Submitted:
16 June 2023
Posted:
26 June 2023
You are already at the latest version
Abstract
Keywords:
1. Introduction
2. Materials and Methods
2.1. Collection of brain tissue from suspected rabid dogs and jackals in Georgia
2.2. RNA purification and degenerate PCR amplification and sequencing of the lyssavirus N gene
2.3. Shotgun sequencing of total RNA samples
2.4. Sequencing-data processing and genome assembly
2.5. Analysis of heterozygous single nucleotide variants (SNVs)
2.6. Phylogenetic analysis
2.7. Sequence analysis of the G glycoprotein ectodomain
2.8. Principal components analysis (PCA) of ectodomain group and geographic origin of samples
2.9. Clustering of RABV genomes and RABV protein sequences
2.10. Alignment of clustered RABV amino acid sequences
2.11. Analysis of predicted epitopes for RABV-GEO P, M, L proteins
2.12. RABV isolation and neutralization with mAb A6
3. Results
3.1. PCR screening and sequencing of N genes of Georgian canine brain tissue isolates
3.2. Sequencing and assembly of seventy-seven complete Georgian RABV genomes
3.3. Phylogeny of the newly identified RABV genomes
3.4. Clustering analysis of RABV full-length genomes
3.5. Amino acid sequence variability in the RABV G ectodomain
3.6. Global sequence variability of RABV proteins
3.7. Epitopes in RABV-GEO P, M and L proteins
3.8. Neutralization of RABV isolates by mAb A6
4. Discussion
Supplementary Materials
Author Contributions
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Hampson, K.; Coudeville, L.; Lembo, T.; Sambo, M.; Kieffer, A.; Attlan, M.; Barrat, J.; Blanton, J.D.; Briggs, D.J.; Cleaveland, S.; et al. Estimating the global burden of endemic canine rabies. PLoS Negl Trop Dis 2015, 9, e0003709. [Google Scholar] [CrossRef]
- Knobel, D.L.; Jackson, A.C.; Bingham, J.; Ertl, H.C.J.; Gibson, A.D.; Hughes, D.; Joubert, K.; Mani, R.S.; Mohr, B.J.; Moore, S.M.; et al. A One Medicine Mission for an Effective Rabies Therapy. Front Vet Sci 2022, 9, 867382. [Google Scholar] [CrossRef] [PubMed]
- Benavides, J.A.; Valderrama, W.; Recuenco, S.; Uieda, W.; Suzan, G.; Avila-Flores, R.; Velasco-Villa, A.; Almeida, M.; Andrade, F.A.G.; Molina-Flores, B.; et al. Defining New Pathways to Manage the Ongoing Emergence of Bat Rabies in Latin America. Viruses 2020, 12. [Google Scholar] [CrossRef] [PubMed]
- Acharya, K.P.; Chand, R.; Huettmann, F.; Ghimire, T.R. Rabies Elimination: Is It Feasible without Considering Wildlife? J Trop Med 2022, 2022, 5942693. [Google Scholar] [CrossRef] [PubMed]
- Tidman, R.; Fahrion, A.S.; Thumbi, S.M.; Wallace, R.M.; De Balogh, K.; Iwar, V.; Yale, G.; Dieuzy-Labaye, I. United Against Rabies Forum: The first 2 years. Front Public Health 2023, 11, 1010071. [Google Scholar] [CrossRef] [PubMed]
- Lojkic, I.; Simic, I.; Bedekovic, T.; Kresic, N. Current Status of Rabies and Its Eradication in Eastern and Southeastern Europe. Pathogens 2021, 10. [Google Scholar] [CrossRef]
- Fisher, C.R.; Streicker, D.G.; Schnell, M.J. The spread and evolution of rabies virus: conquering new frontiers. Nat Rev Microbiol 2018, 16, 241–255. [Google Scholar] [CrossRef]
- Scott, T.P.; Nel, L.H. Lyssaviruses and the Fatal Encephalitic Disease Rabies. Front Immunol 2021, 12, 786953. [Google Scholar] [CrossRef]
- Brunker, K.; Nadin-Davis, S.; Biek, R. Genomic sequencing, evolution and molecular epidemiology of rabies virus. Rev Sci Tech 2018, 37, 401–408. [Google Scholar] [CrossRef]
- Holmes, E.C. The phylogeography of human viruses. Mol Ecol 2004, 13, 745–756. [Google Scholar] [CrossRef]
