Preprint
Article

This version is not peer-reviewed.

An Exhaustive Exploration of the Semaglutide-GLP-1R Sequence Space towards the Design of Semaglutide Analogues with Elevated Binding Affinity to GLP-1R

Wei Li  *

Submitted:

04 May 2024

Posted:

06 May 2024

You are already at the latest version

Abstract
Semaglutide is a potent GLP-1 receptor agonist used in the treatment of type 2 diabetes mellitus due to its ability to regulate blood glucose levels and promote weight loss. On July 26, 2021, with a manually defined set of computational structural and biophysical analysis, a simple Val27-Arg28 exchange was for the first time introduced in the backbone of semaglutide to strengthen the semaglutide-GLP-1R binding affinity. In this article, a comprehensive structural and biophysical analysis approach is for the first time proposed towards an exhaustive exploration of the semaglutide-GLP-1R sequence space for the design of semaglutide analogues with elevated binding affinity to GLP-1R, thereby potentially enhancing therapeutic efficacy of structurally conceivable semaglutide analogues. Through structure biophysics-based rational design and computational modeling, this article puts forward a set of semaglutide analogues and calculated their binding affinities to GLP-1R, with one particular semaglutide analogue-GLP-1R structural model reaching a Kd of 3.0 × 10-8 M, while the Kd is 3.4 × 10-6 M for the binding of native semaglutide to GLP-1. Overall, the computationally designed semaglutide analogues here constitute a hopeful approach for developing GLP-1 receptor agonists with improved efficacy for the treatment of diabetes and weight management in future.
Keywords: 
;  ;  ;  

1. Introduction

Semaglutide is a synthetic glucagon-like peptide-1 (GLP-1) receptor agonist that has garnered significant attention in the field of diabetes management [1,2,3]. Structurally, it is a synthetic peptide consisting of 39 amino acids. Semaglutide shares 94% sequence homology with natural human GLP-1 [2,3,4,5,6,7,8,9]. At the molecular level, semaglutide binds and activates the GLP-1 receptor, promoting insulin secretion and inhibiting glucagon release from pancreatic beta and alpha cells, respectively [10,11,12].
Originally developed by Novo Nordisk, semaglutide was approved by regulatory agencies for the treatment of type 2 diabetes mellitus (T2DM) due to its potent glucose-lowering effects and additional benefits such as weight loss and cardiovascular risk reduction [13,14,15,16]. Semaglutide is available in both injectable and oral formulations, with the injectable form typically administered once weekly and the oral form taken once daily [17,18,19]. The therapeutic efficacy of semaglutide arises from its ability to activate GLP-1 receptors located on pancreatic beta cells, leading to increased insulin secretion in a glucose-dependent manner. Additionally, semaglutide slows gastric emptying, suppresses appetite, and promotes satiety, contributing to its effects on weight loss and glycemic control [20,21,22].
Ligand-receptor binding affinity is an essential parameter in computer-assisted drug discovery and structure-based drug design [23]. Thanks to the continued development of experimental structural biology and the half-a-century old Protein Data Bank (PDB) [24,25,26,27,28], a comprehensive structural biophysical analysis becomes possible [29,30] for specific ligand-receptor complex structures deposited in PDB, such that our understanding of the structural and biophysical basis of their interfacial stability is able to help us modify the binding affinity of certain drug target and its interacting partners [31,32,33,34,35]. Take semaglutide for instance. On July 26, 2021, with a manually defined set of computational structural and biophysical analysis, a simple Val27-Arg28 exchange was for the first time introduced in the backbone of semaglutide to strengthen the semaglutide-GLP-1R binding affinity [7,9,36].
Figure 1. Strengthening semaglutide-GLP-1R binding affinity via a Val27-Arg28 exchange in the peptide backbone of semaglutide [9]. This figure was prepared with PyMol [37].
Figure 1. Strengthening semaglutide-GLP-1R binding affinity via a Val27-Arg28 exchange in the peptide backbone of semaglutide [9]. This figure was prepared with PyMol [37].
Preprints 105606 g001

2. Motivation

The development of semaglutide analogues with increased GLP-1R binding affinity holds significant clinical relevance, offering the potential for enhanced glucose control, weight loss, and cardiovascular benefits in patients with type 2 diabetes and obesity [3,38,39]. By leveraging insights from structural biology and computational modeling and biophysics, this article seeks to design semaglutide derivatives that exhibit tighter interactions with the GLP-1R binding site, thereby improving receptor activation and downstream signaling pathways. These analogues may represent a new class of GLP-1R agonists with superior therapeutic efficacy and reduced dosing frequency, addressing current limitations in the management of metabolic disorders [40,41].

3. Materials and Methods

As listed in Table 1, there is one structure (determined by Cryo-EM) of Semaglutide-bound Glucagon-Like Peptide-1 (GLP-1) Receptor in Complex with Gs protein (PDB ID: 7KI0 [42]) as of 2024/05/14 14:02:52.
However, with a QUERY code: QUERY: Full Text = "Semaglutide", a total of three experimental structures related to semaglutide were found in the Protein Data Bank (PDB [24]), as listed in Table 2.
Among the three, there is one structure (determined by X-ray diffraction) of the semaglutide peptide backbone in complex with the extracellular domain of GLP-1R (PDB ID: 4ZGM [39]). Briefly, the amino acid sequences of the two chains of semaglutide and GLP-1R (according to PDB entry 4ZGM [39]) are listed in italics in fasta format as below,
>4ZGM_1|Chain A|Glucagon-like peptide 1 receptor|Homo sapiens (9606)
RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
>4ZGM_2|Chain B|Semaglutide peptide backbone; 8Aib,34R-GLP-1(7-37)-OH|Homo sapiens (9606)
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
In combination with the comprehensive structural and biophysical analysis [29], the key amino acid residues at the semaglutide-GLP-1R complex binding interface (PDB ID: 4ZGM) were examined carefully in PyMol [9,37,39], and the inter-residue distances were calculated by PyMol [37] to identify potential neighbouring residue pair(s) to modulate the structural stability of the semaglutide-GLP-1R complex structure, leading to the design of a set of semaglutide variants with enhanced binding affinity.
In general, after homology structural modeling of semaglutide variants with Modeller [43], the binding affinity between semaglutide and GLP-1R was calculated using Prodigy [44,45]. Specifically, a total of ( s = g ( 28 , 4 ) = 28 ! 4 ! ( 24 ) ! × 20 4 [46]) set of semaglutide analogues were generated with in-house Python script with four site-specific missense mutations introduced into native semaglutide sequences as listed above. Afterwards, homology structural modeling was carried out using Modeller [43] with PDB entry 4ZGM [39] as the structural template. Finally, the binding affinity between semaglutide and GLP-1R was calculated using Prodigy [44,45] for native semaglutide (10000 times) and for s = g ( 28 , 4 ) = 28 ! 4 ! ( 24 ) ! × 20 4 [46] semaglutide analogues (twenty times each).

