including stability, hydrophobicity, and half-life predictions. These parameters were computed using the ProtParam tool, providing insights into each peptide's potential behavior in biological environments.
Table 8. Physicochemical properties of antiviral peptides (AVPs), including stability, hydrophobicity, and half-life predictions. These parameters were computed using the ProtParam tool, providing insights into each peptide's potential behavior in biological environments.
Antiviral Peptide Theoretical pI Extinction Coefficients* Estimated Half-life** Instability index Aliphatic index GRAVY***
Peptide-6 (standard inhibitor) 4.50 9970 1.9 hours 16.41 127.22 −0.083
An1a 6.78 4845 30 hours 25.56 81.48 0.413
Melittin 12.02 5500 30 hours 44.73 135.00 0.273
CCL20 9.70 8730 1.9 hours 8.19 93.19 −0.106
Labyrinthopeptin A2 4.35 11250 30 hours 59.12 77.11 −0.084
Lactoferricin B 11.84 11125 1.1 hours 77.92 50.80 −0.576
Griffithsin 5.39 11920 1.9 hours 39.86 70.91 −0.240
Shepherin II 7.28 4470 30 hours 27.98 0.00 −1.224
Human neutrophil peptide-1 8.68 10345 4.4 hours 55.71 65.33 0.300
Myticin C 5.52 7950 30 hours 39.38 88.70 0.242
Tricyclic peptide RP 71955 3.80 7240 1.2 hours 33.82 74.29 1.157
Human defensin 5 8.96 3355 4.4 hours 13.79 64.06 −0.113
Human defensin hBD-1 8.87 4845 1.1 hours 34.49 46.11 −0.272
Neutrophil cationic peptide 1 type B 9.80 3355 1 hour 53.98 47.10 −0.200
Brevinin-2 9.70 5500 30 hours 2.80 111.43 0.286
Latarcin 1 11.77 11000 1.9 hours 18.36 66.40 −1.248
Human neutrophil peptide-2 8.67 10345 1.2 hours 42.13 64.14 0.248
Piscidin 2 6.38 2980 30 hours 42.36 70.38 −0.605
Varv peptide E 5.96 5875 30 hours 39.95 46.90 0.159
* Extinction coefficients are in units of M-1 cm-1, at 280 nm measured in water. ** Mammalian reticulocytes, in vitro. *** Grand average of hydropathicity.
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
Copyright: This open access article is published under a Creative Commons CC BY 4.0 license, which permit the free download, distribution, and reuse, provided that the author and preprint are cited in any reuse.
Prerpints.org logo

Preprints.org is a free preprint server supported by MDPI in Basel, Switzerland.

Subscribe

© 2026 MDPI (Basel, Switzerland) unless otherwise stated

Accessibility

Disclaimer

Terms of Use

Privacy Policy

Privacy Settings