- Bourhy, H.; Reynes, J.M.; Dunham, E.J.; Dacheux, L.; Larrous, F.; Huong, V.T.Q.; Xu, G.; Yan, J.; Miranda, M.E.G.; Holmes, E.C. The origin and phylogeography of dog rabies virus. J Gen Virol 2008, 89, 2673–2681. [Google Scholar] [CrossRef]
- Troupin, C.; Dacheux, L.; Tanguy, M.; Sabeta, C.; Blanc, H.; Bouchier, C.; Vignuzzi, M.; Duchene, S.; Holmes, E.C.; Bourhy, H. Large-Scale Phylogenomic Analysis Reveals the Complex Evolutionary History of Rabies Virus in Multiple Carnivore Hosts. PLoS Pathog 2016, 12, e1006041. [Google Scholar] [CrossRef] [PubMed]
- Campbell, K.; Gifford, R.J.; Singer, J.; Hill, V.; O'Toole, A.; Rambaut, A.; Hampson, K.; Brunker, K. Making genomic surveillance deliver: A lineage classification and nomenclature system to inform rabies elimination. PLoS Pathog 2022, 18, e1010023. [Google Scholar] [CrossRef] [PubMed]
- Bacus, M.G.; Buenaventura, S.G.C.; Mamites, A.M.C.; Elizagaque, H.G.; Labrador, C.C.; Delfin, F.C.; Eng, M.N.J.; Lagare, A.P.; Marquez, G.N.; Murao, L.A.E. Genome-based local dynamics of canine rabies virus epidemiology, transmission, and evolution in Davao City, Philippines, 2018-2019. Infect Genet Evol 2021, 92, 104868. [Google Scholar] [CrossRef]
- Dellicour, S.; Troupin, C.; Jahanbakhsh, F.; Salama, A.; Massoudi, S.; Moghaddam, M.K.; Baele, G.; Lemey, P.; Gholami, A.; Bourhy, H. Using phylogeographic approaches to analyse the dispersal history, velocity and direction of viral lineages - Application to rabies virus spread in Iran. Mol Ecol 2019, 28, 4335–4350. [Google Scholar] [CrossRef]
- Heaton, P.R.; Johnstone, P.; McElhinney, L.M.; Cowley, R.; O'Sullivan, E.; Whitby, J.E. Heminested PCR assay for detection of six genotypes of rabies and rabies-related viruses. J Clin Microbiol 1997, 35, 2762–2766. [Google Scholar] [CrossRef]
- Bushnell, B. BBMap: A Fast, Accurate, Splice-Aware Aligner. In Proceedings of the Conference: 9th Annual Genomics of Energy & Environment Meeting, Walnut Creek, CA, USA., 17-20 March 2014. [Google Scholar]
- Shen, W.; Ren, H. TaxonKit: A practical and efficient NCBI taxonomy toolkit. J Genet Genomics 2021, 48, 844–850. [Google Scholar] [CrossRef]
- Nurk, S.; Meleshko, D.; Korobeynikov, A.; Pevzner, P.A. metaSPAdes: a new versatile metagenomic assembler. Genome Res 2017, 27, 824–834. [Google Scholar] [CrossRef]
- Wick, R.R.; Schultz, M.B.; Zobel, J.; Holt, K.E. Bandage: interactive visualization of de novo genome assemblies. Bioinformatics 2015, 31, 3350–3352. [Google Scholar] [CrossRef]
- Wick, R.R.; Judd, L.M.; Gorrie, C.L.; Holt, K.E. Unicycler: Resolving bacterial genome assemblies from short and long sequencing reads. PLoS Comput Biol 2017, 13, e1005595. [Google Scholar] [CrossRef]
- Kalyaanamoorthy, S.; Minh, B.Q.; Wong, T.K.F.; von Haeseler, A.; Jermiin, L.S. ModelFinder: fast model selection for accurate phylogenetic estimates. Nat Methods 2017, 14, 587–589. [Google Scholar] [CrossRef] [PubMed]
- Minh, B.Q.; Schmidt, H.A.; Chernomor, O.; Schrempf, D.; Woodhams, M.D.; von Haeseler, A.; Lanfear, R. IQ-TREE 2: New Models and Efficient Methods for Phylogenetic Inference in the Genomic Era. Mol Biol Evol 2020, 37, 1530–1534. [Google Scholar] [CrossRef] [PubMed]
- Hoang, D.T.; Chernomor, O.; von Haeseler, A.; Minh, B.Q.; Vinh, L.S. UFBoot2: Improving the Ultrafast Bootstrap Approximation. Mol Biol Evol 2018, 35, 518–522. [Google Scholar] [CrossRef] [PubMed]
- Rambaut, A. FigTree. Available online: http://tree.bio.ed.ac.uk/software/figtree/ (accessed on.