4. Results

First off, with the X-ray structure of the semaglutide peptide backbone in complex with the extracellular domain of GLP-1R (PDB ID: 4ZGM [39]) in place, Modeller [43] was employed to build 10000 structural models with 100% homology to PDB ID: 4ZGM [39], and the binding affinity between semaglutide and GLP-1R was calculated using Prodigy [44,45] for native semaglutide (10000 times). As shown in Figure 2, most of the Kd values are located between 2.5 × 10-6 M and 4.0 × 10-6 M, with an average at 3.278 × 10-6 M, which is rather close to the one Kd (3.4 × 10-6 M) as reported in [9].
Secondly, with the X-ray structure of the semaglutide peptide backbone in complex with the extracellular domain of GLP-1R (PDB ID: 4ZGM [39]) as the structural template, a total of s = g ( 28 , 4 ) = 28 ! 4 ! ( 24 ) ! × 20 4 [46] semaglutide variants’ sequence were generated, and plugged into Modeller [43] to build 20 structural models for each semaglutide analogue, and the binding affinity between semaglutide and GLP-1R was calculated using Prodigy [44,45]. In total, the binding affinities of 100 semaglutide analogues to GLP-1R are included in Table 3, including their minimum, maximum, average and standard deviation of the Kd values calculated using Prodigy [44,45] for the semaglutide analogues, each 20 times of homology structural modeling using Modeller [43] In supplementary file supps.pdf, Table 1 includes a total of 8915 semaglutide analogues, including their minimum, maximum, average and standard deviation of the Kd values calculated using Prodigy [44,45] for the semaglutide analogues, each 20 times of homology structural modeling using Modeller [43].
Among the 100 semaglutide analogues included in Table 3, one particular semaglutide analogue stood out, named here as semaglutideX, where the semaglutideX-GLP-1R structural model is reaching a Kd value of 3.0 × 10-8 M, while the Kd is 3.4 × 10-6 M for the binding of native semaglutide to GLP-1 [9]. The amino acid sequence of semaglutideX is listed in italics in fasta format as below,
>semaglutideX (supplementary file semx.pdb)
HAEGTFTSDVSSYLEAQAAKEFQAWRNRGRG
For a close comparison, the amino acid sequence of semaglutide (PDB ID: 4ZGM [39]) is listed in italics in fasta format as below,
>4ZGM_2|Chain B|Semaglutide peptide backbone; 8Aib,34R-GLP-1(7-37)-OH|Homo sapiens (9606)
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
and the amino acid sequence of semaglutide with a Val27-Arg28 exchange [9] is listed in italics in fasta format as below,
>Val27-Arg28 exchange
HAEGTFTSDVSSYLEGQAAKEFIAWLRVGRG
With the X-ray structure of the semaglutide peptide backbone in complex with the extracellular domain of GLP-1R (PDB ID: 4ZGM [39]) in place, Modeller [43] was employed to build 20 structural models for each one of the 8915 semaglutide variants (supplementary file semx.pdb), and the binding affinity between semaglutide variants and GLP-1R were calculated using Prodigy [44,45] for 20 times. As shown in Figure 3, most of the Kd values are located between 1.0 × 10-7 M and 2.0 × 10-7 M, with an average at 1.437 × 10-7 M, which is at least one order of degree lower that the Kd (3.4 × 10-6 M) as reported in [9].

5. Conclusion

To sum up, this article reports a set of computationally designed semaglutide analogues with elevated binding affinity to the GLP-1 receptor compared to native semaglutide and also to a previous semaglutide with a Val27-Arg28 exchange [9]. Overall, these analogues hold promise for improving the treatment of type 2 diabetes and obesity by enhancing receptor activation and downstream signaling cascades. Future preclinical and clinical studies are needed to evaluate the pharmacological properties and therapeutic potential of these novel semaglutide derivatives. Moreover, continued optimization of GLP-1R agonists through structure-based drug design approaches could lead to further advancements in the field, ultimately benefiting patients with diabetes.

6. Discussion

Pharmacologically, there are reasons to design semaglutide analogues with elevated binding affinity to the glucagon-like peptide-1 receptor (GLP-1R) compared to semaglutide itself. However, designing semaglutide analogues with heightened binding affinity to the glucagon-like peptide-1 receptor (GLP-1R) presents both opportunities and challenges in the field of metabolic therapeutics. On the positive side, analogues with enhanced receptor affinity hold the potential to improve therapeutic outcomes by maximizing receptor activation and downstream signaling pathways, leading to more robust glucose control, weight loss, and potentially cardioprotective effects [47]. Additionally, these analogues may offer the advantage of reduced dosing frequency, enhancing patient compliance and convenience [48]. However, there are also drawbacks to consider, including the risk of off-target effects [49] and increased receptor desensitization with prolonged exposure to highly potent semaglutide analogues. Furthermore, the development of analogues with elevated binding affinity necessitates careful optimization to maintain selectivity and minimize adverse reactions [50,51]. Balancing these factors is crucial for realizing the full therapeutic potential of semaglutide analogues with enhanced GLP-1R binding affinity while mitigating potential risks, which is where a truly general intermolecular binding affinity calculator [46,52,53] will be useful to accomodate off-target effects and drug-drug interactions [49,50,51].
Finally, while this study represents a series of semaglutide analogues with elevated binding affinity to the GLP-1 receptor compared to native semaglutide and also to a previous semaglutide with a Val27-Arg28 exchange [9], the entire process of the design, along with the structural biophysics-based strategy for the molecular design [31,32,33,34,54], is essentially also a process of the construction of a semaglutide-GLP-1R based mini general intermolecular binding affinity calculator (GIBAC) [46,52,53] based on the structure of semaglutide peptide backbone in complex with the GLP-1 receptor extracellular domain determined by X-ray diffraction [39]. With a series of semaglutide analogues with elevated binding affinity to the GLP-1R available and this semaglutide-GLP-1R based mini GIBAC in place, here, this articles calls again for the construction of a truly general intermolecular binding affinity calculator to be listed on the agenda of the entire community of drug discovery and design [46,52,53].