- Wheeler, D.L.; Barrett, T.; Benson, D.A.; Bryant, S.H.; Canese, K.; Chetvernin, V.; Church, D.M.; Dicuccio, M.; Edgar, R.; Federhen, S.; et al. Database resources of the National Center for Biotechnology Information. Nucleic Acids Res 2008, 36, D13–21. [Google Scholar] [CrossRef] [PubMed]
- Madeira, F.; Pearce, M.; Tivey, A.R.N.; Basutkar, P.; Lee, J.; Edbali, O.; Madhusoodanan, N.; Kolesnikov, A.; Lopez, R. Search and sequence analysis tools services from EMBL-EBI in 2022. Nucleic Acids Res 2022, 50, W276–279. [Google Scholar] [CrossRef]
- Lai, C.Y.; Dietzschold, B. Amino acid composition and terminal sequence analysis of the rabies virus glycoprotein: identification of the reading frame on the cDNA sequence. Biochem Biophys Res Commun 1981, 103, 536–542. [Google Scholar] [CrossRef]
- Yang, F.; Lin, S.; Ye, F.; Yang, J.; Qi, J.; Chen, Z.; Lin, X.; Wang, J.; Yue, D.; Cheng, Y. , et al. Structural Analysis of Rabies Virus Glycoprotein Reveals pH-Dependent Conformational Changes and Interactions with a Neutralizing Antibody. Cell Host Microbe 2020, 27, 441–453. [Google Scholar] [CrossRef]
- Team, R.C. R: A Language and Environment for Statistical Computing. 2022. [Google Scholar]
- Wickham, H. ggplot2: Elegant Graphics for Data Analysis. Springer-Verlag New York 2016.
- Benson, D.A.; Karsch-Mizrachi, I.; Lipman, D.J.; Ostell, J.; Rapp, B.A.; Wheeler, D.L. GenBank. Nucleic Acids Res 2000, 28, 15–18. [Google Scholar] [CrossRef]
- Steinegger, M.; Soding, J. MMseqs2 enables sensitive protein sequence searching for the analysis of massive data sets. Nat Biotechnol 2017, 35, 1026–1028. [Google Scholar] [CrossRef]
- Mistry, J.; Chuguransky, S.; Williams, L.; Qureshi, M.; Salazar, G.A.; Sonnhammer, E.L.L.; Tosatto, S.C.E.; Paladin, L.; Raj, S.; Richardson, L.J. , et al. Pfam: The protein families database in 2021. Nucleic Acids Res 2021, 49, D412–D419. [Google Scholar] [CrossRef]
- Dhanda, S.K.; Mahajan, S.; Paul, S.; Yan, Z.; Kim, H.; Jespersen, M.C.; Jurtz, V.; Andreatta, M.; Greenbaum, J.A.; Marcatili, P. , et al. IEDB-AR: immune epitope database-analysis resource in 2019. Nucleic Acids Res 2019, 47, W502–W506. [Google Scholar] [CrossRef]
- Olson, R.D.; Assaf, R.; Brettin, T.; Conrad, N.; Cucinell, C.; Davis, J.J.; Dempsey, D.M.; Dickerman, A.; Dietrich, E.M.; Kenyon, R.W. , et al. Introducing the Bacterial and Viral Bioinformatics Resource Center (BV-BRC): a resource combining PATRIC, IRD and ViPR. Nucleic Acids Res 2023, 51, D678–D689. [Google Scholar] [CrossRef] [PubMed]
- Weir, D.L.; Coggins, S.A.; Vu, B.K.; Coertse, J.; Yan, L.; Smith, I.L.; Laing, E.D.; Markotter, W.; Broder, C.C.; Schaefer, B.C. Isolation and Characterization of Cross-Reactive Human Monoclonal Antibodies That Potently Neutralize Australian Bat Lyssavirus Variants and Other Phylogroup 1 Lyssaviruses. Viruses 2021, 13. [Google Scholar] [CrossRef] [PubMed]