7. Acknowledgment

The author is grateful to the communities of structural biology, biophysics, medicinal and computational chemistry and algorithm design, for the continued accumulation of knowledge and data for drug discovery & design, and for the continued development of tools (hardware, software and algorithm) for drug discovery & design.

8. Ethical Statement

No ethical approval is required.

9. Declaration of Generative AI and AI-Assisted Technologies in the Writing Process

During the preparation of this work, the author used OpenAI’s ChatGPT in order to improve the readability of the manuscript, and to make it as concise and short as possible. After using this tool, the author reviewed and edited the content as needed and takes full responsibility for the content of the publication.

Author Contributions

Conceptualization, W.L.; methodology, W.L.; software, W.L.; validation, W.L.; formal analysis, W.L.; investigation, W.L.; resources, W.L.; data duration, W.L.; writing–original draft preparation, W.L.; writing–review and editing, W.L.; visualization, W.L.; supervision, W.L.; project administration, W.L.; funding acquisition, not applicable.

Funding

This research received no external funding.

Conflicts of Interest

The author declares no conflict of interest.

References

  1. Marijic, J.; Neelankavil, J.P. Semaglutide: A New Medical Swiss Army Knife? Journal of Cardiothoracic and Vascular Anesthesia 2024, 38, 871–873. [Google Scholar] [CrossRef] [PubMed]
  2. Cowart, K. Oral Semaglutide: First-in-Class Oral GLP-1 Receptor Agonist for the Treatment of Type 2 Diabetes Mellitus. Annals of Pharmacotherapy 2019, 54, 478–485. [Google Scholar] [CrossRef] [PubMed]
  3. Knudsen, L.B.; Lau, J. The Discovery and Development of Liraglutide and Semaglutide. Frontiers in Endocrinology 2019, 10, 1–32. [Google Scholar] [CrossRef] [PubMed]
  4. Yang, J.; Anishchenko, I.; Park, H.; Peng, Z.; Ovchinnikov, S.; Baker, D. Improved protein structure prediction using predicted interresidue orientations. Proceedings of the National Academy of Sciences 2020, 117, 1496–1503. [Google Scholar] [CrossRef]
  5. Han, J.; Fu, J.; Yang, Q.; Zhou, F.; Chen, X.; Li, C.; Yin, J. Rational design and biological evaluation of gemfibrozil modified Xenopus GLP-1 derivatives as long-acting hypoglycemic agents. European Journal of Medicinal Chemistry 2020, 198, 112389. [Google Scholar] [CrossRef] [PubMed]
  6. Aschenbrenner, D.S. New Drug for Type 2 Diabetes. AJN, American Journal of Nursing 2020, 120, 25. [Google Scholar] [CrossRef]
  7. Ahrén, B.; Atkin, S.L.; Charpentier, G.; Warren, M.L.; Wilding, J.P.H.; Birch, S.; Holst, A.G.; Leiter, L.A. Semaglutide induces weight loss in subjects with type 2 diabetes regardless of baseline BMI or gastrointestinal adverse events in the SUSTAIN 1 to 5 trials. Diabetes, Obesity and Metabolism 2018, 20, 2210–2219. [Google Scholar] [CrossRef]
  8. Lee, Y.S.; Jun, H.S. Anti-diabetic actions of glucagon-like peptide-1 on pancreatic beta-cells. Metabolism 2014, 63, 9–19. [Google Scholar] [CrossRef]
  9. Li, W. Strengthening Semaglutide-GLP-1R Binding Affinity via a Val27-Arg28 Exchange in the Peptide Backbone of Semaglutide: A Computational Structural Approach. Journal of Computational Biophysics and Chemistry 2021, 20, 495–499. [Google Scholar] [CrossRef]
  10. Wang, W.; Volkow, N.D.; Berger, N.A.; Davis, P.B.; Kaelber, D.C.; Xu, R. Association of semaglutide with risk of suicidal ideation in a real-world cohort. Nature Medicine 2024, 30, 168–176. [Google Scholar] [CrossRef]
  11. Li, W. Designing Insulin Analogues with Lower Binding Affinity to Insulin Receptor than That of Insulin Icodec 2024. [CrossRef]
  12. Li, W. Delving Deep into the Structural Aspects of the BPro28-BLys29 Exchange in Insulin Lispro: A Structural Biophysical Lesson 2020.
  13. Kosiborod, M.N.; Petrie, M.C.; Borlaug, B.A.; Butler, J.; Davies, M.J.; Hovingh, G.K.; Kitzman, D.W.; Møller, D.V.; Treppendahl, M.B.; Verma, S.; Jensen, T.J.; Liisberg, K.; Lindegaard, M.L.; Abhayaratna, W.; Ahmed, F.Z.; Ben-Gal, T.; Chopra, V.; Ezekowitz, J.A.; Fu, M.; Ito, H.; Lelonek, M.; Melenovský, V.; Merkely, B.; Núñez, J.; Perna, E.; Schou, M.; Senni, M.; Sharma, K.; van der Meer, P.; Von Lewinski, D.; Wolf, D.; Shah, S.J. Semaglutide in Patients with Obesity-Related Heart Failure and Type 2 Diabetes. New England Journal of Medicine 2024, 390, 1394–1407. [Google Scholar] [CrossRef] [PubMed]