- Meechan, P.J.; Potts, J. Biosafety in microbiological and biomedical laboratories. 2020. 2020. [Google Scholar]
- Tordo, N.; Kouknetzoff, A. The rabies virus genome: an overview. Onderstepoort J Vet Res 1993, 60, 263–269. [Google Scholar] [PubMed]
- Tordo, N.; Badrane, H.; Bourhy, H.; Sacramento, D. Molecular epidemiology of lyssaviruses: focus on the glycoprotein and pseudogenes. Onderstepoort J Vet Res 1993, 60, 315–323. [Google Scholar]
- Tabatadze, L.; Gabashvili, E.; Kobakhidze, S.; Lomidze, G.; Loladze, J.; Tsitskishvili, L.; Kotetishvili, M. Evolutionary analysis of rabies virus isolates from Georgia. Arch Virol 2022, 167, 2293–2298. [Google Scholar] [CrossRef]
- Badrane, H.; Bahloul, C.; Perrin, P.; Tordo, N. Evidence of two Lyssavirus phylogroups with distinct pathogenicity and immunogenicity. J Virol 2001, 75, 3268–3276. [Google Scholar] [CrossRef]
- Wunner, W.H.; Larson, J.K.; Dietzschold, B.; Smith, C.L. The molecular biology of rabies viruses. Rev Infect Dis 1988, 10 Suppl 4, S771–784. [Google Scholar] [CrossRef]
- Dietzschold, B.; Tollis, M.; Lafon, M.; Wunner, W.H.; Koprowski, H. Mechanisms of rabies virus neutralization by glycoprotein-specific monoclonal antibodies. Virology 1987, 161, 29–36. [Google Scholar] [CrossRef] [PubMed]
- Liu, J.; Zhao, W.; He, W.; Wang, N.; Su, J.; Ji, S.; Chen, J.; Wang, D.; Zhou, J.; Su, S. Generation of Monoclonal Antibodies against Variable Epitopes of the M Protein of Rabies Virus. Viruses 2019, 11. [Google Scholar] [CrossRef]
- Zhao, W.; Su, J.; Zhao, N.; Liu, J.; Su, S. Development of Monoclonal Antibodies for Detection of Conserved and Variable Epitopes of Large Protein of Rabies Virus. Viruses 2021, 13. [Google Scholar] [CrossRef] [PubMed]
- Jiang, Y.; Luo, Y.; Michel, F.; Hogan, R.J.; He, Y.; Fu, Z.F. Characterization of conformation-specific monoclonal antibodies against rabies virus nucleoprotein. Arch Virol 2010, 155, 1187–1192. [Google Scholar] [CrossRef] [PubMed]
- Du Pont, V.; Plemper, R.K.; Schnell, M.J. Status of antiviral therapeutics against rabies virus and related emerging lyssaviruses. Curr Opin Virol 2019, 35, 1–13. [Google Scholar] [CrossRef]
- Zhao, J.; Wang, S.; Zhang, S.; Liu, Y.; Zhang, J.; Zhang, F.; Mi, L.; Hu, R. Molecular characterization of a rabies virus isolate from a rabid dog in Hanzhong District, Shaanxi Province, China. Arch Virol 2014, 159, 1481–1486. [Google Scholar] [CrossRef]
- Tohma, K.; Saito, M.; Kamigaki, T.; Tuason, L.T.; Demetria, C.S.; Orbina, J.R.; Manalo, D.L.; Miranda, M.E.; Noguchi, A.; Inoue, S. , et al. Phylogeographic analysis of rabies viruses in the Philippines. Infect Genet Evol 2014, 23, 86–94. [Google Scholar] [CrossRef]