  14. Wilding, J.P.H. Semaglutide in weight management: Author’s reply. The Lancet 2019, 394, 1226–1227. [Google Scholar] [CrossRef] [PubMed]
  15. Bucheit, J.D.; Pamulapati, L.G.; Carter, N.; Malloy, K.; Dixon, D.L.; Sisson, E.M. Oral Semaglutide: A Review of the First Oral Glucagon-Like Peptide 1 Receptor Agonist. Diabetes Technology & Therapeutics 2020, 22, 10–18. [Google Scholar]
  16. Kanters, S.; Wilkinson, L.; Vrazic, H.; Sharma, R.; Lopes, S.; Popoff, E.; Druyts, E. Comparative efficacy of once-weekly semaglutide versus SGLT-2 inhibitors in patients inadequately controlled with one to two oral antidiabetic drugs: a systematic literature review and network meta-analysis. BMJ Open 2019, 9, e023458. [Google Scholar] [CrossRef] [PubMed]
  17. Kosiborod, M.N.; Verma, S.; Borlaug, B.A.; Butler, J.; Davies, M.J.; Jon Jensen, T.; Rasmussen, S.; Erlang Marstrand, P.; Petrie, M.C.; Shah, S.J.; Ito, H.; Schou, M.; Melenovský, V.; Abhayaratna, W.; Kitzman, D.W. Effects of Semaglutide on Symptoms, Function, and Quality of Life in Patients With Heart Failure With Preserved Ejection Fraction and Obesity: A Prespecified Analysis of the STEP-HFpEF Trial. Circulation 2024, 149, 204–216. [Google Scholar] [CrossRef] [PubMed]
  18. Nadkarni, P.; Chepurny, O.G.; Holz, G.G. Regulation of Glucose Homeostasis by GLP-1. In Progress in Molecular Biology and Translational Science; Elsevier, 2014; pp. 23–65.
  19. Bucheit, J.D.; Pamulapati, L.G.; Carter, N.; Malloy, K.; Dixon, D.L.; Sisson, E.M. Oral Semaglutide: A Review of the First Oral Glucagon-Like Peptide 1 Receptor Agonist. Diabetes Technology & Therapeutics 2020, 22, 10–18. [Google Scholar]
  20. Granhall, C.; Donsmark, M.; Blicher, T.M.; Golor, G.; Sondergaard, F.L.; Thomsen, M.; Bakdal, T.A. Safety and Pharmacokinetics of Single and Multiple Ascending Doses of the Novel Oral Human GLP-1 Analogue, Oral Semaglutide, in Healthy Subjects and Subjects with Type 2 Diabetes. Clinical Pharmacokinetics 2018, 58, 781–791. [Google Scholar] [CrossRef]
  21. Garg, S.K.; Kaur, G.; Haider, Z.; Rodriquez, E.; Beatson, C.; Snell-Bergeon, J. Efficacy of Semaglutide in Overweight and Obese Patients with Type 1 Diabetes. Diabetes Technology & Therapeutics 2024, 26, 184–189. [Google Scholar] [CrossRef] [PubMed]
  22. Europe, T.L.R.H. Semaglutide and beyond a turning point in obesity pharmacotherapy. The Lancet Regional Health Europe 2024, 37, 100860. [Google Scholar] [CrossRef]
  23. Fuji, H.; Qi, F.; Qu, L.; Takaesu, Y.; Hoshino, T. Prediction of Ligand Binding Affinity to Target Proteins by Molecular Mechanics Theoretical Calculation. Chemical and Pharmaceutical Bulletin 2017, 65, 461–468. [Google Scholar] [CrossRef]
  24. Berman, H.; Henrick, K.; Nakamura, H. Announcing the worldwide Protein Data Bank. Nature Structural & Molecular Biology 2003, 10, 980–980. [Google Scholar]
  25. Li, W. Half-a-century Burial of ρ, θ and φ in PDB 2021. [CrossRef]
  26. Li, W. Visualising the Experimentally Uncharted Territories of Membrane Protein Structures inside Protein Data Bank 2020.
  27. Li, W. A Local Spherical Coordinate System Approach to Protein 3D Structure Description 2020.
  28. Li, W. Structurally Observed Electrostatic Features of the COVID-19 Coronavirus-Related Experimental Structures inside Protein Data Bank: A Brief Update 2020.
  29. Li, W. How do SMA-linked mutations of SMN1 lead to structural/functional deficiency of the SMA protein? PLOS ONE 2017, 12, e0178519. [Google Scholar] [CrossRef]
  30. Li, W. Extracting the Interfacial Electrostatic Features from Experimentally Determined Antigen and/or Antibody-Related Structures inside Protein Data Bank for Machine Learning-Based Antibody Design 2020.
  31. Li, W. Structural Identification of the Electrostatic Hot Spots for Severe Acute Respiratory Syndrome Coronavirus Spike Protein to Be Complexed with Its Receptor ACE2 and Its Neutralizing Antibodies 2020.
  32. Li, W. Calcium Channel Trafficking Blocker Gabapentin Bound to the -2–1 Subunit of Voltage-Gated Calcium Channel: A Computational Structural Investigation 2020.
  33. Li, W. Inter-Molecular Electrostatic Interactions Stabilizing the Structure of the PD-1/PD-L1 Axis: A Structural Evolutionary Perspective 2020.
  34. Li, W. Structural and Functional Consequences of the SMA-Linked Missense Mutations of the Survival Motor Neuron Protein: A Brief Update. In Novel Aspects on Motor Neuron Disease; IntechOpen, 2019.
  35. Li, W. Designing Nerve Growth Factor Analogues to Suppress Pain Signal Transduction Mediated by the p75NTR-NGF-TrkA Complex: A Structural and Biophysical Perspective 2024. [CrossRef]
  36. Aroda, V.R.; Rosenstock, J.; Terauchi, Y.; Altuntas, Y.; Lalic, N.M.; Villegas, E.C.M.; Jeppesen, O.K.; Christiansen, E.; Hertz, C.L.; Haluzík, M. PIONEER 1: Randomized Clinical Trial of the Efficacy and Safety of Oral Semaglutide Monotherapy in Comparison With Placebo in Patients With Type 2 Diabetes. Diabetes Care 2019, 42, 1724–1732. [Google Scholar] [CrossRef]
  37. DeLano, W.L. Pymol: An open-source molecular graphics tool. CCP4 Newsletter On Protein Crystallography 2002, 40, 82–92. [Google Scholar]
  38. Blüher, M.; Rosenstock, J.; Hoefler, J.; Manuel, R.; Hennige, A.M. Dose–response effects on HbA1c and bodyweight reduction of survodutide, a dual glucagon/GLP-1 receptor agonist, compared with placebo and open-label semaglutide in people with type 2 diabetes: a randomised clinical trial. Diabetologia 2023, 67, 470–482. [Google Scholar] [CrossRef]
  39. Lau, J.; Bloch, P.; Schäffer, L.; Pettersson, I.; Spetzler, J.; Kofoed, J.; Madsen, K.; Knudsen, L.B.; McGuire, J.; Steensgaard, D.B.; Strauss, H.M.; Gram, D.X.; Knudsen, S.M.; Nielsen, F.S.; Thygesen, P.; Reedtz-Runge, S.; Kruse, T. Discovery of the Once-Weekly Glucagon-Like Peptide-1 (GLP-1) Analogue Semaglutide. Journal of Medicinal Chemistry 2015, 58, 7370–7380. [Google Scholar] [CrossRef] [PubMed]
  40. Anderson, S.L.; Beutel, T.R.; Trujillo, J.M. Oral semaglutide in type 2 diabetes. Journal of Diabetes and its Complications 2020, 34, 107520. [Google Scholar] [CrossRef]
  41. Pieber, T.R.; Bode, B.; Mertens, A.; Cho, Y.M.; Christiansen, E.; Hertz, C.L.; Wallenstein, S.O.R.; Buse, J.B.; Akın, S.; Aladağ, N.; Arif, A.A.; Aronne, L.J.; Aronoff, S.; Ataoglu, E.; Baik, S.H.; Bays, H.; Beckett, P.L.; Berker, D.; Bilz, S.; Bode, B.; Braun, E.W.; Buse, J.B.; Canani, L.H.S.; Cho, Y.M.; Chung, C.H.; Colin, I.; Condit, J.; Cooper, J.; Delgado, B.; Eagerton, D.C.; Ebrashy, I.N.E.; Hefnawy, M.H.M.F.E.; Eliaschewitz, F.G.; Finneran, M.P.; Fischli, S.; Fließer-Görzer, E.; Geohas, J.; Godbole, N.A.; Golay, A.; de Lapertosa, S.G.; Gross, J.L.; Gulseth, H.L.; Helland, F.; Høivik, H.O.; Issa, C.; Kang, E.S.; Keller, C.; Khalil, S.H.A.; Kim, N.H.; Kim, I.J.; Klaff, L.J.; Laimer, M.; LaRocque, J.C.; Lederman, S.N.; Lee, K.W.; Litchfield, W.R.; Manning, M.B.; Mertens, A.; Morawski, E.J.; Murray, A.V.; Nicol, P.R.; O’Connor, T.M.; Oğuz, A.; Ong, S.; özdemir, A.; Palace, E.M.; Palchick, B.A.; Pereles-Ortiz, J.; Pieber, T.; Prager, R.; Preumont, V.; Riffer, E.; Rista, L.; Rudofsky, G.; Sarı, R.; Scheen, A.; Schultes, B.; Seo, J.A.; Shelbaya, S.A.; Sivalingam, K.; Sorli, C.H.; Stäuble, S.; Streja, D.A.; T’Sjoen, G.; Tetiker, T.; Gaal, L.V.; Vercammen, C.; Warren, M.L.; Weinstein, D.L.; Weiss, D.; White, A.; Winnie, M.; Wium, C.; Yavuz, D. Efficacy and safety of oral semaglutide with flexible dose adjustment versus sitagliptin in type 2 diabetes (PIONEER 7): a multicentre, open-label, randomised, phase 3a trial. The Lancet Diabetes & Endocrinology 2019, 7, 528–539. [Google Scholar]
  42. Zhang, X.; Belousoff, M.; Danev, R.; Sexton, P.; Wootten, D. Semaglutide-bound Glucagon-Like Peptide-1 (GLP-1) Receptor in Complex with Gs protein, 2021. [CrossRef]
  43. Webb, B.; Sali, A. Protein Structure Modeling with MODELLER. In Methods in Molecular Biology; Springer US, 2020; pp. 239–255.
  44. Vangone, A.; Bonvin, A.M. Contacts-based prediction of binding affinity in protein-protein complexes. eLife 2015, 4. [Google Scholar] [CrossRef]
  45. Xue, L.C.; Rodrigues, J.P.; Kastritis, P.L.; Bonvin, A.M.; Vangone, A. PRODIGY: a web server for predicting the binding affinity of protein-protein complexes. Bioinformatics 2016, p. btw514.
  46. Li, W.; Vottevor, G. Towards a Truly General Intermolecular Binding Affinity Calculator for Drug Discovery & Design 2023. [CrossRef]
  47. Carris, N.W.; Wallace, S.; DuCoin, C.G.; Mhaskar, R.; Stern, M.; Bunnell, B. Discontinuing semaglutide after weight loss: strategy for weight maintenance and a possible new side effect. Canadian Journal of Physiology and Pharmacology 2024. [Google Scholar] [CrossRef]