- de Melo, G.D.; Hellert, J.; Gupta, R.; Corti, D.; Bourhy, H. Monoclonal antibodies against rabies: current uses in prophylaxis and in therapy. Curr Opin Virol 2022, 53, 101204. [Google Scholar] [CrossRef]
- de Melo, G.D.; Sonthonnax, F.; Lepousez, G.; Jouvion, G.; Minola, A.; Zatta, F.; Larrous, F.; Kergoat, L.; Mazo, C.; Moigneu, C. , et al. A combination of two human monoclonal antibodies cures symptomatic rabies. EMBO Mol Med 2020, 12, e12628. [Google Scholar] [CrossRef]




| Protein | Number of sequences from NCBI | RABV-GEO sequences | Number of clusters | Number of clusters containing RABV-GEO samples |
|---|---|---|---|---|
| N | 7,489 | 77 | 2 | 1 |
| P | 2,579 | 77 | 9 | 1 |
| M | 2,178 | 77 | 4 | 1 |
| G | 5,915 | 77 | 5 | 1 |
| L | 2,948 | 77 | 5 | 1 |
| Epitope ID | Epitope Sequence | Difference in representative sequence (if relevant, colored red and bold) | Protein Name | Protein ID | Protein Accession | Start | End |
|---|---|---|---|---|---|---|---|
| 1336019 | EIFSIP | - | L | ADJ29912.1 | P11213 | 1479 | 1484 |
| 1336142 | RALSK | - | L | ADJ29912.1 | P11213 | 1659 | 1663 |
| 1336215 | VFNSL | - | L | ADJ29912.1 | P11213 | 1724 | 1728 |
| 93714 | RKLGWWLKL | not present in representative sequence set | L | SRC266014 | P11213 | ||
| 929568 | PPDDD | - | M | CEH11416.1 | P08671 | 42 | 46 |
| 929569 | PPYDDD | not present in representative sequence set | M | ADJ29910.1 | P08671 | 25 | 30 |
| 12638 | EKDDLSVEAEIAHQIA | EEDDLSVEAEIAHQIA | P | P69479.1 | P06747 | 191 | 206 |
| 1795 | AHLQGEPIEVDNLPEDMKRLQLDDKKPSGL | AHLQGEPIEVDNLPEDMRRLNLDDGKSPNL | P | AAK54996.1 | P06747 | 37 | 66 |
| 20735 | GKYREDFQMDEGDPS | GKYREDFQMDEGEDP | P | SRC279966 | P06747 | ||
| 23111 | GVQIVRQIRSGERFLKIWSQ | GVQIVRQMRSGERFLKIWSQ | P | NP_056794.1 | P06747 | 101 | 120 |
| 31389 | KIPLRCVLGWVALANSKKFQLLVEADKLSKIMQDDLNRYTSC | KLPLRCVLGWVALANSKKFQLLVEADKLSRIMQDDLNRYASS | P | AAZ07892.1 | P06747 | 256 | 297 |
| 31531 | KKETTSISSQRDSQSSKA | KKETTSTPSQRESQSSKA | P | AAK54996.1 | P06747 | 154 | 171 |
| 38005 | LMDEGEDPSLLFQSYLDNVGVQIVRQMRSGER | QMDEGEDPSLLFQSYLDNVGVQIVRQMRSGER | P | AAK54996.1 | P06747 | 82 | 113 |
| 451183 | VLGWV | - | P | AAK55085.1 | P06747 | 262 | 266 |
| 53736 | RFLKIWSQTVEEIISYVAVN | RFLKIWSQTVEEIISYVTVN | P | P69479.1 | P06747 | 113 | 132 |
| 59254 | SLLFQSYLDNVGVQIVRQIR | SLLFQSYLDNVGVQIVRQMR | P | NP_056794.1 | P06747 | 90 | 109 |
| 68113 | VEAEIAHQI | - | P | P15198.1 | P06747 | 197 | 205 |
| 93760 | RQMKSGGRF | RQMRSGERF | P | AAY23584.1 | P06747 | 68 | 76 |
| 94299 | YLDNVGVHI | YLDNVGVQI | P | AAK55014.1 | P06747 | 96 | 104 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).