  48. Trujillo, J.M.; Nuffer, W.; Smith, B.A. GLP-1 receptor agonists: an updated review of head-to-head clinical studies. Therapeutic Advances in Endocrinology and Metabolism 2021, 12, 204201882199732. [Google Scholar] [CrossRef] [PubMed]
  49. He, Y.; Su, J.; Lan, B.; Gao, Y.; Zhao, J. Targeting off-target effects: endoplasmic reticulum stress and autophagy as effective strategies to enhance temozolomide treatment. OncoTargets and Therapy 2019, Volume 12, 1857–1865. [Google Scholar] [CrossRef]
  50. Smits, M.M.; Van Raalte, D.H. Safety of Semaglutide. Frontiers in Endocrinology 2021, 12. [Google Scholar] [CrossRef] [PubMed]
  51. Shetty, R.; Basheer, F.T.; Poojari, P.G.; Thunga, G.; Chandran, V.P.; Acharya, L.D. Adverse drug reactions of GLP-1 agonists: A systematic review of case reports. Diabetes & Metabolic Syndrome: Clinical Research & Reviews 2022, 16, 102427. [Google Scholar] [CrossRef] [PubMed]
  52. Li, W. Towards a General Intermolecular Binding Affinity Calculator 2022.
  53. Li, W. High-Throughput Extraction of Interfacial Electrostatic Features from GLP-1-GLP-1R Complex Structures: A GLP-1-GLP-1R-Based Mini GIBAC Perspective 2024. [CrossRef]
  54. Li, W.; Shi, G. How CaV1.2-bound verapamil blocks Ca2+ influx into cardiomyocyte: Atomic level views. Pharmacological Research 2019, 139, 153–157. [Google Scholar] [CrossRef]
Figure 2. Distribution of the binding affinities between semaglutide (PDB ID: 4ZGM [39]) and GLP-1R as calculated by Prodigy [44,45].
Figure 2. Distribution of the binding affinities between semaglutide (PDB ID: 4ZGM [39]) and GLP-1R as calculated by Prodigy [44,45].
Preprints 105606 g002
Figure 3. Distribution of the binding affinities between semaglutideX (supplementary file semx.pdb) and GLP-1R as calculated by Prodigy [44,45].
Figure 3. Distribution of the binding affinities between semaglutideX (supplementary file semx.pdb) and GLP-1R as calculated by Prodigy [44,45].
Preprints 105606 g003
Table 1. Experimentally determined semaglutide-related structures (released newest from oldest) in the Protein Data Bank (PDB [24]) as of 2024/05/14 14:02:52, QUERY code: QUERY: Polymer Entity Description = "Semaglutide".
Table 1. Experimentally determined semaglutide-related structures (released newest from oldest) in the Protein Data Bank (PDB [24]) as of 2024/05/14 14:02:52, QUERY code: QUERY: Polymer Entity Description = "Semaglutide".
PDB ID Structure Title (release date from newest to oldest)
7KI0 Semaglutide-bound Glucagon-Like Peptide-1 (GLP-1) Receptor in Complex with Gs protein
Table 2. Experimentally determined semaglutide-related structures (released newest from oldest) in the Protein Data Bank (PDB [24]) as of 2024/05/14 14:02:52, QUERY code: QUERY: Full Text = "Semaglutide".
Table 2. Experimentally determined semaglutide-related structures (released newest from oldest) in the Protein Data Bank (PDB [24]) as of 2024/05/14 14:02:52, QUERY code: QUERY: Full Text = "Semaglutide".
PDB ID Structure Title (release date from newest to oldest)
7KI0 Semaglutide-bound Glucagon-Like Peptide-1 (GLP-1) Receptor in Complex with Gs protein
7KI1 Taspoglutide-bound Glucagon-Like Peptide-1 (GLP-1) Receptor in Complex with Gs Protein
4ZGM Crystal structure of Semaglutide peptide backbone in complex with the GLP-1 receptor extracellular domain
Table 3. Computationally designed semaglutide analogues with elevated binding affinity to GLP-1R than native semaglutide. In this table, the binding affinity of semaglutide analogues to GLP-1R is calculated with Prodigy [44,45] at Kd (37 °C) values, while Muta1, Muta2, Muta3 and Muta4 represent the four site-specific mutations introduced into the backbone of semaglutide, and Min, Max, Mean and Std represent the minimum, the maximum, the average and the standard deviation of the Kd values calculated using Prodigy [44,45] for the semaglutide analogues, each 20 times of homology structural modeling using Modeller [43].
Table 3. Computationally designed semaglutide analogues with elevated binding affinity to GLP-1R than native semaglutide. In this table, the binding affinity of semaglutide analogues to GLP-1R is calculated with Prodigy [44,45] at Kd (37 °C) values, while Muta1, Muta2, Muta3 and Muta4 represent the four site-specific mutations introduced into the backbone of semaglutide, and Min, Max, Mean and Std represent the minimum, the maximum, the average and the standard deviation of the Kd values calculated using Prodigy [44,45] for the semaglutide analogues, each 20 times of homology structural modeling using Modeller [43].
No. Muta1 Muta2 Muta3 Muta4 Min Max Mean Std
1 G13B_A I20B_Q L23B_Q V24B_N 5.3E-08 2.2E-07 1.337E-07 4.778E-08
2 G13B_A I20B_N L23B_R V24B_N 6.5E-08 2.4E-07 1.344E-07 4.996E-08
3 G13B_A I20B_N L23B_Q V24B_T 6.6E-08 2.2E-07 1.376E-07 4.199E-08
4 G13B_A I20B_T L23B_Q V24B_N 8.0E-08 3.1E-07 1.404E-07 5.478E-08
5 G13B_A I20B_Q L23B_Q V24B_T 6.8E-08 2.0E-07 1.407E-07 3.779E-08
6 G13B_A I20B_S L23B_R V24B_T 6.1E-08 2.5E-07 1.408E-07 5.527E-08
7 G13B_A I20B_Q L23B_R V24B_N 3.0E-08 3.2E-07 1.461E-07 7.095E-08
8 G13B_A I20B_T L23B_R V24B_N 8.3E-08 2.1E-07 1.467E-07 3.690E-08
9 G13B_A I20B_N L23B_R V24B_Q 6.3E-08 2.9E-07 1.487E-07 5.848E-08
10 G13B_A I20B_Q L23B_R V24B_Q 8.6E-08 2.5E-07 1.489E-07 5.170E-08
11 G13B_A I20B_Q L23B_Q V24B_Q 6.3E-08 2.4E-07 1.505E-07 5.269E-08
12 G13B_A I20B_S L23B_R V24B_N 4.4E-08 3.5E-07 1.520E-07 6.568E-08
13 G13B_A I20B_T L23B_R V24B_T 9.4E-08 2.2E-07 1.545E-07 4.188E-08
14 G13B_A I20B_N L23B_Q V24B_N 7.7E-08 2.2E-07 1.559E-07 4.164E-08
15 G13B_A I20B_S L23B_R V24B_Q 7.7E-08 3.0E-07 1.571E-07 6.401E-08
16 G13B_A I20B_S F19B_Q V24B_N 3.5E-08 2.8E-07 1.583E-07 6.648E-08
17 G13B_A I20B_N L23B_Q V24B_Q 8.2E-08 2.9E-07 1.602E-07 5.879E-08
18 G13B_A I20B_N F19B_Q V24B_N 5.0E-08 2.9E-07 1.634E-07 7.035E-08
19 G13B_A I20B_T F19B_Q V24B_Q 9.7E-08 2.9E-07 1.653E-07 4.839E-08
20 G13B_A I20B_N L23B_R V24B_T 8.0E-08 3.4E-07 1.662E-07 8.233E-08
21 G13B_A I20B_S L23B_Q V24B_Q 7.8E-08 3.4E-07 1.682E-07 7.062E-08
22 G13B_A I20B_Q F19B_Q V24B_T 3.6E-08 3.3E-07 1.686E-07 7.653E-08
23 G13B_A I20B_S L23B_Q V24B_N 6.2E-08 3.0E-07 1.703E-07 6.652E-08
24 G13B_A E18B_T I20B_Q V24B_Q 8.4E-08 2.7E-07 1.706E-07 5.558E-08
25 G13B_A I20B_T F19B_Q V24B_N 6.3E-08 2.9E-07 1.711E-07 7.268E-08
26 Y10B_A I20B_Q L23B_Q V24B_Q 7.3E-08 3.8E-07 1.725E-07 8.816E-08
27 G13B_A I20B_S F19B_Q V24B_T 6.2E-08 3.2E-07 1.725E-07 6.884E-08
28 G13B_A I20B_T L23B_R V24B_Q 5.5E-08 3.0E-07 1.725E-07 6.902E-08
29 G13B_A I20B_T F19B_Q V24B_T 6.5E-08 3.3E-07 1.765E-07 7.216E-08
30 G13B_A I20B_T L23B_Q V24B_T 9.2E-08 3.4E-07 1.765E-07 7.525E-08
31 G13B_A I20B_Q L23B_R V24B_T 8.3E-08 3.7E-07 1.778E-07 7.613E-08
32 G13B_A I20B_S L23B_Q V24B_T 7.8E-08 3.6E-07 1.785E-07 6.839E-08
33 G13B_A I20B_T L23B_Q V24B_Q 9.1E-08 2.9E-07 1.791E-07 4.888E-08
34 G13B_A I20B_Q K17B_S V24B_N 7.5E-08 2.9E-07 1.822E-07 7.042E-08
35 G13B_A I20B_Q K17B_S V24B_T 8.2E-08 2.9E-07 1.826E-07 5.543E-08
36 G13B_A I20B_Q S9B_A V24B_N 7.7E-08 3.5E-07 1.836E-07 6.655E-08
37 G13B_A E18B_T I20B_Q V24B_N 9.5E-08 2.7E-07 1.842E-07 5.523E-08
38 Y10B_A I20B_Q L23B_R V24B_N 8.1E-08 4.7E-07 1.851E-07 9.983E-08
39 G13B_A I20B_Q F19B_Q V24B_N 6.0E-08 3.1E-07 1.869E-07 6.942E-08
40 G13B_A I20B_Q F19B_Q V24B_Q 7.3E-08 3.4E-07 1.870E-07 7.308E-08
41 Y10B_A I20B_N L23B_R V24B_Q 8.9E-08 3.7E-07 1.890E-07 7.203E-08
42 G13B_A I20B_Q S9B_A V24B_T 9.1E-08 3.6E-07 1.895E-07 7.000E-08
43 G13B_A I20B_Q S9B_A L23B_R 8.6E-08 4.6E-07 1.900E-07 8.860E-08
44 G13B_A I20B_N F19B_Q V24B_Q 6.8E-08 3.4E-07 1.909E-07 6.762E-08
45 G13B_A I20B_S F19B_Q V24B_Q 8.8E-08 3.5E-07 1.926E-07 7.739E-08
46 Y10B_A I20B_Q L23B_R V24B_T 9.9E-08 3.5E-07 1.934E-07 7.962E-08
47 Y10B_A I20B_Q L23B_R V24B_Q 6.6E-08 3.3E-07 1.951E-07 7.414E-08
48 G13B_A I20B_Q K17B_S V24B_Q 8.3E-08 3.6E-07 1.962E-07 6.561E-08
49 Y10B_A I20B_T L23B_R V24B_T 1.1E-07 3.4E-07 1.970E-07 6.689E-08
50 G13B_A I20B_T K17B_S V24B_N 1.1E-07 3.0E-07 1.975E-07 5.524E-08
52 Y10B_A I20B_N L23B_R V24B_T 1.1E-07 3.5E-07 1.985E-07 6.784E-08
53 G13B_A I20B_Q S9B_A V24B_Q 9.0E-08 3.0E-07 1.985E-07 6.548E-08
54 G13B_A I20B_S F19B_Q L23B_R 1.2E-07 3.1E-07 1.990E-07 5.077E-08
55 G13B_A I20B_N K17B_S V24B_N 1.2E-07 4.4E-07 2.015E-07 7.264E-08
56 G13B_A I20B_S F19B_Q L23B_Q 7.7E-08 4.1E-07 2.023E-07 9.647E-08
57 G13B_A I20B_S L23B_R K17B_S 1.1E-07 2.8E-07 2.030E-07 4.736E-08
58 Y10B_A I20B_T L23B_R V24B_N 8.9E-08 4.4E-07 2.034E-07 7.708E-08
59 G13B_A I20B_N K17B_S V24B_Q 1.0E-07 5.2E-07 2.035E-07 8.707E-08
60 Y10B_A I20B_S L23B_R V24B_T 8.6E-08 3.5E-07 2.038E-07 7.595E-08
61 G13B_A I20B_N S9B_A L23B_R 1.2E-07 3.8E-07 2.050E-07 8.300E-08
62 G13B_A I20B_N F19B_Q V24B_T 8.4E-08 4.1E-07 2.067E-07 7.351E-08
63 G13B_A I20B_N L23B_R K17B_S 1.1E-07 3.8E-07 2.070E-07 8.228E-08
64 G13B_A E18B_T I20B_Q L23B_Q 1.1E-07 3.4E-07 2.080E-07 7.317E-08
65 G13B_A I20B_N L23B_Q K17B_S 1.1E-07 3.6E-07 2.080E-07 7.557E-08
66 G13B_A I20B_T F19B_Q L23B_R 6.7E-08 3.5E-07 2.097E-07 9.136E-08
67 G13B_A I20B_S K17B_S V24B_N 8.6E-08 3.6E-07 2.098E-07 7.261E-08
68 Y10B_A I20B_N F19B_Q V24B_Q 7.6E-08 3.9E-07 2.098E-07 8.400E-08
69 Y10B_A I20B_N L23B_R V24B_N 1.1E-07 3.4E-07 2.100E-07 6.696E-08
70 G13B_A I20B_T S9B_A L23B_R 8.9E-08 3.8E-07 2.104E-07 7.158E-08
71 Y10B_A I20B_T L23B_R V24B_Q 1.2E-07 3.2E-07 2.105E-07 5.698E-08
72 G13B_A I20B_Q L23B_R K17B_S 8.2E-08 7.9E-07 2.120E-07 1.610E-07
73 G13B_A I20B_T K17B_S V24B_Q 9.2E-08 4.2E-07 2.121E-07 7.875E-08
74 G13B_A I20B_N E18B_T V24B_N 1.3E-07 3.8E-07 2.125E-07 7.181E-08
75 G13B_A I20B_T L23B_R K17B_S 9.5E-08 4.5E-07 2.128E-07 9.408E-08
76 G13B_A E18B_T I20B_S V24B_T 1.0E-07 3.5E-07 2.135E-07 7.081E-08
77 G13B_A I20B_Q F19B_W V24B_Q 8.9E-08 3.9E-07 2.149E-07 8.920E-08
78 Y10B_A I20B_Q L23B_Q V24B_N 6.7E-08 4.5E-07 2.161E-07 1.064E-07
79 Y10B_A I20B_N L23B_Q V24B_Q 9.7E-08 3.3E-07 2.168E-07 5.626E-08
80 G13B_A I20B_N E18B_T L23B_R 1.1E-07 4.0E-07 2.175E-07 9.118E-08
81 G13B_A I20B_Q V24B_Q E12B_A 1.0E-07 3.9E-07 2.175E-07 8.175E-08
82 Y10B_A I20B_S L23B_Q V24B_Q 8.7E-08 3.4E-07 2.179E-07 7.437E-08
83 G13B_A I20B_N F19B_Q L23B_R 8.9E-08 4.4E-07 2.179E-07 9.986E-08
84 Y10B_A I20B_Q K17B_S V24B_T 1.1E-07 4.0E-07 2.195E-07 7.970E-08
85 G13B_A I20B_S S9B_A V24B_Q 9.9E-08 3.2E-07 2.199E-07 5.489E-08
86 G13B_A I20B_Q L23B_Q K17B_S 7.5E-08 3.6E-07 2.208E-07 7.533E-08
87 Y10B_A I20B_T L23B_Q V24B_N 1.0E-07 4.7E-07 2.210E-07 9.037E-08
88 Y10B_A I20B_Q F19B_Q V24B_N 6.8E-08 5.7E-07 2.218E-07 1.294E-07
89 G13B_A I20B_S F19B_W V24B_N 1.3E-07 3.7E-07 2.225E-07 7.376E-08
90 Y10B_A I20B_Q F19B_Q V24B_Q 9.9E-08 4.3E-07 2.244E-07 8.656E-08
91 G13B_A E18B_T I20B_Q L23B_R 8.6E-08 3.9E-07 2.248E-07 9.776E-08
92 G13B_A I20B_T S9B_A V24B_Q 1.4E-07 3.7E-07 2.250E-07 6.653E-08
93 Y10B_A I20B_S L23B_R V24B_N 1.4E-07 3.5E-07 2.260E-07 6.344E-08
94 G13B_A I20B_T F19B_Q L23B_Q 6.0E-08 4.6E-07 2.263E-07 1.111E-07
95 G13B_A I20B_N E18B_T V24B_Q 1.0E-07 4.0E-07 2.265E-07 7.700E-08
96 Y10B_A I20B_Q F19B_Q V24B_T 8.5E-08 3.2E-07 2.267E-07 6.989E-08
97 Y10B_A I20B_T L23B_Q V24B_Q 9.6E-08 4.5E-07 2.268E-07 9.045E-08
98 G13B_A I20B_N E18B_T V24B_T 1.2E-07 4.4E-07 2.270E-07 8.572E-08
99 G13B_A E18B_T I20B_T L23B_Q 1.0E-07 4.9E-07 2.270E-07 1.064E-07
100 Y10B_A I20B_N F19B_Q V24B_N 9.0E-08 4.4E-07 2.277E-07 9.537E-08
Table 4. The binding affinities of semaglutide, semaglutide with a Val27-Arg28 exchange [9] and semaglutideX to GLP-1R calculated by Prodigy [44,45]. In this table, 4ZGM represents the experimental structure (determined by X-ray diffraction) of the semaglutide peptide backbone in complex with the extracellular domain of GLP-1R (PDB ID: 4ZGM), mutant semaglutide represents the B27Arg-B28Val mutant of semaglutide, whose structural model is described in the supplementary file semx.pdb, and semaglutideX represents a semaglutide variant with four site-specific missense mutations, i.e., G13B_A I20B_Q L23B_R V24B_N.
Table 4. The binding affinities of semaglutide, semaglutide with a Val27-Arg28 exchange [9] and semaglutideX to GLP-1R calculated by Prodigy [44,45]. In this table, 4ZGM represents the experimental structure (determined by X-ray diffraction) of the semaglutide peptide backbone in complex with the extracellular domain of GLP-1R (PDB ID: 4ZGM), mutant semaglutide represents the B27Arg-B28Val mutant of semaglutide, whose structural model is described in the supplementary file semx.pdb, and semaglutideX represents a semaglutide variant with four site-specific missense mutations, i.e., G13B_A I20B_Q L23B_R V24B_N.
PDB file Protein-Protein Complex Δ G (kcal/mol) Kd (M) at 37 °C Fold to 4ZGM
4ZGM [39] semaglutide-GLP-1R [39] -7.8 3.4 × 10-6 1
sema.pdb [9] Val27-Arg28 exchange [9] -8.4 1.1 × 10-6 3.09
semx.pdb G13B_A I20B_Q L23B_R V24B_N -10.7 3.0 × 10-8 113.33
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.
Copyright: This open access article is published under a Creative Commons CC BY 4.0 license, which permit the free download, distribution, and reuse, provided that the author and preprint are cited in any reuse.